Citrus Sinensis ID: 023690
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 278 | ||||||
| 255551573 | 338 | conserved hypothetical protein [Ricinus | 0.992 | 0.816 | 0.753 | 9e-99 | |
| 224107297 | 346 | predicted protein [Populus trichocarpa] | 0.985 | 0.791 | 0.653 | 1e-83 | |
| 449454446 | 346 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.791 | 0.605 | 7e-80 | |
| 297804694 | 335 | hypothetical protein ARALYDRAFT_915246 [ | 0.920 | 0.764 | 0.617 | 2e-79 | |
| 359477457 | 332 | PREDICTED: uncharacterized protein LOC10 | 0.938 | 0.786 | 0.634 | 6e-78 | |
| 18414476 | 337 | uncharacterized protein [Arabidopsis tha | 0.924 | 0.762 | 0.602 | 8e-78 | |
| 356555589 | 332 | PREDICTED: uncharacterized protein LOC10 | 0.935 | 0.783 | 0.578 | 4e-77 | |
| 357478533 | 344 | hypothetical protein MTR_4g118510 [Medic | 0.967 | 0.781 | 0.592 | 4e-77 | |
| 357478537 | 389 | hypothetical protein MTR_4g118510 [Medic | 0.964 | 0.688 | 0.591 | 1e-76 | |
| 2244910 | 576 | hypothetical protein [Arabidopsis thalia | 0.924 | 0.446 | 0.573 | 1e-73 |
| >gi|255551573|ref|XP_002516832.1| conserved hypothetical protein [Ricinus communis] gi|223543920|gb|EEF45446.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 365 bits (938), Expect = 9e-99, Method: Compositional matrix adjust.
Identities = 214/284 (75%), Positives = 239/284 (84%), Gaps = 8/284 (2%)
Query: 1 MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLA 60
MLAKE G GSTFDLPEEVLQVLPSDPFEQLDVARKITSIA+STRVS LESE SALR QLA
Sbjct: 1 MLAKESG-GSTFDLPEEVLQVLPSDPFEQLDVARKITSIALSTRVSSLESEFSALRLQLA 59
Query: 61 EKDSRIAELQSQIESIYSSLSD---KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEV 117
EKD IAELQS IES+ +SLSD KL QA A+KE L KEN +L+N V+KLQRDVSKLEV
Sbjct: 60 EKDHLIAELQSHIESLDASLSDSADKLAQADAEKENLLKENASLSNIVKKLQRDVSKLEV 119
Query: 118 FRKTLVQSLKDDEDASTGAT-RIAKPTPNEDDAAVAPTGTSSVHSQISEGGNSSFAEERE 176
FRKTL++SL+DDE++S+GA IAKPTP EDDA++ P+ TSS+ SQ SE GNS FAE+RE
Sbjct: 120 FRKTLMKSLQDDEESSSGAIPIIAKPTPTEDDASMLPSRTSSMRSQFSEMGNS-FAEDRE 178
Query: 177 PE-SSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRG 235
+ SSRPG+S G +LASQTSTPR TPPGSPPS SASVSPT+T KPVSPRRHS+SFSTSRG
Sbjct: 179 IDASSRPGMSHGPLLASQTSTPRFTPPGSPPSFSASVSPTRTSKPVSPRRHSMSFSTSRG 238
Query: 236 MFDDR-SSILSSVHSSHSSISSSESGSQTGKTRVDGKEFFRQVR 278
M DDR S S S HSSISSSE+GS TG+TRVDGKEFFRQVR
Sbjct: 239 MPDDRSSLFSSIPSSQHSSISSSETGSHTGRTRVDGKEFFRQVR 282
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224107297|ref|XP_002314437.1| predicted protein [Populus trichocarpa] gi|222863477|gb|EEF00608.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449454446|ref|XP_004144966.1| PREDICTED: uncharacterized protein LOC101217996 [Cucumis sativus] gi|449515179|ref|XP_004164627.1| PREDICTED: uncharacterized protein LOC101231402 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297804694|ref|XP_002870231.1| hypothetical protein ARALYDRAFT_915246 [Arabidopsis lyrata subsp. lyrata] gi|297316067|gb|EFH46490.1| hypothetical protein ARALYDRAFT_915246 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|359477457|ref|XP_002278619.2| PREDICTED: uncharacterized protein LOC100252741 [Vitis vinifera] gi|297736943|emb|CBI26144.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18414476|ref|NP_567470.1| uncharacterized protein [Arabidopsis thaliana] gi|14517356|gb|AAK62569.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|15982813|gb|AAL09754.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|16323276|gb|AAL15372.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|21592639|gb|AAM64588.1| unknown [Arabidopsis thaliana] gi|22531186|gb|AAM97097.1| expressed protein [Arabidopsis thaliana] gi|23198008|gb|AAN15531.1| expressed protein [Arabidopsis thaliana] gi|332658223|gb|AEE83623.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356555589|ref|XP_003546113.1| PREDICTED: uncharacterized protein LOC100776071 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357478533|ref|XP_003609552.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510607|gb|AES91749.1| hypothetical protein MTR_4g118510 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357478537|ref|XP_003609554.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510609|gb|AES91751.1| hypothetical protein MTR_4g118510 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|2244910|emb|CAB10332.1| hypothetical protein [Arabidopsis thaliana] gi|7268301|emb|CAB78596.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 278 | ||||||
| TAIR|locus:505006472 | 337 | AT4G15545 "AT4G15545" [Arabido | 0.931 | 0.768 | 0.574 | 1.8e-71 | |
| TAIR|locus:2017933 | 325 | AT1G16520 "AT1G16520" [Arabido | 0.924 | 0.790 | 0.363 | 7.7e-32 | |
| TAIR|locus:2205230 | 310 | AT1G56080 "AT1G56080" [Arabido | 0.726 | 0.651 | 0.368 | 2.1e-29 | |
| UNIPROTKB|E7EMV0 | 863 | DIAPH1 "Protein diaphanous hom | 0.690 | 0.222 | 0.248 | 3.5e-05 | |
| MGI|MGI:96687 | 487 | Krt12 "keratin 12" [Mus muscul | 0.546 | 0.312 | 0.254 | 4.5e-05 | |
| UNIPROTKB|E7ERW8 | 1215 | DIAPH1 "Protein diaphanous hom | 0.690 | 0.158 | 0.248 | 5.2e-05 | |
| UNIPROTKB|E9PHQ0 | 1260 | DIAPH1 "Protein diaphanous hom | 0.690 | 0.152 | 0.248 | 5.4e-05 | |
| UNIPROTKB|E7ET75 | 1264 | DIAPH1 "Protein diaphanous hom | 0.690 | 0.151 | 0.248 | 5.5e-05 | |
| UNIPROTKB|E9PEZ3 | 1269 | DIAPH1 "Protein diaphanous hom | 0.690 | 0.151 | 0.248 | 5.5e-05 | |
| UNIPROTKB|O60610 | 1272 | DIAPH1 "Protein diaphanous hom | 0.690 | 0.150 | 0.248 | 5.5e-05 |
| TAIR|locus:505006472 AT4G15545 "AT4G15545" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 723 (259.6 bits), Expect = 1.8e-71, P = 1.8e-71
Identities = 158/275 (57%), Positives = 193/275 (70%)
Query: 9 GS-TFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIA 67
GS +FDLP+E+LQVLPSDPFEQLDVARKITSIA+STRVS LESE S LR LAEK+
Sbjct: 18 GSRSFDLPDELLQVLPSDPFEQLDVARKITSIALSTRVSALESESSDLRELLAEKEKEFE 77
Query: 68 ELQSQIESIYSSLSD---KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQ 124
ELQS +ES+ +SLSD KL A +KE L +EN +L+NTV++LQRDVSKLE FRKTL+
Sbjct: 78 ELQSHVESLEASLSDAFHKLSLADGEKENLIRENASLSNTVKRLQRDVSKLEGFRKTLMM 137
Query: 125 SLKDDEDASTGATRI-AKPTPNEDDAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPG 183
SL+DD D + G T+I AKPTPN+DD P+ SS+ SQ + A + E ++ +P
Sbjct: 138 SLQDD-DQNAGTTQIIAKPTPNDDDTPFQPSRHSSIQSQQASEAIEPAATDNENDAPKPS 196
