Citrus Sinensis ID: 023638


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MPEQPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSETKKPGVRLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSVDGASVPEEEKEGHAWLQEGEKPKDLLVIGSFYIGPEIVEN
cccccccccccccccccEEEEEEEccccEEEEEEEcccccccccccccccHHEEEEEEEEEEEEEEcccccccccccccccccccccccEEcccccccccccEEccccccccccEEEEEccccccEEEEEcccccccccccccccEEEEEEEccccccccccccccccccEEEEEEEEcEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccccccccccEEEEEccccccccccccccccccccEEEEEEEcccccEEEEccccccccEEcc
cccccccccccccccccEEEEEEEEcccEEEEEEEEccccEEccccccccEEEEEEEEEEEEEEEccccccccccccccEEEcccEEEcccccEEEcccccccEEEEEEcccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEccccccEEEEEEcccHEEHEEcccccccccccccEEEEEccccccccccccccccccccEEEEEEccccccEEEEcccccccccccc
mpeqpyfrrqagrkypaiTYQHIFECekfsmgifclppsgviplhnhpgmtvFSKLLFGtmhiksydwvvdvpsdtsadaagvpgktsAVAVdaipgetsaaavdiipgkplaamvdvipgkplaaavdavpdknsadvvndngntsadavdvpskmstdanpsetkkpgvrlakvkadsdltapcntsilypadggnmhcFTAVTACAVLdvlgppysdsegrhctyyqdfpfanfsvdgasvpeeekeghawlqegekpkdllvigsfyigpeiven
mpeqpyfrrqagrkypAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNgntsadavdvpskmstdanpsetkkpgvrlakvkadsdltapcNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSVDGASVPEEEKEGHAwlqegekpkdllVIGSFYIGPEIVEN
MPEQPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSETKKPGVRLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSVDGASVPEEEKEGHAWLQEGEKPKDLLVIGSFYIGPEIVEN
***********GRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPS**************AVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAV*****************************************************LTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSVDG************WL******KDLLVIGSFYIGPE****
***********GRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVV*******************VAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPS*************PGVRLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFP*******************AWLQEGEKPKDLLVIGSFYIGP*****
*********QAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPS****************RLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSVDGAS*********AWLQEGEKPKDLLVIGSFYIGPEIVEN
****PYFR***GRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSETKKPGVRLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSV*********KEGHAWLQEGEKPKDLLVIGSFYIGP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEQPYFRRQAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSADAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMSTDANPSETKKPGVRLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSVDGASVPEEEKEGHAWLQEGEKPKDLLVIGSFYIGPEIVEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q6PDY2256 2-aminoethanethiol dioxyg yes no 0.146 0.160 0.490 2e-09
Q556I2218 Probable 2-aminoethanethi yes no 0.182 0.233 0.461 7e-09
Q96SZ5270 2-aminoethanethiol dioxyg yes no 0.143 0.148 0.48 1e-07
>sp|Q6PDY2|AEDO_MOUSE 2-aminoethanethiol dioxygenase OS=Mus musculus GN=Ado PE=1 SV=2 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (63%)

Query: 13  RKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYD 67
           R  P +TY HI+E E FS+G+F L     IPLH+HPGM    K+L+GT+ I   D
Sbjct: 68  RNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGTVRISCMD 122





Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: 3EC: .EC: 1EC: 1EC: .EC: 1EC: 9
>sp|Q556I2|AEDO_DICDI Probable 2-aminoethanethiol dioxygenase OS=Dictyostelium discoideum GN=ado-1 PE=3 SV=2 Back     alignment and function description
>sp|Q96SZ5|AEDO_HUMAN 2-aminoethanethiol dioxygenase OS=Homo sapiens GN=ADO PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
225452714279 PREDICTED: 2-aminoethanethiol dioxygenas 0.462 0.462 0.728 9e-48
356572403281 PREDICTED: 2-aminoethanethiol dioxygenas 0.448 0.444 0.684 4e-46
356550744281 PREDICTED: 2-aminoethanethiol dioxygenas 0.448 0.444 0.676 7e-46
356531790287 PREDICTED: 2-aminoethanethiol dioxygenas 0.465 0.452 0.679 2e-45
225452718268 PREDICTED: 2-aminoethanethiol dioxygenas 0.412 0.429 0.756 7e-44
255552872288 Protein C10orf22, putative [Ricinus comm 0.458 0.444 0.696 7e-44
356572405276 PREDICTED: 2-aminoethanethiol dioxygenas 0.448 0.452 0.669 5e-43
449459462288 PREDICTED: 2-aminoethanethiol dioxygenas 0.358 0.347 0.733 1e-42
449520916210 PREDICTED: 2-aminoethanethiol dioxygenas 0.358 0.476 0.733 2e-42
356568634288 PREDICTED: 2-aminoethanethiol dioxygenas 0.462 0.447 0.648 1e-41
>gi|225452714|ref|XP_002282633.1| PREDICTED: 2-aminoethanethiol dioxygenase isoform 2 [Vitis vinifera] gi|296082863|emb|CBI22164.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  196 bits (498), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 94/129 (72%), Positives = 106/129 (82%)

