Citrus Sinensis ID: 023670
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 279 | ||||||
| TAIR|locus:2168818 | 280 | SDH2-2 "succinate dehydrogenas | 0.989 | 0.985 | 0.772 | 5.4e-118 | |
| TAIR|locus:2086716 | 279 | SDH2-1 "succinate dehydrogenas | 0.989 | 0.989 | 0.773 | 1.8e-117 | |
| FB|FBgn0014028 | 297 | SdhB "Succinate dehydrogenase | 0.863 | 0.811 | 0.632 | 2e-86 | |
| UNIPROTKB|F1NNF7 | 290 | SDHB "Succinate dehydrogenase | 0.921 | 0.886 | 0.6 | 1.8e-85 | |
| UNIPROTKB|Q9YHT2 | 290 | SDHB "Succinate dehydrogenase | 0.842 | 0.810 | 0.645 | 3e-85 | |
| UNIPROTKB|Q3B8J8 | 282 | sdhb "Succinate dehydrogenase | 0.921 | 0.911 | 0.594 | 3e-85 | |
| UNIPROTKB|B0BM36 | 284 | sdhb "Succinate dehydrogenase | 0.863 | 0.848 | 0.636 | 1e-84 | |
| ZFIN|ZDB-GENE-030131-8005 | 280 | sdhb "succinate dehydrogenase | 0.910 | 0.907 | 0.606 | 1e-84 | |
| POMBASE|SPAC140.01 | 275 | sdh2 "succinate dehydrogenase | 0.888 | 0.901 | 0.614 | 1.3e-84 | |
| TAIR|locus:504954878 | 309 | SDH2-3 "succinate dehydrogenas | 0.820 | 0.741 | 0.665 | 1.5e-83 |
| TAIR|locus:2168818 SDH2-2 "succinate dehydrogenase 2-2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1162 (414.1 bits), Expect = 5.4e-118, P = 5.4e-118
Identities = 214/277 (77%), Positives = 234/277 (84%)
Query: 1 MATGLXXXXXXXXXX-VAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDS 59
MA GL ++ ARL+ AR+ ++ +EAQ K FQIYRWNPD+
Sbjct: 1 MAFGLIGRVVGTKSSRLSTAARLIPARWTSTGSEAQSKASTGGGGASLKTFQIYRWNPDN 60
Query: 60 PSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLA 119
P KPEL++++I+LK+CGPMVLDALIKIK+E+DPSLTFRRSCREGICGSCAMNIDGCNGLA
Sbjct: 61 PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA 120
Query: 120 CLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQS 179
CLTKI +TITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP +PGKEI QS
Sbjct: 121 CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS 180
Query: 180 KKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANRWISDSRDEYTKERLEA 239
KKDRAKLDGMYECILCACCSTSCPSYWW E+YLGPAALLHANRWISDSRDEYTKERLEA
Sbjct: 181 KKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEA 240
Query: 240 IDDEFKLYRCHTILNCARACPKGLNPGKQIINIKQLQ 276
IDDEFKLYRCHTILNCARACPKGLNPGKQI +IKQLQ
Sbjct: 241 IDDEFKLYRCHTILNCARACPKGLNPGKQITHIKQLQ 277
|
|
| TAIR|locus:2086716 SDH2-1 "succinate dehydrogenase 2-1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0014028 SdhB "Succinate dehydrogenase B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NNF7 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9YHT2 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3B8J8 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B0BM36 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-8005 sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC140.01 sdh2 "succinate dehydrogenase (ubiquinone) iron-sulfur protein subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954878 SDH2-3 "succinate dehydrogenase 2-3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| PLN00129 | 276 | PLN00129, PLN00129, succinate dehydrogenase [ubiqu | 1e-180 | |
| PRK05950 | 232 | PRK05950, sdhB, succinate dehydrogenase iron-sulfu | 1e-146 | |
| COG0479 | 234 | COG0479, FrdB, Succinate dehydrogenase/fumarate re | 1e-105 | |
| TIGR00384 | 220 | TIGR00384, dhsB, succinate dehydrogenase and fumar | 1e-97 | |
| PRK12575 | 235 | PRK12575, PRK12575, succinate dehydrogenase iron-s | 4e-92 | |
| PRK12577 | 329 | PRK12577, PRK12577, succinate dehydrogenase iron-s | 3e-54 | |
| PRK12576 | 279 | PRK12576, PRK12576, succinate dehydrogenase iron-s | 7e-49 | |
| pfam13085 | 107 | pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind | 3e-47 | |
| PRK12385 | 244 | PRK12385, PRK12385, fumarate reductase iron-sulfur | 2e-42 | |
| PRK06259 | 486 | PRK06259, PRK06259, succinate dehydrogenase/fumara | 1e-38 | |
| PRK13552 | 239 | PRK13552, frdB, fumarate reductase iron-sulfur sub | 3e-37 | |
| PRK08640 | 249 | PRK08640, sdhB, succinate dehydrogenase iron-sulfu | 1e-19 | |
| PRK12386 | 251 | PRK12386, PRK12386, fumarate reductase iron-sulfur | 5e-17 | |
| pfam13534 | 61 | pfam13534, Fer4_17, 4Fe-4S dicluster domain | 2e-06 | |
| PRK07570 | 250 | PRK07570, PRK07570, succinate dehydrogenase/fumara | 2e-05 | |
| COG0247 | 388 | COG0247, GlpC, Fe-S oxidoreductase [Energy product | 1e-04 | |
| pfam13183 | 54 | pfam13183, Fer4_8, 4Fe-4S dicluster domain | 0.002 |
| >gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit | Back alignment and domain information |
|---|
Score = 497 bits (1281), Expect = e-180
Identities = 195/280 (69%), Positives = 216/280 (77%), Gaps = 5/280 (1%)
Query: 1 MATGLIRRAISSSAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSP 60
MA GL+RR + A + PA A A+ + K K S ++ K+FQIYRWNPD+P
Sbjct: 1 MAAGLLRRLAGAKAGLLAPA----AAASAAASAETKASSKGSKPSNLKEFQIYRWNPDNP 56
Query: 61 SKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLAC 120
KP L+ ++++L +CGPMVLD LIKIK+E DPSLTFRRSCREGICGSCAMNIDG N LAC
Sbjct: 57 GKPHLQSYKVDLNDCGPMVLDVLIKIKNEQDPSLTFRRSCREGICGSCAMNIDGKNTLAC 116
Query: 121 LTKISP-SGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQS 179
LTKI +TITPLPHMFVIKDLVVDMTNFY QYKSIEPWLK K PP KE QS
Sbjct: 117 LTKIDRDESGPTTITPLPHMFVIKDLVVDMTNFYQQYKSIEPWLKTKKPPEDGQKEHLQS 176
Query: 180 KKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANRWISDSRDEYTKERLEA 239
K+DRAKLDGMYECILCACCSTSCPSYWW E +LGPAALLHA RWISDSRDEYTKERLEA
Sbjct: 177 KEDRAKLDGMYECILCACCSTSCPSYWWNPEKFLGPAALLHAYRWISDSRDEYTKERLEA 236
Query: 240 IDDEFKLYRCHTILNCARACPKGLNPGKQIINIKQLQLKR 279
+DDEFKLYRCHTI NC+ ACPKGLNP K I IKQL
Sbjct: 237 LDDEFKLYRCHTIRNCSNACPKGLNPAKAIAKIKQLLGLG 276
|
Length = 276 |
| >gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181515 PRK08640, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237086 PRK12386, PRK12386, fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|181038 PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223325 COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| KOG3049 | 288 | consensus Succinate dehydrogenase, Fe-S protein su | 100.0 | |
| PLN00129 | 276 | succinate dehydrogenase [ubiquinone] iron-sulfur s | 100.0 | |
| COG0479 | 234 | FrdB Succinate dehydrogenase/fumarate reductase, F | 100.0 | |
| PRK12575 | 235 | succinate dehydrogenase iron-sulfur subunit; Provi | 100.0 | |
| PRK13552 | 239 | frdB fumarate reductase iron-sulfur subunit; Provi | 100.0 | |
| PRK08640 | 249 | sdhB succinate dehydrogenase iron-sulfur subunit; | 100.0 | |
| PRK12385 | 244 | fumarate reductase iron-sulfur subunit; Provisiona | 100.0 | |
| PRK12386 | 251 | fumarate reductase iron-sulfur subunit; Provisiona | 100.0 | |
| PRK12577 | 329 | succinate dehydrogenase iron-sulfur subunit; Provi | 100.0 | |
| PRK05950 | 232 | sdhB succinate dehydrogenase iron-sulfur subunit; | 100.0 | |
| PRK12576 | 279 | succinate dehydrogenase iron-sulfur subunit; Provi | 100.0 | |
| TIGR00384 | 220 | dhsB succinate dehydrogenase and fumarate reductas | 100.0 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 100.0 | |
| PRK06259 | 486 | succinate dehydrogenase/fumarate reductase iron-su | 100.0 | |
| PF13085 | 110 | Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; | 100.0 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 99.84 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 99.83 | |
| PTZ00305 | 297 | NADH:ubiquinone oxidoreductase; Provisional | 99.83 | |
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 99.79 | |