Query: 184 ISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRXXX 243
+S L SQT+TPRLTPPGSPP LSAS +P T +P+SPRRHS+SF+T+RGMFDD
Sbjct: 197 LSASLPLVSQTTTPRLTPPGSPPILSASGTPKTTSRPISPRRHSVSFATTRGMFDD---- 252
Query: 244 XXXXXXXXXXXXXXXXXXQTGKTRVDGKEFFRQVR 278
QT +TRVDGKEFFRQVR
Sbjct: 253 ------TRSSISISEPGSQTARTRVDGKEFFRQVR 281
|
|
| TAIR|locus:2017933 AT1G16520 "AT1G16520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205230 AT1G56080 "AT1G56080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EMV0 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96687 Krt12 "keratin 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ERW8 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PHQ0 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ET75 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PEZ3 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60610 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_X4241 | hypothetical protein (346 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 278 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 8e-05 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 1e-04 | |
| pfam12329 | 74 | pfam12329, TMF_DNA_bd, TATA element modulatory fac | 6e-04 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 44.7 bits (106), Expect = 4e-05
Identities = 24/109 (22%), Positives = 49/109 (44%), Gaps = 4/109 (3%)
Query: 27 FEQLDVARKITSIA-ISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESI---YSSLSD 82
+ R I + + +LE + L +L E + + EL+ ++E + L D
Sbjct: 818 SLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELED 877
Query: 83 KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLKDDED 131
+L + + +KE L +E L + + +L+ ++ KL + L L+ E
Sbjct: 878 ELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEV 926
|
Length = 1163 |
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|221533 pfam12329, TMF_DNA_bd, TATA element modulatory factor 1 DNA binding | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 278 | |||
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.89 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.85 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.81 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 96.73 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 96.61 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 96.57 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.53 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.35 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 96.25 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 96.12 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.08 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.0 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.61 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.48 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 95.47 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.4 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 95.36 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 95.2 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 95.1 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 95.05 | |
| KOG3990 | 305 | consensus Uncharacterized conserved protein [Funct | 94.92 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.89 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 94.76 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.71 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.61 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 94.54 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.54 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 94.52 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.47 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 94.45 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 94.41 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.31 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 94.24 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.2 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 94.1 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 93.97 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 93.81 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 93.76 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 93.73 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 93.72 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 93.72 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 93.7 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 93.68 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 93.64 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 93.61 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 93.59 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 93.43 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 93.28 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 93.23 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 93.21 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 93.06 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 93.04 | |
| PF04899 | 70 | MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th | 92.87 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 92.86 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 92.84 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.84 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 92.78 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 92.72 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 92.72 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 92.7 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 92.69 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 92.61 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.6 | |