Query: 150 AVDVPSKMSTDANPSETKKPGVRLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACA 209
           AV  P   S +ANPS+ + PGV+LAKVK D+D TAPCN+SILYPADGGNMH FTA+TACA
Sbjct: 150 AVGSPCNPSANANPSQIQHPGVQLAKVKVDADFTAPCNSSILYPADGGNMHRFTALTACA 209

Query: 210 VLDVLGPPYSDSEGRHCTYYQDFPFANFSVDGASVPEEEKEGHAWLQEGEKPKDLLVIGS 269
           VLDVLGPPYSD EGR CTYY DFPF NFSVDG SVPEEE+EG+AWLQE EK +D  V+G+
Sbjct: 210 VLDVLGPPYSDPEGRDCTYYFDFPFTNFSVDGVSVPEEEREGYAWLQEREKLEDFAVVGA 269

Query: 270 FYIGPEIVE 278
            Y GP IVE
Sbjct: 270 VYNGPMIVE 278




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356572403|ref|XP_003554358.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356550744|ref|XP_003543744.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Back     alignment and taxonomy information
>gi|356531790|ref|XP_003534459.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Back     alignment and taxonomy information
>gi|225452718|ref|XP_002282644.1| PREDICTED: 2-aminoethanethiol dioxygenase isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552872|ref|XP_002517479.1| Protein C10orf22, putative [Ricinus communis] gi|223543490|gb|EEF45021.1| Protein C10orf22, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356572405|ref|XP_003554359.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449459462|ref|XP_004147465.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520916|ref|XP_004167478.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356568634|ref|XP_003552515.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2150866293 AT5G15120 [Arabidopsis thalian 0.376 0.358 0.623 2e-63
TAIR|locus:2014169282 AT1G18490 "AT1G18490" [Arabido 0.376 0.372 0.457 9.6e-44
TAIR|locus:2041524242 AT2G42670 [Arabidopsis thalian 0.261 0.301 0.565 5.2e-43
TAIR|locus:2098984242 AT3G58670 [Arabidopsis thalian 0.254 0.293 0.549 3.2e-41
TAIR|locus:2178032276 AT5G39890 [Arabidopsis thalian 0.383 0.387 0.75 7.5e-41
ZFIN|ZDB-GENE-041212-62248 adoa "2-aminoethanethiol (cyst 0.218 0.245 0.475 1.6e-19
ZFIN|ZDB-GENE-040426-2267254 adob "2-aminoethanethiol (cyst 0.229 0.251 0.441 1.2e-18
MGI|MGI:2685083256 Ado "2-aminoethanethiol (cyste 0.197 0.214 0.490 1.7e-17
RGD|1308233256 Ado "2-aminoethanethiol (cyste 0.197 0.214 0.472 2.8e-17
UNIPROTKB|Q96SZ5270 ADO "2-aminoethanethiol dioxyg 0.186 0.192 0.480 3.2e-16
TAIR|locus:2150866 AT5G15120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 2.0e-63, Sum P(2) = 2.0e-63
 Identities = 68/109 (62%), Positives = 81/109 (74%)

Query:   172 RLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQD 231
             RLAK+K DS  TAPCN SILYP DGGNMH FTA+TACAVLDVLGPPY + EGRHCTY+ +
Sbjct:   183 RLAKLKVDSTFTAPCNASILYPEDGGNMHRFTAITACAVLDVLGPPYCNPEGRHCTYFLE 242