| COG1034 | 693 | NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc | 99.78 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 99.77 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 99.75 | |
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 99.74 | |
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 99.74 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 99.66 | |
| PRK11274 | 407 | glcF glycolate oxidase iron-sulfur subunit; Provis | 99.43 | |
| COG1150 | 195 | HdrC Heterodisulfide reductase, subunit C [Energy | 99.33 | |
| TIGR03290 | 144 | CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s | 99.28 | |
| COG1139 | 459 | Uncharacterized conserved protein containing a fer | 99.2 | |
| TIGR00273 | 432 | iron-sulfur cluster-binding protein. Members of th | 99.19 | |
| TIGR03193 | 148 | 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm | 99.18 | |
| PRK11433 | 217 | aldehyde oxidoreductase 2Fe-2S subunit; Provisiona | 99.16 | |
| PF13510 | 82 | Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; | 99.15 | |
| PRK11168 | 396 | glpC sn-glycerol-3-phosphate dehydrogenase subunit | 99.15 | |
| PRK09908 | 159 | xanthine dehydrogenase subunit XdhC; Provisional | 99.12 | |
| COG2080 | 156 | CoxS Aerobic-type carbon monoxide dehydrogenase, s | 99.05 | |
| TIGR03379 | 397 | glycerol3P_GlpC glycerol-3-phosphate dehydrogenase | 99.03 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 98.95 | |
| COG0247 | 388 | GlpC Fe-S oxidoreductase [Energy production and co | 98.93 | |
| TIGR03198 | 151 | pucE xanthine dehydrogenase E subunit. This gene h | 98.92 | |
| PF13183 | 57 | Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ | 98.92 | |
| PF13534 | 61 | Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 | 98.87 | |
| PRK15055 | 344 | anaerobic sulfite reductase subunit A; Provisional | 98.72 | |
| KOG2282 | 708 | consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 | 98.59 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 98.57 | |
| PRK09800 | 956 | putative hypoxanthine oxidase; Provisional | 98.52 | |
| TIGR03313 | 951 | Se_sel_red_Mo probable selenate reductase, molybde | 98.5 | |
| cd00207 | 84 | fer2 2Fe-2S iron-sulfur cluster binding domain. Ir | 98.48 | |
| PRK00941 | 781 | acetyl-CoA decarbonylase/synthase complex subunit | 98.47 | |
| TIGR02910 | 334 | sulfite_red_A sulfite reductase, subunit A. Member | 98.44 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 98.41 | |
| cd01916 | 731 | ACS_1 Acetyl-CoA synthase (ACS), also known as ace | 98.41 | |
| TIGR02963 | 467 | xanthine_xdhA xanthine dehydrogenase, small subuni | 98.38 | |
| TIGR00314 | 784 | cdhA CO dehydrogenase/acetyl-CoA synthase complex, | 98.38 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 98.34 | |
| TIGR03311 | 848 | Se_dep_Molyb_1 selenium-dependent molybdenum hydro | 98.33 | |
| PF00111 | 78 | Fer2: 2Fe-2S iron-sulfur cluster binding domain; I | 98.29 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 98.26 | |
| CHL00134 | 99 | petF ferredoxin; Validated | 98.23 | |
| TIGR02008 | 97 | fdx_plant ferredoxin [2Fe-2S]. This model represen | 98.2 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 98.19 | |
| TIGR02484 | 372 | CitB CitB domain protein. CobZ is essential for co | 98.17 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 98.15 | |
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 98.14 | |
| PF13746 | 69 | Fer4_18: 4Fe-4S dicluster domain | 98.14 | |
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 98.12 | |
| PF13237 | 52 | Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. | 98.11 | |
| PRK10713 | 84 | 2Fe-2S ferredoxin YfaE; Provisional | 98.03 | |
| TIGR02007 | 110 | fdx_isc ferredoxin, 2Fe-2S type, ISC system. This | 98.01 | |
| PLN00192 | 1344 | aldehyde oxidase | 97.98 | |
| PLN02593 | 117 | adrenodoxin-like ferredoxin protein | 97.98 | |
| KOG3256 | 212 | consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 | 97.96 | |
| TIGR02969 | 1330 | mam_aldehyde_ox aldehyde oxidase. Members of this | 97.88 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 97.88 | |
| PLN03136 | 148 | Ferredoxin; Provisional | 97.86 | |
| PRK15033 | 389 | tricarballylate utilization protein B; Provisional | 97.86 | |
| TIGR00403 | 183 | ndhI NADH-plastoquinone oxidoreductase subunit I p | 97.86 | |
| COG1152 | 772 | CdhA CO dehydrogenase/acetyl-CoA synthase alpha su | 97.73 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 97.7 | |
| PTZ00038 | 191 | ferredoxin; Provisional | 97.69 | |
| PTZ00490 | 143 | Ferredoxin superfamily; Provisional | 97.65 | |
| COG0633 | 102 | Fdx Ferredoxin [Energy production and conversion] | 97.64 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 97.61 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 97.52 | |
| CHL00014 | 167 | ndhI NADH dehydrogenase subunit I | 97.5 | |
| PRK14028 | 312 | pyruvate ferredoxin oxidoreductase subunit gamma/d | 97.5 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 97.47 | |
| TIGR02160 | 352 | PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, | 97.45 | |
| PLN02906 | 1319 | xanthine dehydrogenase | 97.41 | |
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 97.38 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 97.38 | |
| PRK05713 | 312 | hypothetical protein; Provisional | 97.37 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 97.32 | |
| PRK08222 | 181 | hydrogenase 4 subunit H; Validated | 97.32 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 97.31 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 97.3 | |
| PRK11872 | 340 | antC anthranilate dioxygenase reductase; Provision | 97.28 | |
| TIGR01971 | 122 | NuoI NADH-quinone oxidoreductase, chain I. This mo | 97.28 | |
| PRK07609 | 339 | CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat | 97.25 | |
| PRK06273 | 165 | ferredoxin; Provisional | 97.24 | |
| TIGR02176 | 1165 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid | 97.24 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 97.22 | |
| PRK05113 | 191 | electron transport complex protein RnfB; Provision | 97.16 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 97.16 | |
| PRK09477 | 271 | napH quinol dehydrogenase membrane component; Prov | 97.13 | |
| TIGR02163 | 255 | napH_ ferredoxin-type protein, NapH/MauN family. M | 97.13 | |
| PRK09625 | 133 | porD pyruvate flavodoxin oxidoreductase subunit de | 97.07 | |
| PF13484 | 67 | Fer4_16: 4Fe-4S double cluster binding domain | 97.04 | |
| TIGR02512 | 374 | Fe_only_hydrog hydrogenases, Fe-only. This model d | 97.03 | |
| PF12798 | 15 | Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 | 96.98 | |
| TIGR02494 | 295 | PFLE_PFLC glycyl-radical enzyme activating protein | 96.96 | |
| PRK06991 | 270 | ferredoxin; Provisional | 96.92 | |
| TIGR01941 | 405 | nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo | 96.91 | |
| PRK10684 | 332 | HCP oxidoreductase, NADH-dependent; Provisional | 96.87 | |
| PRK12387 | 180 | formate hydrogenlyase complex iron-sulfur subunit; | 96.85 | |
| PRK09624 | 105 | porD pyuvate ferredoxin oxidoreductase subunit del | 96.81 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 96.81 | |
| PRK05464 | 409 | Na(+)-translocating NADH-quinone reductase subunit | 96.8 | |
| COG1146 | 68 | Ferredoxin [Energy production and conversion] | 96.79 | |
| TIGR01944 | 165 | rnfB electron transport complex, RnfABCDGE type, B | 96.75 | |
| PRK09623 | 105 | vorD 2-ketoisovalerate ferredoxin oxidoreductase s | 96.74 | |
| PRK08764 | 135 | ferredoxin; Provisional | 96.73 | |