| KOG3433 | 203 | consensus Protein involved in meiotic recombinatio | 92.57 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 92.44 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 92.42 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 92.37 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 92.36 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 92.35 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.3 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 92.25 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 92.19 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 92.12 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 92.06 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 91.96 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 91.89 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 91.85 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 91.79 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 91.67 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 91.63 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 91.53 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 91.51 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 91.5 | |
| KOG4010 | 208 | consensus Coiled-coil protein TPD52 [General funct | 91.31 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 91.25 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.23 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 91.18 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 91.14 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 91.1 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 91.02 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 90.99 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 90.94 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 90.91 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 90.91 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 90.83 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 90.73 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 90.71 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 90.65 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 90.47 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 90.45 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 90.44 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 90.4 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 90.36 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 90.35 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 90.21 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 90.12 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 90.11 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 90.11 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 90.1 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 90.06 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 90.06 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 90.05 | |
| PF11544 | 76 | Spc42p: Spindle pole body component Spc42p; InterP | 90.0 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 89.86 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 89.75 | |
| PF09798 | 654 | LCD1: DNA damage checkpoint protein; InterPro: IPR | 89.71 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 89.63 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 89.58 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 89.56 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 89.25 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 89.25 | |
| PF10779 | 71 | XhlA: Haemolysin XhlA; InterPro: IPR019715 Haemoly | 89.12 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 89.08 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 88.95 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 88.94 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 88.92 | |
| PF04201 | 162 | TPD52: Tumour protein D52 family; InterPro: IPR007 | 88.89 | |
| KOG4398 | 359 | consensus Predicted coiled-coil protein [General f | 88.89 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 88.87 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 88.81 | |
| PF11068 | 131 | YlqD: YlqD protein; InterPro: IPR021297 This bacte | 88.77 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 88.77 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 88.59 | |
| PRK09039 | 343 | hypothetical protein; Validated | 88.48 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 88.37 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 88.37 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 88.32 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 88.29 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 88.23 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 88.18 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 88.17 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 88.1 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 88.05 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 87.96 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 87.95 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 87.91 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 87.75 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 87.61 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 87.59 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 87.59 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 87.55 | |
| PF11594 | 106 | Med28: Mediator complex subunit 28; InterPro: IPR0 | 87.49 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 87.47 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 87.42 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 87.41 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 87.27 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 87.26 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 87.19 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 87.17 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 87.16 | |
| PF02601 | 319 | Exonuc_VII_L: Exonuclease VII, large subunit; Inte | 87.16 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 87.15 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 87.02 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 86.92 | |
| PF14817 | 632 | HAUS5: HAUS augmin-like complex subunit 5 | 86.89 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 86.65 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 86.64 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 86.64 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 86.63 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 86.35 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 86.34 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 86.25 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 86.04 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 85.85 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 85.82 | |