Query:   232 FPFANFSVDGASV--PEEEKEGHAWLQE-GEKPKDLL-VIGSFYIGPEI 276
             FP    S +   V   EEEKEG+AWLQE  + P+D   V+G+ Y GP++
Sbjct:   243 FPLDKLSSEDDDVLSSEEEKEGYAWLQERDDNPEDHTNVVGALYRGPKV 291


GO:0005634 "nucleus" evidence=ISM
GO:0047800 "cysteamine dioxygenase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009061 "anaerobic respiration" evidence=IEP;IMP
GO:0001666 "response to hypoxia" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0044036 "cell wall macromolecule metabolic process" evidence=RCA
TAIR|locus:2014169 AT1G18490 "AT1G18490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041524 AT2G42670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098984 AT3G58670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178032 AT5G39890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041212-62 adoa "2-aminoethanethiol (cysteamine) dioxygenase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2267 adob "2-aminoethanethiol (cysteamine) dioxygenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2685083 Ado "2-aminoethanethiol (cysteamine) dioxygenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308233 Ado "2-aminoethanethiol (cysteamine) dioxygenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96SZ5 ADO "2-aminoethanethiol dioxygenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.13.11LOW CONFIDENCE prediction!
3rd Layer1.13.11.19LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
pfam07847194 pfam07847, DUF1637, Protein of unknown function (D 6e-37
pfam07847194 pfam07847, DUF1637, Protein of unknown function (D 9e-33
>gnl|CDD|219605 pfam07847, DUF1637, Protein of unknown function (DUF1637) Back     alignment and domain information
 Score =  129 bits (326), Expect = 6e-37
 Identities = 47/80 (58%), Positives = 61/80 (76%), Gaps = 2/80 (2%)

Query: 2  PEQPYFRR--QAGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFG 59
          PE  YFR   ++G+  P +TY HI+EC+ FSMG+FCLPP  VIPLH+HPGMTV SK+L+G
Sbjct: 14 PELFYFRAAAKSGKSRPPVTYLHIYECDDFSMGVFCLPPGAVIPLHDHPGMTVLSKVLYG 73

Query: 60 TMHIKSYDWVVDVPSDTSAD 79
          ++H+KSYDWV   P DT+  
Sbjct: 74 SLHVKSYDWVDGEPLDTTRG 93


This family contains many eukaryotic hypothetical proteins. The region featured in this family is approximately 120 residues long. According to InterPro annotation, some members of this family may belong to the cupin superfamily. Length = 194

>gnl|CDD|219605 pfam07847, DUF1637, Protein of unknown function (DUF1637) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG4281236 consensus Uncharacterized conserved protein [Funct 100.0
PF07847200 DUF1637: Protein of unknown function (DUF1637); In 100.0
PF05995175 CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 98.44
COG1917131 Uncharacterized conserved protein, contains double 96.06
PRK13290125 ectC L-ectoine synthase; Reviewed 95.78
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 94.34
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 94.14
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 94.02
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 93.22
smart00835146 Cupin_1 Cupin. This family represents the conserve 92.55
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 91.83
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 83.99
>KOG4281 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=2.6e-70  Score=490.51  Aligned_cols=188  Identities=57%  Similarity=1.073  Sum_probs=172.2

Q ss_pred             CCCcccccc--cCCCCCCeEEEEeeccCCeEEEEEecCCCCcccCCCCCCCeeeeeeeecceEEEEeecccCCCCCCccc
Q 023638            2 PEQPYFRRQ--AGRKYPAITYQHIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSAD   79 (279)
Q Consensus         2 ~~~~~~~~~--~~~~~~pItY~~IyE~~~FSmgIF~LppGa~IPLHDHPgMtV~sKVLyGsl~VkSYDwv~~~~~~~~~~   79 (279)
                      +++++||+.  ..|..++|+|||||||+.|||||||||+|++||||||||||||||+|||+|||+||||+++++..+.  
T Consensus        46 ~~~~~~~~~~~~~rn~ppitYlhi~EcD~FSigiFclp~ss~IPLHdHPgM~v~sKllyGtmhVksyDw~ePd~~~~~--  123 (236)
T KOG4281|consen   46 PEMQYFRPSGVSERNLPPITYLHIHECDRFSIGIFCLPPSSVIPLHDHPGMTVLSKLLYGTMHVKSYDWVEPDEPQTE--  123 (236)
T ss_pred             hhhhhccCCCCCcCCCCCceEEEEEecCceeEEEEEcCCCCeeecCCCcchHHHHHhhhceeEeeeccccCCCCcccC--
Confidence            678899972  3466789999999999999999999999999999999999999999999999999999986554332  