| TIGR00402 | 101 | napF ferredoxin-type protein NapF. The gene codes | 96.73 | |
| PRK09326 | 341 | F420H2 dehydrogenase subunit F; Provisional | 96.71 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 96.6 | |
| TIGR02179 | 78 | PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta | 96.57 | |
| PF12797 | 22 | Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 | 96.55 | |
| TIGR02912 | 314 | sulfite_red_C sulfite reductase, subunit C. Member | 96.5 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 96.5 | |
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 96.44 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 96.39 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 96.39 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 96.38 | |
| PF12837 | 24 | Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 | 96.29 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 96.27 | |
| COG2768 | 354 | Uncharacterized Fe-S center protein [General funct | 96.16 | |
| PF12800 | 17 | Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 | 96.06 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 96.06 | |
| PF00037 | 24 | Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T | 96.06 | |
| TIGR02060 | 132 | aprB adenosine phosphosulphate reductase, beta sub | 96.04 | |
| COG4630 | 493 | XdhA Xanthine dehydrogenase, iron-sulfur cluster a | 95.92 | |
| PF12837 | 24 | Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 | 95.92 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 95.67 | |
| TIGR02745 | 434 | ccoG_rdxA_fixG cytochrome c oxidase accessory prot | 95.58 | |
| TIGR00397 | 213 | mauM_napG MauM/NapG family ferredoxin-type protein | 95.56 | |
| PF12800 | 17 | Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 | 95.56 | |
| TIGR02700 | 234 | flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T | 95.56 | |
| COG1144 | 91 | Pyruvate:ferredoxin oxidoreductase and related 2-o | 95.35 | |
| PF00037 | 24 | Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T | 95.18 | |
| TIGR03336 | 595 | IOR_alpha indolepyruvate ferredoxin oxidoreductase | 95.17 | |
| TIGR00276 | 282 | iron-sulfur cluster binding protein, putative. Thi | 95.16 | |
| TIGR03287 | 391 | methan_mark_16 putative methanogenesis marker 16 m | 95.07 | |
| TIGR01582 | 283 | FDH-beta formate dehydrogenase, beta subunit, Fe-S | 95.02 | |
| KOG0430 | 1257 | consensus Xanthine dehydrogenase [Nucleotide trans | 94.9 | |
| TIGR01660 | 492 | narH nitrate reductase, beta subunit. The Nitrate | 94.89 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 94.84 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 94.84 | |
| TIGR00397 | 213 | mauM_napG MauM/NapG family ferredoxin-type protein | 94.66 | |
| PF12798 | 15 | Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 | 94.64 | |
| PRK10330 | 181 | formate dehydrogenase-H ferredoxin subunit; Provis | 94.64 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 94.61 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 94.49 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 94.46 | |
| PRK09476 | 254 | napG quinol dehydrogenase periplasmic component; P | 94.44 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 94.42 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 94.39 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 94.35 | |
| PRK13795 | 636 | hypothetical protein; Provisional | 94.3 | |
| PRK00054 | 250 | dihydroorotate dehydrogenase electron transfer sub | 94.29 | |
| PRK07118 | 280 | ferredoxin; Validated | 94.2 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 94.18 | |
| TIGR02951 | 161 | DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi | 94.15 | |
| PRK10330 | 181 | formate dehydrogenase-H ferredoxin subunit; Provis | 94.13 | |
| PF13247 | 98 | Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX | 94.13 | |
| TIGR01582 | 283 | FDH-beta formate dehydrogenase, beta subunit, Fe-S | 94.12 | |
| TIGR03294 | 228 | FrhG coenzyme F420 hydrogenase, subunit gamma. Thi | 94.08 | |
| KOG3309 | 159 | consensus Ferredoxin [Energy production and conver | 94.03 | |
| TIGR02951 | 161 | DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi | 94.02 | |
| PRK07118 | 280 | ferredoxin; Validated | 94.01 | |
| PF12797 | 22 | Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 | 94.0 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 93.97 | |
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 93.94 | |
| PRK09476 | 254 | napG quinol dehydrogenase periplasmic component; P | 93.81 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 93.63 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 93.58 | |
| TIGR02486 | 314 | RDH reductive dehalogenase. This model represents | 93.25 | |
| TIGR01660 | 492 | narH nitrate reductase, beta subunit. The Nitrate | 93.17 | |
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 93.06 | |
| COG2878 | 198 | Predicted NADH:ubiquinone oxidoreductase, subunit | 92.96 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 92.89 | |
| COG3894 | 614 | Uncharacterized metal-binding protein [General fun | 92.83 | |
| cd07030 | 259 | RNAP_D D subunit of Archaeal RNA polymerase. The D | 92.74 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 92.58 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 92.43 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 92.35 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 92.34 | |
| COG4231 | 640 | Indolepyruvate ferredoxin oxidoreductase, alpha an | 92.32 | |
| PF13746 | 69 | Fer4_18: 4Fe-4S dicluster domain | 92.26 | |
| COG2221 | 317 | DsrA Dissimilatory sulfite reductase (desulfovirid | 92.14 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 91.89 | |
| PRK00783 | 263 | DNA-directed RNA polymerase subunit D; Provisional | 91.79 | |
| TIGR02066 | 341 | dsrB sulfite reductase, dissimilatory-type beta su | 91.68 | |
| PRK01777 | 95 | hypothetical protein; Validated | 91.6 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 91.52 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 91.43 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 91.03 | |
| PRK12387 | 180 | formate hydrogenlyase complex iron-sulfur subunit; | 90.97 | |
| PF13484 | 67 | Fer4_16: 4Fe-4S double cluster binding domain | 90.94 | |
| cd06219 | 248 | DHOD_e_trans_like1 FAD/NAD binding domain in the e | 90.9 | |
| PF13237 | 52 | Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. | 90.86 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 90.78 | |
| cd06192 | 243 | DHOD_e_trans_like FAD/NAD binding domain (electron | 90.53 | |
| TIGR02745 | 434 | ccoG_rdxA_fixG cytochrome c oxidase accessory prot | 90.42 | |
| PF13247 | 98 | Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX | 90.35 | |
| PRK05802 | 320 | hypothetical protein; Provisional | 90.23 | |
| KOG3256 | 212 | consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 | 89.87 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 89.84 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 89.82 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 89.67 | |
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 89.35 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 89.12 | |
| cd06218 | 246 | DHOD_e_trans FAD/NAD binding domain in the electro | 88.96 | |
| COG2871 | 410 | NqrF Na+-transporting NADH:ubiquinone oxidoreducta | 88.83 | |
| PRK06222 | 281 | ferredoxin-NADP(+) reductase subunit alpha; Review | 88.66 | |
| COG1600 | 337 | Uncharacterized Fe-S protein [Energy production an | 88.37 | |