| COG1322 | 448 | Predicted nuclease of restriction endonuclease-lik | 85.82 | |
| PF13874 | 141 | Nup54: Nucleoporin complex subunit 54; PDB: 3T97_B | 85.72 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 85.71 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 85.68 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 85.66 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 85.55 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 85.51 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 85.49 | |
| PF04100 | 383 | Vps53_N: Vps53-like, N-terminal ; InterPro: IPR007 | 85.46 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 85.28 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 85.23 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 85.2 | |
| PF08700 | 87 | Vps51: Vps51/Vps67; InterPro: IPR014812 The VFT te | 85.18 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 85.1 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 85.1 | |
| TIGR02559 | 158 | HrpB7 type III secretion protein HrpB7. This famil | 85.08 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 85.06 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 85.04 | |
| PF10158 | 131 | LOH1CR12: Tumour suppressor protein; InterPro: IPR | 85.04 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 84.99 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 84.87 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 84.86 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 84.79 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 84.57 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 84.51 | |
| TIGR03495 | 135 | phage_LysB phage lysis regulatory protein, LysB fa | 84.45 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 84.4 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 84.36 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 84.25 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 84.15 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 84.13 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 84.06 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 84.0 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 83.97 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 83.92 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 83.82 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 83.81 | |
| TIGR00293 | 126 | prefoldin, archaeal alpha subunit/eukaryotic subun | 83.67 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 83.66 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 83.65 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 83.56 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 83.56 | |
| PRK00286 | 438 | xseA exodeoxyribonuclease VII large subunit; Revie | 83.43 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 83.36 | |
| PF14932 | 256 | HAUS-augmin3: HAUS augmin-like complex subunit 3 | 83.33 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 83.25 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 83.22 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 83.19 | |
| PF05781 | 538 | MRVI1: MRVI1 protein; InterPro: IPR008677 This fam | 83.17 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 83.1 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 83.09 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 83.06 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 83.02 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 83.0 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 82.98 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 82.92 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 82.83 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 82.8 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 82.78 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 82.77 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 82.74 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 82.69 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 82.4 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 82.32 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 82.29 | |
| TIGR00237 | 432 | xseA exodeoxyribonuclease VII, large subunit. This | 82.28 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 82.2 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 82.03 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 81.96 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 81.9 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 81.86 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 81.78 | |
| PF02388 | 406 | FemAB: FemAB family; InterPro: IPR003447 The femAB | 81.6 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 81.53 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 81.49 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 81.48 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 81.07 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 81.02 | |
| PF04136 | 157 | Sec34: Sec34-like family ; InterPro: IPR007265 Sec | 80.95 | |
| PF12240 | 205 | Angiomotin_C: Angiomotin C terminal; InterPro: IPR | 80.93 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 80.78 | |
| PF06246 | 255 | Isy1: Isy1-like splicing family; InterPro: IPR0093 | 80.64 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 80.6 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 80.49 | |
| KOG4552 | 272 | consensus Vitamin-D-receptor interacting protein c | 80.43 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 80.21 |
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
Probab=96.89 E-value=0.026 Score=48.27 Aligned_cols=78 Identities=21% Similarity=0.321 Sum_probs=54.1
Q ss_pred HHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHH
Q 023690 35 KITSIAISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQRDVS 113 (278)
Q Consensus 35 kIts~A~atRVs~LE~E~~~LR~~LaEKd~~i~~Lq~r~s~le~~l~~rL~~a~ee~~kL~~E~~~La~TvKkL~rDva 113 (278)
|+=.-++-.|+..||..+..|-+...+|+..|..|+.|+..||..|- ++...+.+......+.+....++..|+|-|.