Q ss_pred             ccCCCCcccccccccCCCccccccccccCCCCccceecccCCCccccccccCCCCCCcccccCCCCCcCcccccCCCCCC
Q 023638           80 AAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAMVDVIPGKPLAAAVDAVPDKNSADVVNDNGNTSADAVDVPSKMST  159 (279)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~v~v~~~~~~  159 (279)
                                                                                                      
T Consensus       124 --------------------------------------------------------------------------------  123 (236)
T KOG4281|consen  124 --------------------------------------------------------------------------------  123 (236)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCCCCCCCceeEeEEeecccccCCCCeEEeecCCCCCeeeeeecCceeEeEeeCCCCCCCCCCCCccceecCCCCccC
Q 023638          160 DANPSETKKPGVRLAKVKADSDLTAPCNTSILYPADGGNMHCFTAVTACAVLDVLGPPYSDSEGRHCTYYQDFPFANFSV  239 (279)
Q Consensus       160 ~~~p~~~~~~~~rlAk~~~d~~~ta~~~t~vLyP~~gGNlH~ftAvtpcA~LDVL~PPY~~~~gR~CtYY~~~p~~~~~~  239 (279)
                        .|.    ..+|+|||+.|.++|++|++++|||++|||+|||+|+|+|||||||+|||+.+.||+|+||+++++..++.
T Consensus       124 --dp~----q~~r~akl~~d~~~T~~s~~~~LyP~~ggn~h~f~a~t~cAvlDILsPPY~~~~gR~C~Yyr~~p~~~~~~  197 (236)
T KOG4281|consen  124 --DPH----QPVRPAKLVSDKEFTAASPASTLYPKTGGNHHCFTAITPCAVLDILSPPYDSDHGRHCTYYRDYPFSSLSG  197 (236)
T ss_pred             --CCC----cceeeeeEeccceecCCCCCcEeeecCCCcEeeeeeccceeEEeeccCCCCCCCCcCceEEeccCccccCC
Confidence              111    23899999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             CCCCCCccccCcceEEEeeCCCCCeEEeCeecCCCeee
Q 023638          240 DGASVPEEEKEGHAWLQEGEKPKDLLVIGSFYIGPEIV  277 (279)
Q Consensus       240 ~~~~~~~~~~~~~~wL~e~~~P~df~~~~~~Y~GP~i~  277 (279)
                      +...++++++++++||+|+.+|+||+|.+++|+||.|.
T Consensus       198 ~~~~s~~~~~~~~~wL~E~~~~D~f~~~~~~Y~gp~i~  235 (236)
T KOG4281|consen  198 DCVVSSEEEKEDVAWLEERQPPDDFVCRGEPYRGPKIR  235 (236)
T ss_pred             ceeecCccccccceeeeccCCcccceEeccccCCCccC
Confidence            77778899999999999999999999999999999985



>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine Back     alignment and domain information
>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 98.66
3uss_A211 Putative uncharacterized protein; cupin, three his 98.58
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 98.45
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 98.42
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 97.54
1v70_A105 Probable antibiotics synthesis protein; structural 97.47
3h8u_A125 Uncharacterized conserved protein with double-STR 97.47
2q30_A110 Uncharacterized protein; double-stranded beta-heli 97.41
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 97.0
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 96.92
3rns_A227 Cupin 2 conserved barrel domain protein; structura 96.55
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 96.18
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 96.16
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 96.13
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 95.96
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 95.95
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 95.84
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 95.54
3rns_A227 Cupin 2 conserved barrel domain protein; structura 95.38
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 95.21
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 94.98
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 94.91
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 94.91
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 94.34
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 94.13
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 93.71
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 93.5
3cjx_A165 Protein of unknown function with A cupin-like FOL; 93.28
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 92.98
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 92.48
3lwc_A119 Uncharacterized protein; structural genomics, unkn 92.47
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 92.34
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 92.27
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 91.61
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 91.31
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 91.15
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 90.86
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 90.35
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 90.33
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 90.28
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 90.19
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 90.07
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 89.94
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 89.7
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 89.11
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 88.79
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 88.55
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 88.42
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 88.38
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 88.31
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 87.91
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 87.52
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 86.88
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 86.56
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 86.02
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 85.09
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 84.47
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 83.02
1vj2_A126 Novel manganese-containing cupin TM1459; structura 82.94
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 82.89
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 82.8
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 82.17
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 82.17
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 81.74
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 81.59
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 81.0
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
Probab=98.66  E-value=1.5e-07  Score=81.73  Aligned_cols=49  Identities=27%  Similarity=0.472  Sum_probs=45.0