| PF13534 | 61 | Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 | 88.34 | |
| PF10418 | 40 | DHODB_Fe-S_bind: Iron-sulfur cluster binding domai | 87.38 | |
| PF13183 | 57 | Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ | 87.05 | |
| cd06220 | 233 | DHOD_e_trans_like2 FAD/NAD binding domain in the e | 86.74 | |
| PRK08345 | 289 | cytochrome-c3 hydrogenase subunit gamma; Provision | 86.2 | |
| COG1150 | 195 | HdrC Heterodisulfide reductase, subunit C [Energy | 85.52 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 85.04 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 84.91 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 84.78 | |
| PRK05659 | 66 | sulfur carrier protein ThiS; Validated | 84.72 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 84.42 | |
| PF14691 | 111 | Fer4_20: Dihydroprymidine dehydrogenase domain II, | 83.89 | |
| COG1152 | 772 | CdhA CO dehydrogenase/acetyl-CoA synthase alpha su | 83.76 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 83.62 | |
| COG1941 | 247 | FrhG Coenzyme F420-reducing hydrogenase, gamma sub | 83.4 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 83.39 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 83.23 | |
| COG1146 | 68 | Ferredoxin [Energy production and conversion] | 82.77 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 82.67 | |
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 82.55 | |
| TIGR01683 | 64 | thiS thiamine biosynthesis protein ThiS. This mode | 82.37 | |
| PRK09477 | 271 | napH quinol dehydrogenase membrane component; Prov | 82.27 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 81.61 | |
| TIGR02163 | 255 | napH_ ferredoxin-type protein, NapH/MauN family. M | 81.6 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 81.57 | |
| PF14157 | 63 | YmzC: YmzC-like protein; PDB: 3KVP_E. | 81.43 | |
| PF13459 | 65 | Fer4_15: 4Fe-4S single cluster domain | 81.0 | |
| CHL00014 | 167 | ndhI NADH dehydrogenase subunit I | 80.58 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 80.33 | |
| TIGR00403 | 183 | ndhI NADH-plastoquinone oxidoreductase subunit I p | 80.13 |
| >KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-70 Score=467.90 Aligned_cols=237 Identities=69% Similarity=1.276 Sum_probs=224.3
Q ss_pred CCCCCceeEEEEEeeCCCCC-CCCceEEEEEeccCCCchHHHHHHHcccCCCCCccccCCCCCCccCeeEEEECCeeecc
Q 023670 41 ASANTDTKKFQIYRWNPDSP-SKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLA 119 (279)
Q Consensus 41 ~~~~~~~~~~~i~R~~p~~~-~~~~~~~~~v~~~~~g~tvLdal~~~~~~~dptl~~~~~c~~g~CG~C~v~inG~~~lA 119 (279)
++.+++.++|+|||||||.+ .+|+.|+|+|+.+++|.+|||||.+|+++.||||+||+|||+||||||+|+|||.+.||
T Consensus 40 ~~~~~rlKtFeIYRwnPd~pg~kP~~Q~y~vDL~~CGpMvLDALiKIKnE~DptLTFRRSCREGICGSCAMNI~G~NtLA 119 (288)
T KOG3049|consen 40 AATGPRLKTFEIYRWNPDNPGDKPHLQTYEVDLNDCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGTNTLA 119 (288)
T ss_pred cccCCccceEEEEecCCCCCCCCccceeeeecHHhcchHHHHHHHHhhcccCCceehhhhhhccccccceeccCCCceeE
Confidence 45578999999999999988 69999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccC-CCCceEEeeCCCCcchhhhhhccchhhhhhhccccccccCCCCCC-CCCCCCCChhhHhhhcccccCcccCc
Q 023670 120 CLTKISP-SGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPM-PGKEIPQSKKDRAKLDGMYECILCAC 197 (279)
Q Consensus 120 C~t~v~~-g~~~~~iepl~~~~vikDLvvD~~~~~~~~~~~~p~l~~~~~~~~-~~~~~~~s~~~~~~~~~~~~CI~CG~ 197 (279)
|.++|+. ++...+|.||+|+.||||||+|++.||++|++++||++.++.... .+++++||.+++.++++++.||+|.+
T Consensus 120 Ci~kId~n~sK~~kIyPLPHmfvvkDLVpDm~~FY~QYksIqPwlqrk~~~~~~g~~q~lQS~~dR~kLDGlYECILCAC 199 (288)
T KOG3049|consen 120 CICKIDQNESKSTKIYPLPHMFVVKDLVPDMTNFYAQYKSIEPWLQRKNPAKEPGKKQYLQSVEDRAKLDGLYECILCAC 199 (288)
T ss_pred EEEeeccCCcccceeecCcceeeehhhcccHHHHHHHHhcccHHhhcCCcccCccHHHHHHhHHHHHhhccHHHHHHHHH
Confidence 9999994 577889999999999999999999999999999999998765431 35788999999999999999999999
Q ss_pred ccCCCCCcccCCCcccCHHHHHHHHHHhhcCcchhHHHHHHHhhcccCccCchhhhhhhhhCCCCCChHHHHHHHHHHHH
Q 023670 198 CSTSCPSYWWTSEAYLGPAALLHANRWISDSRDEYTKERLEAIDDEFKLYRCHTILNCARACPKGLNPGKQIINIKQLQL 277 (279)
Q Consensus 198 C~~~CP~~~~~~~~~~gP~~l~~a~r~~~d~r~~~~~erl~~l~~~~~~~~C~~Cg~C~~vCP~gi~~~~~I~~lR~~~~ 277 (279)
|+.+||+||||.+.|+||++++++|||+.|+||+.+++|+..+.+++.+|+|++..+|+..||+|++|+.+|.+++..++
T Consensus 200 CsTSCPSYWWN~ekYLGPAvLmqAyRWiiDSRD~~t~eRl~~l~d~~slyrCHtImNCtrtCPKgLNPg~aI~eiK~ll~ 279 (288)
T KOG3049|consen 200 CSTSCPSYWWNSEKYLGPAVLMQAYRWIIDSRDEATKERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKLLA 279 (288)
T ss_pred hcCCCcccccCcccccCHHHHHHHHhhhhcchhHHHHHHHHHhcCchhheehhhhhhhhhcCCCCCCHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999998999999999999999999999999999999998875
|
|
| >PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit | Back alignment and domain information |
|---|
| >COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12385 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12386 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PTZ00305 NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C | Back alignment and domain information |
|---|
| >COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00273 iron-sulfur cluster-binding protein | Back alignment and domain information |
|---|
| >TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit | Back alignment and domain information |
|---|
| >PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional | Back alignment and domain information |
|---|
| >PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK09908 xanthine dehydrogenase subunit XdhC; Provisional | Back alignment and domain information |
|---|
| >COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03198 pucE xanthine dehydrogenase E subunit | Back alignment and domain information |
|---|
| >PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N | Back alignment and domain information |
|---|
| >PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B | Back alignment and domain information |
|---|
| >PRK15055 anaerobic sulfite reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >PRK09800 putative hypoxanthine oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit | Back alignment and domain information |
|---|
| >cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR02910 sulfite_red_A sulfite reductase, subunit A | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA | Back alignment and domain information |
|---|
| >TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit | Back alignment and domain information |
|---|
| >TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 | Back alignment and domain information |
|---|
| >PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions | Back alignment and domain information |
|---|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >CHL00134 petF ferredoxin; Validated | Back alignment and domain information |
|---|
| >TIGR02008 fdx_plant ferredoxin [2Fe-2S] | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02484 CitB CitB domain protein | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PF13746 Fer4_18: 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A | Back alignment and domain information |
|---|
| >PRK10713 2Fe-2S ferredoxin YfaE; Provisional | Back alignment and domain information |
|---|
| >TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system | Back alignment and domain information |
|---|
| >PLN00192 aldehyde oxidase | Back alignment and domain information |
|---|
| >PLN02593 adrenodoxin-like ferredoxin protein | Back alignment and domain information |
|---|
| >KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02969 mam_aldehyde_ox aldehyde oxidase | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >PLN03136 Ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK15033 tricarballylate utilization protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
| >COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00038 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PTZ00490 Ferredoxin superfamily; Provisional | Back alignment and domain information |
|---|
| >COG0633 Fdx Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >CHL00014 ndhI NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >PLN02906 xanthine dehydrogenase | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >PRK05713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >PRK08222 hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >PRK11872 antC anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01971 NuoI NADH-quinone oxidoreductase, chain I | Back alignment and domain information |
|---|
| >PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >PRK06273 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >PRK05113 electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09477 napH quinol dehydrogenase membrane component; Provisional | Back alignment and domain information |
|---|
| >TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PF13484 Fer4_16: 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >TIGR02512 Fe_only_hydrog hydrogenases, Fe-only | Back alignment and domain information |
|---|
| >PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family | Back alignment and domain information |
|---|
| >PRK06991 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
| >PRK10684 HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >COG1146 Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PRK08764 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00402 napF ferredoxin-type protein NapF | Back alignment and domain information |
|---|
| >PRK09326 F420H2 dehydrogenase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family | Back alignment and domain information |
|---|
| >PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02912 sulfite_red_C sulfite reductase, subunit C | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2768 Uncharacterized Fe-S center protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit | Back alignment and domain information |
|---|
| >COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family | Back alignment and domain information |
|---|
| >COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR00276 iron-sulfur cluster binding protein, putative | Back alignment and domain information |
|---|
| >TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein | Back alignment and domain information |
|---|
| >TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing | Back alignment and domain information |
|---|
| >KOG0430 consensus Xanthine dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01660 narH nitrate reductase, beta subunit | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK09476 napG quinol dehydrogenase periplasmic component; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13795 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B | Back alignment and domain information |
|---|
| >TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing | Back alignment and domain information |
|---|
| >TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma | Back alignment and domain information |
|---|
| >KOG3309 consensus Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >PRK09476 napG quinol dehydrogenase periplasmic component; Provisional | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >TIGR02486 RDH reductive dehalogenase | Back alignment and domain information |
|---|
| >TIGR01660 narH nitrate reductase, beta subunit | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG3894 Uncharacterized metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd07030 RNAP_D D subunit of Archaeal RNA polymerase | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13746 Fer4_18: 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK00783 DNA-directed RNA polymerase subunit D; Provisional | Back alignment and domain information |
|---|
| >TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit | Back alignment and domain information |
|---|
| >PRK01777 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF13484 Fer4_16: 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A | Back alignment and domain information |
|---|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B | Back alignment and domain information |
|---|
| >PRK05802 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >COG1600 Uncharacterized Fe-S protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B | Back alignment and domain information |
|---|
| >PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] | Back alignment and domain information |
|---|
| >PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N | Back alignment and domain information |
|---|
| >cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05659 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >COG1146 Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR01683 thiS thiamine biosynthesis protein ThiS | Back alignment and domain information |
|---|
| >PRK09477 napH quinol dehydrogenase membrane component; Provisional | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >PF14157 YmzC: YmzC-like protein; PDB: 3KVP_E | Back alignment and domain information |
|---|
| >PF13459 Fer4_15: 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >CHL00014 ndhI NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 279 | ||||
| 1yq3_B | 252 | Avian Respiratory Complex Ii With Oxaloacetate And | 3e-91 | ||
| 1zoy_B | 252 | Crystal Structure Of Mitochondrial Respiratory Comp | 1e-86 | ||
| 3abv_B | 252 | Crystal Structure Of Porcine Heart Mitochondrial Co | 1e-86 | ||
| 3vr8_B | 282 | Mitochondrial Rhodoquinol-Fumarate Reductase From T | 3e-81 | ||
| 1nek_B | 238 | Complex Ii (Succinate Dehydrogenase) From E. Coli W | 9e-67 | ||
| 2wp9_B | 238 | Crystal Structure Of The E. Coli Succinate:quinone | 1e-65 | ||
| 1kf6_B | 243 | E. Coli Quinol-Fumarate Reductase With Bound Inhibi | 3e-30 | ||
| 2bs2_B | 241 | Quinol:fumarate Reductase From Wolinella Succinogen | 6e-25 | ||
| 1qlb_B | 239 | Respiratory Complex Ii-Like Fumarate Reductase From | 7e-25 |
| >pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 | Back alignment and structure |
|
| >pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 | Back alignment and structure |
| >pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 | Back alignment and structure |
| >pdb|3VR8|B Chain B, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 282 | Back alignment and structure |
| >pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 | Back alignment and structure |
| >pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 | Back alignment and structure |
| >pdb|1KF6|B Chain B, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 243 | Back alignment and structure |
| >pdb|2BS2|B Chain B, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 241 | Back alignment and structure |
| >pdb|1QLB|B Chain B, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 239 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 1e-143 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 1e-143 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 1e-141 | |
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 1e-135 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 1e-132 | |
| 3kwl_A | 514 | Uncharacterized protein; putative oxidoreductase, | 3e-56 |
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 | Back alignment and structure |
|---|
Score = 402 bits (1034), Expect = e-143
Identities = 122/235 (51%), Positives = 162/235 (68%), Gaps = 6/235 (2%)
Query: 49 KFQIYRWNPDSPSKPELKEFEINLKECGPM-VLDALIKIKSEIDPSLTFRRSCREGICGS 107
+F IYR+NPD P ++++ + E M +LDALI++K E DPSL+FRRSCREG+CGS
Sbjct: 4 EFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLK-EKDPSLSFRRSCREGVCGS 62
Query: 108 CAMNIDGCNGLACLTKIS---PSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLK 164
+N++G NGLAC+T IS G I PLP + VI+DLVVDM FY QY+ I+P+L
Sbjct: 63 DGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLL 122
Query: 165 RKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANRW 224
P P +E Q + R KLDG+YECILCACCSTSCPS+WW + ++GPA LL A R+
Sbjct: 123 NNGQNP-PAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRF 181
Query: 225 ISDSRDEYTKERLEAIDDEFKLYRCHTILNCARACPKGLNPGKQIINIKQLQLKR 279
+ DSRD T RL+ + D F ++RCH+I+NC CPKGLNP + I +IK + L+R
Sbjct: 182 LIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQR 236
|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 | Back alignment and structure |
|---|
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 | Back alignment and structure |
|---|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 | Back alignment and structure |
|---|
| >3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 100.0 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 100.0 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 100.0 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 100.0 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 100.0 | |
| 3kwl_A | 514 | Uncharacterized protein; putative oxidoreductase, | 100.0 | |
| 1rm6_C | 161 | 4-hydroxybenzoyl-COA reductase gamma subunit; xant | 99.82 | |
| 1t3q_A | 168 | Quinoline 2-oxidoreductase small subunit; QOR, mol | 99.77 | |
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 99.76 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 99.68 | |
| 1ffv_A | 163 | CUTS, iron-sulfur protein of carbon monoxide dehyd | 99.57 | |
| 1n62_A | 166 | Carbon monoxide dehydrogenase small chain; CODH, m | 99.56 | |
| 3hrd_D | 160 | Nicotinate dehydrogenase small FES subunit; seleni | 99.29 | |
| 2w3s_A | 462 | Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 | 99.02 | |
| 1vlb_A | 907 | Aldehyde oxidoreductase; iron-sulphur cluster; HET | 98.96 | |
| 3nvw_A | 164 | Xanthine dehydrogenase/oxidase; hydroxylase, homod | 98.95 | |
| 1dgj_A | 907 | Aldehyde oxidoreductase; beta half-barrel, four-he | 98.87 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 98.63 | |
| 1frr_A | 95 | Ferredoxin I; electron transfer(iron-sulfur protei | 98.6 | |
| 1frd_A | 98 | Heterocyst [2Fe-2S] ferredoxin; electron transport | 98.57 | |
| 1jq4_A | 98 | Methane monooxygenase component C; [2Fe-2S] ferred | 98.51 | |
| 1awd_A | 94 | Ferredoxin; electron transport, eukaryotic, green | 98.5 | |
| 1a70_A | 97 | Ferredoxin; iron-sulfur protein, photosynthesis, e | 98.48 | |
| 1iue_A | 98 | Ferredoxin; electron transport, iron-sulfur; 1.70A | 98.48 | |
| 1czp_A | 98 | Ferredoxin I; [2Fe-2S] protein, crystal reduced wi | 98.43 | |
| 1wri_A | 93 | Ferredoxin II, ferredoxin; electron transport; 1.2 | 98.31 | |
| 2bt6_A | 108 | Adrenodoxin 1; ruthenium(II) bipyridyl complex, in | 98.21 | |
| 1l5p_A | 93 | Ferredoxin; [2Fe-2S] cluster, electron transfer, i | 98.2 | |
| 2wlb_A | 103 | ETP1-FD, electron transfer protein 1, mitochondria | 98.17 | |
| 2y5c_A | 109 | Adrenodoxin-like protein, mitochondrial; electron | 98.08 | |
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 98.04 | |
| 3lxf_A | 104 | Ferredoxin; iron, iron-sulfur, metal-binding, meta | 98.0 | |
| 1doi_A | 128 | 2Fe-2S ferredoxin; halophilic protein, redox prote | 97.99 | |
| 3ah7_A | 113 | [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur | 97.97 | |
| 1xlq_A | 106 | Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored | 97.96 | |
| 3unc_A | 1332 | Xanthine dehydrogenase/oxidase; oxidoreductase; HE | 97.95 | |
| 1i7h_A | 111 | Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch | 97.95 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 97.94 | |
| 1b9r_A | 105 | Protein (terpredoxin); structure from molmol, ferr | 97.89 | |
| 3hui_A | 126 | Ferredoxin; cytochrome P450, electron transfer, ir | 97.86 | |
| 1uwm_A | 106 | Ferredoxin VI, FDVI; electron transport, metal-bin | 97.85 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 97.61 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 97.58 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 97.58 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 97.52 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 97.51 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 97.48 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 97.42 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 97.41 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 97.39 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 97.38 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 97.29 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 97.28 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 97.24 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 97.23 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 97.02 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 96.97 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 96.92 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 96.88 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 96.78 | |
| 1jnr_B | 150 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.76 | |
| 3gyx_B | 166 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.74 | |
| 3zyv_A | 1335 | AOH1; oxidoreductase, molybdenum cofactor; HET: MT | 96.71 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 96.66 | |
| 3zyy_X | 631 | Iron-sulfur cluster binding protein; iron-sulfur-b | 96.49 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 96.44 | |
| 3n9z_C | 123 | Adrenodoxin; cytochrome P450, 22-hydroxycholestero | 96.37 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 95.86 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 95.74 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 95.62 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 95.6 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 95.58 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 95.53 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 95.46 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 95.42 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 94.9 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 94.39 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 94.27 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 93.89 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 92.38 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 90.87 | |
| 3mm5_B | 366 | Sulfite reductase, dissimilatory-type subunit BET; | 89.74 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 89.33 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 89.27 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 89.19 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 88.89 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 88.76 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 88.7 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 88.42 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 87.73 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 87.52 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 87.16 | |
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 86.62 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 85.82 | |
| 3mm5_A | 418 | Sulfite reductase, dissimilatory-type subunit ALP; | 85.58 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 85.47 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 83.33 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 82.51 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 82.24 | |
| 1ep3_B | 262 | Dihydroorotate dehydrogenase B (PYRK subunit); het | 82.19 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 81.47 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 80.62 | |
| 2pa8_D | 265 | DNA-directed RNA polymerase subunit D; ferredoxin- | 80.54 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 80.16 |
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.5e-65 Score=462.43 Aligned_cols=238 Identities=58% Similarity=1.121 Sum_probs=215.7
Q ss_pred CCCCCceeEEEEEeeCCCC-CCCCceEEEEEeccCCCchHHHHHHHcccCCCCCccccCCCCCCccCeeEEEECCeeecc
Q 023670 41 ASANTDTKKFQIYRWNPDS-PSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLA 119 (279)
Q Consensus 41 ~~~~~~~~~~~i~R~~p~~-~~~~~~~~~~v~~~~~g~tvLdal~~~~~~~dptl~~~~~c~~g~CG~C~v~inG~~~lA 119 (279)
+.+.+++++|+||||||+. +++||||+|+|+++++|+||||||+++++++||+|+|+.+|++|+||+|+|+|||++++|
T Consensus 29 ~~~~~~~~~~~I~R~~p~~~~~~p~~~~~~v~v~~~~~tlLdaL~~i~~~~~ptl~~~~~C~~G~CGsC~V~InG~~~la 108 (282)
T 3vr8_B 29 APTGKRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLA 108 (282)
T ss_pred ccCCCeeEEEEEEEeCCCCCCCCCCcEEEEEEeCCCCCcHHHHHHhcCcccCCceeecCCCCCCCCCCCEEEECCEEecc
Confidence 3456789999999999985 678999999999976579999999999987899999999999999999999999999999
Q ss_pred ccccccC-CCCceEEeeCCCCcchhhhhhccchhhhhhhccccccccCCCCCCCCCCCCCChhhHhhhcccccCcccCcc
Q 023670 120 CLTKISP-SGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSKKDRAKLDGMYECILCACC 198 (279)
Q Consensus 120 C~t~v~~-g~~~~~iepl~~~~vikDLvvD~~~~~~~~~~~~p~l~~~~~~~~~~~~~~~s~~~~~~~~~~~~CI~CG~C 198 (279)
|.|++.+ .++.++||||++||||||||||++.||++|++++||+..+...+...++++|+++++++++++++||+||+|
T Consensus 109 C~t~v~~~~~~~~tIepL~~~pVikDLvvD~~~f~~~~~~v~p~l~~~~~~~~~~~~~~qs~~~~~~~~~~~~CI~CG~C 188 (282)
T 3vr8_B 109 CICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACC 188 (282)
T ss_pred hhhhHhHhcCCcEEeccCCCCceeeccccccHHHHHHHHHHhhhcCCCCCCCCCchhcccCHHHHHHHHhhhhCcccCcC
Confidence 9999983 467899999999999999999999999999999999987654322356788999999999999999999999
Q ss_pred cCCCCCcccCCCcccCHHHHHHHHHHhhcCcchhHHHHHHHhhcccCccCchhhhhhhhhCCCCCChHHHHHHHHHHHHh
Q 023670 199 STSCPSYWWTSEAYLGPAALLHANRWISDSRDEYTKERLEAIDDEFKLYRCHTILNCARACPKGLNPGKQIINIKQLQLK 278 (279)
Q Consensus 199 ~~~CP~~~~~~~~~~gP~~l~~a~r~~~d~r~~~~~erl~~l~~~~~~~~C~~Cg~C~~vCP~gi~~~~~I~~lR~~~~~ 278 (279)
.++||++++++++|+||++++++++++.++++....++++.+.+..++|.|++||+|+.+||+||++.++|..+|+++++
T Consensus 189 ~~aCP~~~~~~~~~lGP~~li~a~r~~~d~rd~~~~erl~~l~~~~~l~~C~~Cg~C~~vCP~gI~~~~~I~~lR~~l~~ 268 (282)
T 3vr8_B 189 SASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTK 268 (282)
T ss_pred cccCCceeccCCcCCCHHHHHHHHHHHhCCcccchHHHHHHHhhcCCcccChhhCCccccCcCCCCHHHHHHHHHHHHHH
Confidence 99999999887889999999999999999988766677776655678999999999999999999999999999999875
|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* | Back alignment and structure |
|---|
| >1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 | Back alignment and structure |
|---|
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* | Back alignment and structure |
|---|
| >1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* | Back alignment and structure |
|---|
| >3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* | Back alignment and structure |
|---|
| >1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* | Back alignment and structure |
|---|
| >3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* | Back alignment and structure |
|---|
| >1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 | Back alignment and structure |
|---|
| >1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A | Back alignment and structure |
|---|
| >1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... | Back alignment and structure |
|---|
| >1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* | Back alignment and structure |
|---|
| >1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
| >3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 | Back alignment and structure |
|---|
| >1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A | Back alignment and structure |
|---|
| >3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A | Back alignment and structure |
|---|
| >3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* | Back alignment and structure |
|---|
| >1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A | Back alignment and structure |
|---|
| >1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* | Back alignment and structure |
|---|
| >3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* | Back alignment and structure |
|---|
| >3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 | Back alignment and structure |
|---|
| >2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 279 | ||||
| d1kf6b2 | 105 | d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur | 3e-39 | |
| d1nekb1 | 132 | a.1.2.1 (B:107-238) Succinate dehydogenase {Escher | 9e-38 | |
| d1kf6b1 | 138 | a.1.2.1 (B:106-243) Fumarate reductase {Escherichi | 3e-37 | |
| d2bs2b2 | 106 | d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur | 2e-36 | |
| d2bs2b1 | 133 | a.1.2.1 (B:107-239) Fumarate reductase {Wolinella | 5e-36 | |
| d1nekb2 | 106 | d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul | 2e-34 |
| >d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: 2Fe-2S ferredoxin-like family: 2Fe-2S ferredoxin domains from multidomain proteins domain: Fumarate reductase iron-sulfur protein, N-terminal domain species: Escherichia coli [TaxId: 562]
Score = 130 bits (329), Expect = 3e-39
Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 1/106 (0%)
Query: 43 ANTDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCRE 102
A K ++ R+NP+ + P +E+ + +LDAL IK + P L++R SCR
Sbjct: 1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPY-DATTSLLDALGYIKDNLAPDLSYRWSCRM 59
Query: 103 GICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVD 148
ICGSC M ++ LAC T + + L + + +DLVVD
Sbjct: 60 AICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVD 105
|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 | Back information, alignment and structure |
|---|
| >d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| d1kf6b2 | 105 | Fumarate reductase iron-sulfur protein, N-terminal | 100.0 | |
| d2bs2b2 | 106 | Fumarate reductase iron-sulfur protein, N-terminal | 100.0 | |
| d1nekb2 | 106 | Succinate dehydogenase iron-sulfur protein, N-term | 100.0 | |
| d1nekb1 | 132 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 99.95 | |
| d1kf6b1 | 138 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 99.95 | |
| d2bs2b1 | 133 | Fumarate reductase {Wolinella succinogenes [TaxId: | 99.9 | |
| d1rm6c2 | 81 | 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, | 99.3 | |
| d1t3qa2 | 81 | Quinoline 2-oxidoreductase small subunit QorS, N-d | 99.3 | |
| d1ffva2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 99.26 | |
| d3c8ya2 | 126 | Fe-only hydrogenase, N-terminal domain {Clostridiu | 99.26 | |
| d1vlba2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 99.2 | |
| d1n62a2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 99.18 | |
| d1dgja2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 99.17 | |
| d1jroa2 | 84 | Xanthine dehydrogenase chain A, N-terminal domain | 98.9 | |
| d2fug33 | 95 | Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi | 98.79 | |
| d1v97a2 | 90 | Xanthine oxidase, N-terminal domain {Cow (Bos taur | 98.66 | |
| d2fug34 | 151 | NADH-quinone oxidoreductase chain 3, Nqo3, domain | 98.54 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 98.39 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 98.3 | |
| d1czpa_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 98.2 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 98.17 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 98.12 | |
| d1a70a_ | 97 | 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta | 98.07 | |
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 98.06 | |
| d1frda_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 97.98 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 97.98 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 97.98 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 97.95 | |
| d1jq4a_ | 98 | Methane monooxygenase reductase N-terminal domain | 97.95 | |
| d2piaa3 | 98 | Phthalate dioxygenase reductase, C-terminal domain | 97.92 | |
| d1frra_ | 95 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 97.83 | |
| d1awda_ | 94 | 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | 97.81 | |
| d1iuea_ | 98 | 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa | 97.81 | |
| d1e9ma_ | 106 | 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo | 97.73 | |
| d1l5pa_ | 93 | 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 | 97.73 | |
| d1krha3 | 104 | Benzoate dioxygenase reductase, N-terminal domain | 97.72 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 97.67 | |
| d2bt6a1 | 104 | Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | 97.66 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 97.62 | |
| d1doia_ | 128 | 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui | 97.61 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 97.61 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 97.58 | |
| d1wria_ | 93 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 97.57 | |
| d1xlqa1 | 106 | 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox | 97.56 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 97.55 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 97.5 | |
| d1i7ha_ | 109 | Adrenodoxin-like ferredoxin {Escherichia coli [Tax | 97.49 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 97.49 | |
| d1b9ra_ | 105 | 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T | 97.46 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 97.45 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 97.26 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 97.09 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 97.02 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 96.67 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 96.2 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 95.67 | |
| d1vlfn2 | 195 | Transhydroxylase beta subunit, BthL, N-terminal do | 95.33 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 95.0 | |
| d1h0hb_ | 214 | Tungsten containing formate dehydrogenase, small s | 94.35 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 94.02 | |
| d1ep3b2 | 160 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 93.26 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 92.46 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 91.9 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 91.57 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 91.34 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 91.05 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 90.76 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 90.63 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 90.21 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 89.88 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 89.8 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 88.82 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 88.68 | |
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 87.66 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 87.42 | |
| d2v4jb1 | 69 | DsrB insert domain {Desulfovibrio vulgaris [TaxId: | 86.85 | |
| d1nekb1 | 132 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 86.42 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 85.52 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 85.49 | |
| d1gtea1 | 182 | Dihydropyrimidine dehydrogenase, N-terminal domain | 84.76 | |
| d2bs2b1 | 133 | Fumarate reductase {Wolinella succinogenes [TaxId: | 84.47 | |
| d1kf6b1 | 138 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 84.21 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 83.1 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 83.01 | |
| d2v4jb1 | 69 | DsrB insert domain {Desulfovibrio vulgaris [TaxId: | 82.63 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 82.27 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 81.25 |
| >d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: 2Fe-2S ferredoxin-like family: 2Fe-2S ferredoxin domains from multidomain proteins domain: Fumarate reductase iron-sulfur protein, N-terminal domain species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=3.7e-39 Score=250.17 Aligned_cols=103 Identities=33% Similarity=0.599 Sum_probs=99.1
Q ss_pred CceeEEEEEeeCCCCCCCCceEEEEEeccCCCchHHHHHHHcccCCCCCccccCCCCCCccCeeEEEECCeeeccccccc
Q 023670 45 TDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKI 124 (279)
Q Consensus 45 ~~~~~~~i~R~~p~~~~~~~~~~~~v~~~~~g~tvLdal~~~~~~~dptl~~~~~c~~g~CG~C~v~inG~~~lAC~t~v 124 (279)
-++++|+||||||+.+.+||||+|+|++++ ++||||||.+|+.++||+|+||+||++|+||+|+|+|||+++|||+|++
T Consensus 3 ~~~i~~~i~R~dp~~~~~~~~~~y~v~~~~-~~tvLd~L~~Ik~~~d~sLsfr~sCr~giCGsCam~ING~~~LAC~t~v 81 (105)
T d1kf6b2 3 MKNLKIEVVRYNPEVDTAPHSAFYEVPYDA-TTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFL 81 (105)
T ss_dssp CEEEEEEEEECCTTTCSSCEEEEEEEEECT-TCBHHHHHHHHHHHTCTTCCCCCCCSSSSSCCCEEEETTEEEEGGGCBG
T ss_pred ccEEEEEEEEECCCCCCCCeeEEEEEecCC-CCcHHHHHHHHHHhcCCcceEEeccCCCCCCCCeEEECCcccccceeEe
Confidence 457999999999999999999999999998 8999999999998899999999999999999999999999999999999
Q ss_pred cCCCCceEEeeCCCCcchhhhhhc
Q 023670 125 SPSGSASTITPLPHMFVIKDLVVD 148 (279)
Q Consensus 125 ~~g~~~~~iepl~~~~vikDLvvD 148 (279)
.+.++.++||||++|||||||+||
T Consensus 82 ~~~~~~i~iePl~~~pVikDLvVD 105 (105)
T d1kf6b2 82 RDYTDGMKVEALANFPIERDLVVD 105 (105)
T ss_dssp GGCTTCEEEECCTTSCEEETTEEC
T ss_pred eccCCCeEEEECCCCCccccCCcC
Confidence 988788999999999999999998
|
| >d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} | Back information, alignment and structure |
|---|
| >d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | Back information, alignment and structure |
|---|
| >d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} | Back information, alignment and structure |
|---|
| >d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|