T Consensus 6 k~E~d~a~~r~e~~e~~~K~le~~~~~~E~EI~sL~~K~~~lE~eld-~~~~~l~~~k~~lee~~~~~~~~E~l~rriq 83 (143)
T PF12718_consen 6 KLEADNAQDRAEELEAKVKQLEQENEQKEQEITSLQKKNQQLEEELD-KLEEQLKEAKEKLEESEKRKSNAEQLNRRIQ 83 (143)
T ss_pred HHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHhHHHHHHhHHHHHhhHH
Confidence 34455677899999999999999999999999999999999999996 3333333333333333333333334444443
|
In striated muscle, tropomyosin mediate the interactions between the troponin complex and actin so as to regulate muscle contraction []. The role of tropomyosin in smooth muscle and non-muscle tissues is not clear. Tropomyosin is an alpha-helical protein that forms a coiled-coil structure of 2 parallel helices containing 2 sets of 7 alternating actin binding sites []. There are multiple cell-specific isoforms, created by differential splicing of the messenger RNA from one gene, but the proportions of the isoforms vary between different cell types. Muscle isoforms of tropomyosin are characterised by having 284 amino acid residues and a highly conserved N-terminal region, whereas non-muscle forms are generally smaller and are heterogeneous in their N-terminal region. This entry represents tropomyosin (Tmp) 1, 2 and 3. Within the yeast Tmp1 and Tmp2, biochemical and sequence analyses indicate that Tpm2 spans four actin monomers along a filament, whereas Tpm1 spans five. Despite its shorter length, Tpm2 can compete with Tpm1 for binding to F-actin. Over-expression of Tpm2 in vivo alters the axial budding of haploids to a bipolar pattern, and this can be partially suppressed by co-over-expression of Tpm1. This suggests distinct functions for the two tropomyosins, and indicates that the ratio between them is important for correct morphogenesis []. |
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG3990 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >KOG4010 consensus Coiled-coil protein TPD52 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF09798 LCD1: DNA damage checkpoint protein; InterPro: IPR018622 This is a family of proteins which regulate checkpoint kinases | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF10779 XhlA: Haemolysin XhlA; InterPro: IPR019715 Haemolysin XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes [] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF04201 TPD52: Tumour protein D52 family; InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma | Back alignment and domain information |
|---|
| >KOG4398 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >PF11068 YlqD: YlqD protein; InterPro: IPR021297 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF11594 Med28: Mediator complex subunit 28; InterPro: IPR021640 Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species [],[] | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF14817 HAUS5: HAUS augmin-like complex subunit 5 | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG1322 Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >PF13874 Nup54: Nucleoporin complex subunit 54; PDB: 3T97_B | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF04100 Vps53_N: Vps53-like, N-terminal ; InterPro: IPR007234 Vps53 complexes with Vps52 and Vps54 to form a multi-subunit complex involved in regulating membrane trafficking events [] | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF08700 Vps51: Vps51/Vps67; InterPro: IPR014812 The VFT tethering complex (also known as GARP complex, Golgi associated retrograde protein complex, Vps53 tethering complex) is a conserved eukaryotic docking complex which is involved in recycling of proteins from endosomes to the late Golgi | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >TIGR02559 HrpB7 type III secretion protein HrpB7 | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR03495 phage_LysB phage lysis regulatory protein, LysB family | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF14932 HAUS-augmin3: HAUS augmin-like complex subunit 3 | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF05781 MRVI1: MRVI1 protein; InterPro: IPR008677 This family consists of mammalian MRVI1 proteins which are related to the lymphoid-restricted membrane protein (JAW1) and the IP3 receptor associated cGMP kinase substrates A and B (IRAGA and IRAGB) | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >TIGR00237 xseA exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF04136 Sec34: Sec34-like family ; InterPro: IPR007265 Sec34 and Sec35 form a sub-complex in a seven-protein complex that includes Dor1 | Back alignment and domain information |
|---|
| >PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF06246 Isy1: Isy1-like splicing family; InterPro: IPR009360 Isy1 protein is important in the optimisation of splicing [] | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >KOG4552 consensus Vitamin-D-receptor interacting protein complex component [Transcription] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 278 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 51.0 bits (121), Expect = 2e-07
Identities = 42/338 (12%), Positives = 87/338 (25%), Gaps = 108/338 (31%)
Query: 12 FDLPE------EVLQVLPSDPF-EQLDV--ARKITSIAISTRVSD--LESEHSALRSQ-- 58
F+ E ++L V D F + D + + +S D + S+ + +
Sbjct: 9 FETGEHQYQYKDILSVF-EDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRL 67
Query: 59 ---LAEKDSRIAE------LQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQ 109
L K + + L+ + + S + + Q ++ + L N +
Sbjct: 68 FWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVF- 126
Query: 110 RDVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNEDDAAVAPTGTSSVHSQISEG--- 166
+K V R L+ A +P N V + G
Sbjct: 127 ---AKYNVSRLQPYLKLRQ-------ALLELRPAKN-----VL------ID-----GVLG 160
Query: 167 -GNSSFAEE----REPESSRPG----ISRG---------------FVLASQTSTPRLTPP 202
G + A + + + ++ T R
Sbjct: 161 SGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHS 220
Query: 203 GSPPSLSASVSP------TKTPKP--------VSPRRHSISFS-------TSRGMFDDRS 241
+ S+ P V + +F+ T+R +
Sbjct: 221 SNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTR----FKQ 276
Query: 242 --SILSSVHSSHSSISSSESGSQTGKTRVDGKEFFRQV 277
LS+ ++H S+ T + K +
Sbjct: 277 VTDFLSAATTTHISLDHHSMTL----TPDEVKSLLLKY 310
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 278 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 97.0 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 96.98 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.84 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.67 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 96.39 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 96.3 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 95.97 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 95.87 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.68 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.58 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.31 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 95.27 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 95.21 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 95.17 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 94.74 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.68 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 94.68 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 94.62 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 94.22 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 94.01 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 94.01 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 93.98 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 93.89 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 93.71 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 93.56 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 93.55 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 93.47 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 93.43 | |
| 2q6q_A | 74 | Spindle POLE BODY component SPC42; SPC42P, budding | 93.41 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 93.27 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 93.17 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 93.14 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 93.05 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 92.76 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 92.73 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 92.51 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 92.34 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 92.29 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 92.19 | |
| 4fm3_A | 98 | Uncharacterized hypothetical protein; PF14346 fami | 91.81 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 91.75 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 91.66 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 91.64 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 91.31 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 90.83 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 90.67 | |
| 2akf_A | 32 | Coronin-1A; coiled coil, protein binding; 1.20A {S | 90.29 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 90.27 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 90.21 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 90.02 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 89.93 | |
| 1x4t_A | 92 | Hypothetical protein LOC57905; structural genomics | 89.9 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 89.86 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 89.85 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 89.5 | |
| 3etw_A | 119 | Adhesin A; antiparallel helix-loop-helix, leucine | 89.08 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 88.9 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 88.82 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 88.57 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 88.39 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 88.2 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 87.95 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 87.89 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 87.84 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 87.62 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 87.47 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 87.44 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 87.43 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 87.04 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 87.03 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 86.97 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 86.87 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 86.55 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 86.55 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 86.22 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 85.98 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 85.9 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 85.89 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 85.88 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 85.7 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 85.4 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 85.07 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 85.02 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 84.69 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 84.63 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 84.44 | |
| 4ghu_A | 198 | TNF receptor-associated factor 3; alpha/beta, inna | 84.17 | |
| 1ik9_A | 213 | DNA repair protein XRCC4; DNA END joining, double- | 84.06 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 83.98 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 83.47 | |
| 4dci_A | 150 | Uncharacterized protein; PSI-biology, midwest cent | 83.43 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 83.34 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 83.05 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 82.71 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 82.2 | |
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 81.96 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 81.84 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 81.8 | |
| 3he4_A | 56 | Synzip6; heterodimeric coiled-coil, de novo protei | 81.56 | |
| 2lw1_A | 89 | ABC transporter ATP-binding protein UUP; ABC REG s | 81.27 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 80.87 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 80.86 | |
| 1yf2_A | 425 | Type I restriction-modification enzyme, S subunit; | 80.77 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 80.09 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=97.00 E-value=0.019 Score=46.95 Aligned_cols=42 Identities=12% Similarity=0.173 Sum_probs=22.4
Q ss_pred HHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 023690 40 AISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESIYSSLS 81 (278)
Q Consensus 40 A~atRVs~LE~E~~~LR~~LaEKd~~i~~Lq~r~s~le~~l~ 81 (278)
+|..+|..|+.++..+..++.+-...+..|+.++..++..+.
T Consensus 3 ~~~~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~ 44 (284)
T 1c1g_A 3 AIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELV 44 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 455555555555555555555555555555555554444443
|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fm3_A Uncharacterized hypothetical protein; PF14346 family protein, DUF4398, structural genomics, joint for structural genomics, JCSG; HET: PG4; 2.47A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2akf_A Coronin-1A; coiled coil, protein binding; 1.20A {Synthetic} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4t_A Hypothetical protein LOC57905; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.2.15.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >4ghu_A TNF receptor-associated factor 3; alpha/beta, innate immunity, IFN pathway, immune system; 2.20A {Mus musculus} PDB: 2gkw_A 1kzz_A 1l0a_A 1zms_A 1rf3_A | Back alignment and structure |
|---|
| >1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >3he4_A Synzip6; heterodimeric coiled-coil, de novo protein; 2.46A {Artificial gene} | Back alignment and structure |
|---|
| >2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >1yf2_A Type I restriction-modification enzyme, S subunit; structura genomics, PSI, protein structure initiative; 2.40A {Methanocaldococcus jannaschii} SCOP: d.287.1.2 d.287.1.2 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 278 | |||
| d1yf2a2 | 205 | Bipartite methylase S protein MJ0130 {Methanocaldo | 91.87 | |
| d1ydxa2 | 181 | Bipartite methylase S protein MG438 {Mycoplasma ge | 89.09 | |
| d1x4ta1 | 80 | Pre-mRNA-splicing factor ISY1 homolog {Mouse (Mus | 85.86 | |
| d1ydxa1 | 193 | Bipartite methylase S protein MG438 {Mycoplasma ge | 85.6 | |
| d1yf2a1 | 220 | Bipartite methylase S protein MJ0130 {Methanocaldo | 81.0 |
| >d1yf2a2 d.287.1.2 (A:221-425) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: DNA methylase specificity domain superfamily: DNA methylase specificity domain family: Type I restriction modification DNA specificity domain domain: Bipartite methylase S protein MJ0130 species: Methanocaldococcus jannaschii [TaxId: 2190]
Probab=91.87 E-value=0.14 Score=38.37 Aligned_cols=39 Identities=13% Similarity=0.308 Sum_probs=32.5
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHhhc
Q 023690 88 QADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSL 126 (278)
Q Consensus 88 ~ee~~kL~~E~~~La~TvKkL~rDvaKLE~FKk~LmqSL 126 (278)
.+++.+..+.-+.+-..+.++.+.+.+|+.+|+.|||.|
T Consensus 158 ~~eQ~~I~~~l~~id~~i~~~~~~~~~l~~~k~~Ll~~l 196 (205)
T d1yf2a2 158 LEEQKQIAKILSSVDKSIELKKQKKEKLQRMKKKIMELL 196 (205)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 456667777777777888899999999999999999986
|
| >d1ydxa2 d.287.1.2 (A:194-374) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1x4ta1 a.2.15.1 (A:7-86) Pre-mRNA-splicing factor ISY1 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ydxa1 d.287.1.2 (A:1-193) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1yf2a1 d.287.1.2 (A:1-220) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|