Q ss_pred             Eeec-cCCeEEEEEecCCCCcccCCCCCCCeeeeeeeecceEEEEeeccc
Q 023638           22 HIFE-CEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVV   70 (279)
Q Consensus        22 ~IyE-~~~FSmgIF~LppGa~IPLHDHPgMtV~sKVLyGsl~VkSYDwv~   70 (279)
                      -||+ +..|+|-+++.+||...|+|||.+..++.+||.|.++.+.|+|.+
T Consensus        62 ll~~~~~~~~l~ll~W~PGq~SpiHDH~~s~g~i~VL~G~l~e~~y~~~~  111 (200)
T 3eln_A           62 LVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPD  111 (200)
T ss_dssp             EEECGGGTCEEEEEEECTTCBCCEECCTTCEEEEEEEESCEEEEEECCCC
T ss_pred             eeecCCCceEEEEEEECCCCcCCCccCCCceEEEEEEeeeEEEEEeecCC
Confidence            4566 578999999999999999999999999999999999999999853



>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d3elna1186 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {R 8e-08
d1v70a_105 b.82.1.9 (A:) Hypothetical protein TTHA0104 {Therm 0.001
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Length = 186 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Cysteine dioxygenase type I
domain: Cysteine dioxygenase type I
species: Rattus norvegicus [TaxId: 10116]
 Score = 48.9 bits (116), Expect = 8e-08
 Identities = 17/103 (16%), Positives = 31/103 (30%), Gaps = 10/103 (9%)

Query: 22  HIFECEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVVDVPSDTSA--- 78
                 KF++ I C        +H+H     F KLL G +    +DW     ++      
Sbjct: 59  VDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSE 118

Query: 79  ------DAAGVPGKTSAVAVDAIPGETSAAAVDIIPGKPLAAM 115
                   A +        V+ +     A ++ +    P    
Sbjct: 119 RTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLY-SPPFDTC 160


>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Length = 105 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 99.55
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 98.38
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 97.67
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 97.39
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 96.59
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 95.29
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 95.19
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 93.86
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 92.45
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 89.89
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 89.48
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 89.45
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 88.24
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 87.42
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 86.48
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 85.22
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 84.32
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 83.97
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 82.95
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 80.02
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Cysteine dioxygenase type I
domain: Cysteine dioxygenase type I
species: Rattus norvegicus [TaxId: 10116]
Probab=99.55  E-value=2.9e-14  Score=119.70  Aligned_cols=52  Identities=27%  Similarity=0.454  Sum_probs=46.8

Q ss_pred             EEEEeec-cCCeEEEEEecCCCCcccCCCCCCCeeeeeeeecceEEEEeeccc
Q 023638           19 TYQHIFE-CEKFSMGIFCLPPSGVIPLHNHPGMTVFSKLLFGTMHIKSYDWVV   70 (279)
Q Consensus        19 tY~~IyE-~~~FSmgIF~LppGa~IPLHDHPgMtV~sKVLyGsl~VkSYDwv~   70 (279)
                      +.--||+ +++|+|.++|.+||...|+|||++|.+++|||.|+++.+.|+|.+
T Consensus        55 ~R~li~~~~~~fel~li~W~pGq~tpiHDH~~~~~~~~vl~G~l~e~~Y~~~~  107 (186)
T d3elna1          55 TRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPD  107 (186)
T ss_dssp             EEEEEECGGGTCEEEEEEECTTCBCCEECCTTCEEEEEEEESCEEEEEECCCC
T ss_pred             EEEEEEcCCCCeEEEEEEccCCCcCCCccCCCCcEEEEEcccceEEEEeecCC
Confidence            3445665 678999999999999999999999999999999999999999874



>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure