Citrus Sinensis ID: 023691

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MAASSAGNHSTPHNTKPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILHNS
ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccccccccEEcccccccccccccccEEEccccccccHHHHHHHHHHccccEEEEEcccEEcccccccccccccccccEEEEEEEEEEEEEEEEEccEEEEEEEEEEcccccccEEEEEEccccccccccccccHHHHHHHHHHHccccccccEEEEcccccEEEEEEcc
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHcccccccccEEccHHcccccccccccccccccccccEEEcccccccccccccEEEEEEcccccHHcccEEEEEcccccccHHHHHHHHHHccccEEEEccccEccccccHcccccccccccEEEccEEEEEcccccccccEEEEEEEEEEccccccEEEEEEEEEccccccccccccHHHHHHHHHHHHcccccccEEEEEccccEEEEEEcc
maassagnhstphntkpfefsavdfpprisltadqynHCSEALSFFKEKLQNKSREISQEFARLQasrikpsemargctvaldgvnlsknrytdilpfdknrvvLKQCKdyrpaargyINASLISTSSSEKVSQFIAtqgplphtyeDFWEMVIQYHCPVIVMLTRLVdnykmvkcgdyfqaedgprefgnigIVTKWIKTTETALVLRNLEvnykeseeppmsvlhiqypewpdhgvprdtLAVREILKRIynlppnfgpivvHCRYWENWCILHNS
maassagnhstphntkpfefsAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQasrikpsemargCTVAldgvnlsknrytdilpfdknrvvLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILHNS
MAASSAGNHSTPHNTKPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILHNS
*********************AVDFPPRISLTADQYNHCSEALSFFK***************************ARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLIST****KVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYK******MSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILH**
*******************************************SF**********EISQEFARLQASRI***************VNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKE*EEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILHNS
************HNTKPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILHNS
********************SAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILHNS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASSAGNHSTPHNTKPFEFSAVDFPPRISLTADQYNHCSEALSFFxxxxxxxxxxxxxxxxxxxxxRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCRYWENWCILHNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query278 2.2.26 [Sep-21-2011]
O82656340 Protein-tyrosine-phosphat no no 0.971 0.794 0.632 1e-101
P08575 1304 Receptor-type tyrosine-pr yes no 0.776 0.165 0.351 1e-25
A1L1L3421 Tyrosine-protein phosphat yes no 0.723 0.477 0.360 3e-25
P04157 1273 Receptor-type tyrosine-pr no no 0.776 0.169 0.351 4e-25
P06800 1291 Receptor-type tyrosine-pr no no 0.776 0.167 0.360 5e-25
P34137 522 Tyrosine-protein phosphat yes no 0.708 0.377 0.349 7e-25
B2RU801998 Receptor-type tyrosine-pr no no 0.748 0.104 0.325 9e-25
O55082426 Tyrosine-protein phosphat no no 0.723 0.471 0.351 4e-24
P29074926 Tyrosine-protein phosphat no no 0.618 0.185 0.393 4e-24
P234671997 Receptor-type tyrosine-pr no no 0.748 0.104 0.321 5e-24
>sp|O82656|PTP1_ARATH Protein-tyrosine-phosphatase PTP1 OS=Arabidopsis thaliana GN=PTP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  366 bits (940), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/280 (63%), Positives = 216/280 (77%), Gaps = 10/280 (3%)

Query: 4   SSAGNHSTPHNTKPFEFSAVDFPPRISLTA-DQYNHCSEALSFFKEKLQNKSREISQEFA 62
           SSA N  T   +  F+ S+ D PP     + DQ NHC +AL  F+ K+QN    I+ EF 
Sbjct: 7   SSAANLFT--GSTRFDLSSADSPPSKLSLSSDQLNHCHQALGVFRGKIQNPD-SIAHEFT 63

Query: 63  RLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINAS 122
            LQA+R+ PSE+    TVA++ VN+ KNRY+D++PFDKNR+VL  CKD   +A+GY+NAS
Sbjct: 64  GLQANRMWPSELLLNSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCKD--SSAKGYVNAS 121

Query: 123 LISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQA 182
           LI TS SE +SQFIATQGPLPHT EDFWEMVIQ HCP+IVMLTRLVDN + VKCGDYFQ 
Sbjct: 122 LIKTSESESISQFIATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVDNNRTVKCGDYFQD 181

Query: 183 EDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDT 242
           EDGPREFGNI + TKWIKTT+T+L+LRNLEVNYKE+E+ PMSVLHIQYPEWPDHGVP+DT
Sbjct: 182 EDGPREFGNISLTTKWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDHGVPKDT 241

Query: 243 LAVREILKRIYNLPPNFGPIVVHCRYW----ENWCILHNS 278
           +AVREILKR+Y +PP+ GPI+VHC         +C +HN+
Sbjct: 242 VAVREILKRLYQVPPSLGPIIVHCSAGIGRTGTYCAIHNT 281
Protein-tyrosine-phosphatase that dephosphorylates and probably inhibits MPK6 in non-oxidative stress conditions. In association with MKP1, represses salicylic acid (SA) and camalexin biosynthesis, thus modulating defense response. May also repress MPK3. Dephosphorylates and inactivates MPK4 in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P08575|PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens GN=PTPRC PE=1 SV=2 Back     alignment and function description
>sp|A1L1L3|PTN20_RAT Tyrosine-protein phosphatase non-receptor type 20 OS=Rattus norvegicus GN=Ptpn20 PE=2 SV=1 Back     alignment and function description
>sp|P04157|PTPRC_RAT Receptor-type tyrosine-protein phosphatase C OS=Rattus norvegicus GN=Ptprc PE=2 SV=2 Back     alignment and function description
>sp|P06800|PTPRC_MOUSE Receptor-type tyrosine-protein phosphatase C OS=Mus musculus GN=Ptprc PE=1 SV=3 Back     alignment and function description
>sp|P34137|PTP1_DICDI Tyrosine-protein phosphatase 1 OS=Dictyostelium discoideum GN=ptpA1-1 PE=2 SV=2 Back     alignment and function description
>sp|B2RU80|PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus GN=Ptprb PE=1 SV=1 Back     alignment and function description
>sp|O55082|PTN20_MOUSE Tyrosine-protein phosphatase non-receptor type 20 OS=Mus musculus GN=Ptpn20 PE=1 SV=1 Back     alignment and function description
>sp|P29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens GN=PTPN4 PE=1 SV=1 Back     alignment and function description
>sp|P23467|PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens GN=PTPRB PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
225463924339 PREDICTED: tyrosine-protein phosphatase 0.992 0.814 0.745 1e-120
297735824342 unnamed protein product [Vitis vinifera] 0.992 0.807 0.745 1e-120
224135471339 predicted protein [Populus trichocarpa] 0.989 0.811 0.724 1e-119
255586813332 protein-tyrosine phosphatase 1, plants, 0.974 0.816 0.709 1e-115
47558926333 protein tyrosine phosphatase [Phaseolus 0.931 0.777 0.716 1e-110
351727190338 tyrosine phosphatase 1 [Glycine max] gi| 0.996 0.819 0.681 1e-110
356576133338 PREDICTED: tyrosine-protein phosphatase 0.953 0.784 0.705 1e-108
297839025342 hypothetical protein ARALYDRAFT_339406 [ 0.935 0.760 0.672 1e-107
88683154330 protein tyrosine phosphatase [Fagus sylv 0.956 0.806 0.698 1e-104
42572073277 tyrosine phosphatase 1 [Arabidopsis thal 0.964 0.967 0.656 1e-101
>gi|225463924|ref|XP_002267287.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/283 (74%), Positives = 237/283 (83%), Gaps = 7/283 (2%)

Query: 1   MAASSAGNH-STPHNTKPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQ 59
           MAA SAG   +   + KPF+FS  D PPR+SLT DQ+ HCSEAL FFK+KLQ   + I Q
Sbjct: 1   MAAESAGKSIAVSSSRKPFDFSP-DSPPRLSLTPDQFKHCSEALRFFKDKLQMPEK-IRQ 58

Query: 60  EFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYI 119
           EFA LQA+R++PSEM R CTVALD VNLSKNRYTD+LPFDK RVVL  CKDYRP+ARGYI
Sbjct: 59  EFAFLQANRMRPSEMMRSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYI 118

Query: 120 NASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDY 179
           NAS I TSS+E +S+FIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYK VKCGDY
Sbjct: 119 NASFIETSSTESISRFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKTVKCGDY 178

Query: 180 FQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVP 239
           FQAEDGPREFGNI IVTKWIKTTET+LVLR+LEVNYKESEEP +SVLHIQYPEWPDHGVP
Sbjct: 179 FQAEDGPREFGNIFIVTKWIKTTETSLVLRHLEVNYKESEEPSLSVLHIQYPEWPDHGVP 238

Query: 240 RDTLAVREILKRIYNLPPNFGPIVVHCRYW----ENWCILHNS 278
           RDT AVRE+LKR+ ++ P+ GPIVVHC         +C +HN+
Sbjct: 239 RDTCAVREMLKRMCHVLPSLGPIVVHCSAGIGRTGTYCTIHNT 281

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297735824|emb|CBI18544.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224135471|ref|XP_002327226.1| predicted protein [Populus trichocarpa] gi|222835596|gb|EEE74031.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255586813|ref|XP_002534020.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis] gi|223525971|gb|EEF28361.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|47558926|gb|AAT35563.1| protein tyrosine phosphatase [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|351727190|ref|NP_001237920.1| tyrosine phosphatase 1 [Glycine max] gi|3413473|emb|CAA06975.1| tyrosine phosphatase 1 [Glycine max] Back     alignment and taxonomy information
>gi|356576133|ref|XP_003556188.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like [Glycine max] Back     alignment and taxonomy information
>gi|297839025|ref|XP_002887394.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. lyrata] gi|297333235|gb|EFH63653.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|88683154|emb|CAJ77612.1| protein tyrosine phosphatase [Fagus sylvatica] Back     alignment and taxonomy information
>gi|42572073|ref|NP_974127.1| tyrosine phosphatase 1 [Arabidopsis thaliana] gi|332197120|gb|AEE35241.1| tyrosine phosphatase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
TAIR|locus:2012991340 PTP1 "protein tyrosine phospha 0.971 0.794 0.642 1.8e-96
RGD|1309812421 Ptpn20b "protein tyrosine phos 0.769 0.508 0.357 1e-27
UNIPROTKB|Q6ED61 1303 Q6ED61 "CD45" [Aotus nancymaae 0.776 0.165 0.351 1.9e-27
UNIPROTKB|E9PC28 1256 PTPRC "Receptor-type tyrosine- 0.776 0.171 0.351 2.9e-27
UNIPROTKB|Q6ED60 1290 Q6ED60 "CD45" [Aotus vociferan 0.776 0.167 0.351 3e-27
UNIPROTKB|P08575 1304 PTPRC "Receptor-type tyrosine- 0.776 0.165 0.351 3e-27
UNIPROTKB|B1ALS2 1306 PTPRC "Receptor-type tyrosine- 0.776 0.165 0.351 3e-27
UNIPROTKB|F1Q1U1 1300 PTPRC "Uncharacterized protein 0.776 0.166 0.343 4.9e-27
UNIPROTKB|F1Q1S4 1308 PTPRC "Uncharacterized protein 0.776 0.165 0.343 5e-27
MGI|MGI:1196295426 Ptpn20 "protein tyrosine phosp 0.719 0.469 0.359 7.3e-27
TAIR|locus:2012991 PTP1 "protein tyrosine phosphatase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 959 (342.6 bits), Expect = 1.8e-96, P = 1.8e-96
 Identities = 180/280 (64%), Positives = 223/280 (79%)

Query:     4 SSAGNHSTPHNTKPFEFSAVDFPP-RISLTADQYNHCSEALSFFKEKLQNKSREISQEFA 62
             SSA N  T  +T+ F+ S+ D PP ++SL++DQ NHC +AL  F+ K+QN    I+ EF 
Sbjct:     7 SSAANLFTG-STR-FDLSSADSPPSKLSLSSDQLNHCHQALGVFRGKIQNPD-SIAHEFT 63

Query:    63 RLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINAS 122
              LQA+R+ PSE+    TVA++ VN+ KNRY+D++PFDKNR+VL  CKD   +A+GY+NAS
Sbjct:    64 GLQANRMWPSELLLNSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCKD--SSAKGYVNAS 121

Query:   123 LISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQA 182
             LI TS SE +SQFIATQGPLPHT EDFWEMVIQ HCP+IVMLTRLVDN + VKCGDYFQ 
Sbjct:   122 LIKTSESESISQFIATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVDNNRTVKCGDYFQD 181

Query:   183 EDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDT 242
             EDGPREFGNI + TKWIKTT+T+L+LRNLEVNYKE+E+ PMSVLHIQYPEWPDHGVP+DT
Sbjct:   182 EDGPREFGNISLTTKWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDHGVPKDT 241

Query:   243 LAVREILKRIYNLPPNFGPIVVHCRYW----ENWCILHNS 278
             +AVREILKR+Y +PP+ GPI+VHC         +C +HN+
Sbjct:   242 VAVREILKRLYQVPPSLGPIIVHCSAGIGRTGTYCAIHNT 281
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0033550 "MAP kinase tyrosine phosphatase activity" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0031348 "negative regulation of defense response" evidence=IGI
GO:0005829 "cytosol" evidence=RCA
GO:0000303 "response to superoxide" evidence=RCA
GO:0007243 "intracellular protein kinase cascade" evidence=RCA;TAS
GO:0008219 "cell death" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0043407 "negative regulation of MAP kinase activity" evidence=RCA
GO:0004725 "protein tyrosine phosphatase activity" evidence=IDA
RGD|1309812 Ptpn20b "protein tyrosine phosphatase, non-receptor type 20B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ED61 Q6ED61 "CD45" [Aotus nancymaae (taxid:37293)] Back     alignment and assigned GO terms
UNIPROTKB|E9PC28 PTPRC "Receptor-type tyrosine-protein phosphatase C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ED60 Q6ED60 "CD45" [Aotus vociferans (taxid:57176)] Back     alignment and assigned GO terms
UNIPROTKB|P08575 PTPRC "Receptor-type tyrosine-protein phosphatase C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B1ALS2 PTPRC "Receptor-type tyrosine-protein phosphatase C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q1U1 PTPRC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q1S4 PTPRC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1196295 Ptpn20 "protein tyrosine phosphatase, non-receptor type 20" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.48LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.41.173.1
hypothetical protein (321 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 7e-65
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 2e-64
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 2e-61
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 9e-33
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 8e-27
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 8e-22
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 3e-21
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 3e-19
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 1e-09
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 1e-09
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 0.004
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information 
 Score =  203 bits (518), Expect = 7e-65
 Identities = 81/214 (37%), Positives = 109/214 (50%), Gaps = 14/214 (6%)

Query: 57  ISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAAR 116
           + +EF +L   +         CTVA    N  KNRY D+LP+D  RV LK          
Sbjct: 2   LEEEFEKLDRLKPDDES----CTVAAFPENRDKNRYKDVLPYDHTRVKLKPPPGE---GS 54

Query: 117 GYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKC 176
            YINAS I   +  K   +IATQGPLP T EDFW MV +    VIVMLT LV+  +  KC
Sbjct: 55  DYINASYIDGPNGPK--AYIATQGPLPSTVEDFWRMVWEQKVTVIVMLTELVEKGR-EKC 111

Query: 177 GDYFQAEDG-PREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPD 235
             Y+  E+G P  +G+I +  K ++  +    +R LEV      E   +V H  Y  WPD
Sbjct: 112 AQYWPDEEGEPLTYGDITVTLKSVEKVDD-YTIRTLEVTNTGCSE-TRTVTHYHYTNWPD 169

Query: 236 HGVPRDTLAVREILKRIYNLPPNF-GPIVVHCRY 268
           HGVP    ++ ++++ +        GPIVVHC  
Sbjct: 170 HGVPESPESILDLIRAVRKSQSTSTGPIVVHCSA 203

Length = 259
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 278
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
KOG0790 600 consensus Protein tyrosine phosphatase Corkscrew a 100.0
PHA02738320 hypothetical protein; Provisional 100.0
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 100.0
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 100.0
KOG0791374 consensus Protein tyrosine phosphatase, contains f 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 100.0
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 100.0
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.16
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.16
PTZ00242166 protein tyrosine phosphatase; Provisional 98.3
PTZ00393241 protein tyrosine phosphatase; Provisional 97.81
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 97.04
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 95.89
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 95.33
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 95.26
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 95.25
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 94.36
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 93.55
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 92.68
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 89.13
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 88.49
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 84.92
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 84.31
COG5350172 Predicted protein tyrosine phosphatase [General fu 82.69
PRK12361 547 hypothetical protein; Provisional 81.96
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 81.16
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-60  Score=426.29  Aligned_cols=209  Identities=30%  Similarity=0.527  Sum_probs=181.8

Q ss_pred             HHHHHHHHHhHhcCCCCccccccceeecCCCCCCCCCCCCCCCCCCCeEEeeccCCCCCCCCCccccceeecCCCCcccc
Q 023691           55 REISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQ  134 (278)
Q Consensus        55 ~~~~~Ef~~l~~~~~~~~~~~~~~~~a~~~~n~~kNRy~~i~p~D~tRV~L~~~~~~~~~~~dYINAs~V~~~~~~~~~~  134 (278)
                      ..+.+||+.|.....     ..++..+..++|..||||.||+|||+|||+|....    +.+||||||||+|+...  ++
T Consensus        26 ~~i~~E~~~i~~~~~-----~~~~~~~~~~~N~~KNRy~~i~~~D~tRV~L~~~~----~~~dYINAsyI~g~~~~--~~   94 (303)
T PHA02742         26 EILKEEHEHIMQEIV-----AFSCNESLELKNMKKCRYPDAPCFDRNRVILKIED----GGDDFINASYVDGHNAK--GR   94 (303)
T ss_pred             HHHHHHHHHHhcCCC-----CCchhhccChhhhhcCCCCCCCCCCCCEEEeCCCC----CCCCcEEEeeecCCCCC--Ce
Confidence            679999999975432     35788888999999999999999999999998532    36899999999998643  79


Q ss_pred             eecccCCCcccHHHHHHHHHHhcCCeEEEecccccccccccccccccC-CCCceeeeeeEEEEEEEEEecccEEEEEeee
Q 023691          135 FIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQA-EDGPREFGNIGIVTKWIKTTETALVLRNLEV  213 (278)
Q Consensus       135 yIatQ~Pl~~T~~dFW~mV~e~~v~~IVmLt~~~E~~~~~kc~~YwP~-~~~~~~~g~~~V~~~~~~~~~~~~~~r~l~v  213 (278)
                      |||||||+++|+.|||+||||++|.+|||||++.|++ +++|.+|||. +++...||.|+|++.++.. ..+|+++.|.|
T Consensus        95 fIatQ~Pl~~T~~dFW~MVw~~~~~vIVmLt~~~E~g-~~kc~~YWp~~~~~~~~~g~~~V~~~~~~~-~~~~~~~~l~l  172 (303)
T PHA02742         95 FICTQAPLEETALDFWQAIFQDQVRVIVMITKIMEDG-KEACYPYWMPHERGKATHGEFKIKTKKIKS-FRNYAVTNLCL  172 (303)
T ss_pred             EEEECCCCcccHHHHHHHHhhcCCCeEEEcchhhhCC-eeeccccCCCCCCCceEEEEEEEEEEEEEE-cCCEEEEEEEE
Confidence            9999999999999999999999999999999999976 5899999996 4577899999999988776 46899999999


Q ss_pred             eecCCCCCceEEEEEeeCCCCCCCCCCChHHHHHHHHHHHcCC------------CCCCCEEEEcCc----chhhheecC
Q 023691          214 NYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLP------------PNFGPIVVHCRY----WENWCILHN  277 (278)
Q Consensus       214 ~~~~~~~~~r~V~h~~y~~Wpd~gvP~~~~~ll~~~~~~~~~~------------~~~~PivVHCs~----tGtfiald~  277 (278)
                      .+.+.+. .|.|+||||++|||+|+|.++..+++|+..+++..            ...+||||||||    ||||||||+
T Consensus       173 ~~~~~~~-~r~V~h~~y~~Wpd~gvP~~~~~~l~~i~~v~~~~~~~~~~~~~~~~~~~~PIvVHCsaGvGRTGtF~aid~  251 (303)
T PHA02742        173 TDTNTGA-SLDIKHFAYEDWPHGGLPRDPNKFLDFVLAVREADLKADVDIKGENIVKEPPILVHCSAGLDRAGAFCAIDI  251 (303)
T ss_pred             EECCCCc-eEEEEEEEECCCCCCCcCCCHHHHHHHHHHHHHHhhhccccccccccCCCCCeEEECCCCCchhHHHHHHHH
Confidence            9866555 57999999999999999999999999998776421            123799999998    999999986

>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 3e-25
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 6e-25
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 8e-25
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 1e-24
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 3e-24
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 3e-24
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 3e-24
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 5e-24
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 6e-24
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 6e-24
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 2e-23
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-23
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 3e-23
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 5e-23
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 5e-23
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 6e-23
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 7e-23
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-22
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-22
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 1e-22
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 1e-22
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 1e-22
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 1e-22
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-22
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 1e-22
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 1e-22
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 1e-22
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 1e-22
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 2e-22
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 2e-22
2nlk_A627 Crystal Structure Of D1 And D2 Catalytic Domains Of 2e-22
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 2e-22
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 2e-22
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-22
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 2e-22
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 2e-22
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 2e-22
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-22
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 2e-22
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-22
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 2e-22
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 2e-22
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 2e-22
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 2e-22
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 2e-22
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 3e-22
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 3e-22
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 3e-22
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 5e-22
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 6e-22
1fpr_A284 Crystal Structure Of The Complex Formed Between The 7e-22
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 7e-22
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 8e-22
1lar_A 575 Crystal Structure Of The Tandem Phosphatase Domains 1e-21
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 1e-21
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 2e-21
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-21
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 2e-21
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-21
1a5y_A 330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 2e-21
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-21
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 2e-21
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 2e-21
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 2e-21
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 2e-21
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 3e-21
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-21
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 8e-21
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 1e-20
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 1e-20
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 1e-20
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 1e-20
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 2e-20
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 2e-20
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 3e-20
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 4e-20
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 6e-20
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 6e-20
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 9e-20
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 1e-19
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 2e-19
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 2e-19
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 1e-18
2qcj_A313 Native Structure Of Lyp Length = 313 2e-18
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 2e-18
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 2e-18
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 2e-18
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 3e-18
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 3e-18
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 5e-18
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 2e-17
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 5e-17
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 6e-17
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 8e-17
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 2e-16
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 2e-16
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 3e-16
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 8e-16
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 8e-15
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 8e-15
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 6e-13
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 102/183 (55%), Gaps = 11/183 (6%)
Query: 86  NLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHT 145
           N+SKNRY DI P+D  RV+LK  +DY  A   YIN  +    SS  ++Q+IA QGPLPHT
Sbjct: 71  NISKNRYRDISPYDATRVILKGNEDYINA--NYINMEI---PSSSIINQYIACQGPLPHT 125
Query: 146 YEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETA 205
             DFW+M  +    ++VMLT  V+  + VKC  Y+    G   +G    VT   +   TA
Sbjct: 126 CTDFWQMTWEQGSSMVVMLTTQVERGR-VKCHQYWPEPTGSSSYGCYQ-VTCHSEEGNTA 183
Query: 206 LVLRNLEV-NYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYN-LPPNFGPIV 263
            + R + + N +++E  P++   IQY  WPDHGVP D+    + +  + N       P+V
Sbjct: 184 YIFRKMTLFNQEKNESRPLT--QIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVV 241
Query: 264 VHC 266
           VHC
Sbjct: 242 VHC 244
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 3e-67
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 5e-67
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 6e-67
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 5e-65
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 5e-65
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 2e-64
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 2e-63
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 2e-63
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 3e-63
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 3e-62
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 3e-62
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 4e-62
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 4e-62
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 4e-62
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 2e-53
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 6e-62
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-61
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 2e-61
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 1e-60
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 4e-60
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 5e-60
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 8e-60
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-54
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 2e-59
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 4e-59
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 4e-59
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 4e-59
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 7e-54
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 6e-59
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 6e-59
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-53
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 4e-58
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 1e-57
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 2e-57
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 2e-56
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 2e-56
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 2e-55
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
 Score =  210 bits (536), Expect = 3e-67
 Identities = 71/228 (31%), Positives = 112/228 (49%), Gaps = 21/228 (9%)

Query: 43  LSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNR 102
              F +   + +  +S+E+  L+      S     C +AL   N  KNRY +ILP+D  R
Sbjct: 15  EGHFMKLQADSNYLLSKEYEELKDVGRNQS-----CDIALLPENRGKNRYNNILPYDATR 69

Query: 103 VVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIV 162
           V L    DY       INAS I  ++  +  ++I TQGPLP T +DFW+MV + +   IV
Sbjct: 70  VKLSGGSDY-------INASYIPGNNFRR--EYIVTQGPLPGTKDDFWKMVWEQNVHNIV 120

Query: 163 MLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETAL-VLRNLEVNYKESEEP 221
           M+T+ V+  + VKC  Y+ A+     +G++ +    +  +      +R  ++  +E  + 
Sbjct: 121 MVTQCVEKGR-VKCDHYWPADQDSLYYGDLILQM--LSESVLPEWTIREFKICGEEQLDA 177

Query: 222 PMSVLHIQYPEWPDHGVPRDTLAV---REILKRIYNLPPNFGPIVVHC 266
              + H  Y  WPDHGVP  T ++      ++   N  P  GP VVHC
Sbjct: 178 HRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHC 225
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 100.0
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.82
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.56
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.51
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 98.86
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 98.48
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 97.77
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 97.59
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 97.56
2q05_A195 Late protein H1, dual specificity protein phosphat 97.44
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 97.39
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 97.36
3cm3_A176 Late protein H1, dual specificity protein phosphat 97.23
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 97.18
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 96.92
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 96.84
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 96.75
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 96.56
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 96.41
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 96.36
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 95.94
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 95.93
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 95.81
2oud_A177 Dual specificity protein phosphatase 10; A central 95.69
2hcm_A164 Dual specificity protein phosphatase; structural g 95.6
1xri_A151 AT1G05000; structural genomics, protein structure 95.6
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 95.53
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 95.36
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 95.16
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 94.8
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 94.65
2g6z_A 211 Dual specificity protein phosphatase 5; alpha/beta 94.47
2hxp_A155 Dual specificity protein phosphatase 9; human phos 94.4
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 94.34
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 94.25
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 93.54
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 92.49
1ywf_A 296 Phosphotyrosine protein phosphatase PTPB; four str 90.23
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 90.0
3emu_A161 Leucine rich repeat and phosphatase domain contain 89.86
2f46_A156 Hypothetical protein; structural genomics, joint c 89.27
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 88.13
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 84.35
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-65  Score=457.85  Aligned_cols=232  Identities=30%  Similarity=0.510  Sum_probs=196.6

Q ss_pred             CCCCCCCCHHHHhHHHHHHHHHHHHhhcchHHHHHHHHHhHhcCCCCccccccceeecCCCCCCCCCCCCCCCCCCCeEE
Q 023691           25 FPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVV  104 (278)
Q Consensus        25 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~a~~~~n~~kNRy~~i~p~D~tRV~  104 (278)
                      .|.+..++.+++      ++++.++..   .+|.+||+.|+....     ..++..+..++|+.||||.||+|||+|||+
T Consensus         5 ~p~p~~~~~~~~------~~~~~~~~~---~g~~~Ef~~l~~~~~-----~~~~~~~~~~~N~~KNRy~dI~pyD~tRV~   70 (314)
T 4ge6_A            5 VPGPHAMTIQEL------VDYVNARQK---QGIYEEYEDIRRENP-----VGTFHCSMSPGNLEKNRYGDVPCLDQTRVK   70 (314)
T ss_dssp             CSCSSCBCHHHH------HHHHHHHHH---HHHHHHHHHHHHSCC-----SSCCHHHHSTTTGGGCSCTTCCCCTTTBCC
T ss_pred             CCCCCccCHHHH------HHHHHhhhh---hhHHHHHHHhhCcCC-----CCcchhccChhhhccCCCCCcCCCcCcEEE
Confidence            466667776665      345544433   689999999986542     346778899999999999999999999999


Q ss_pred             eeccCCCCCCCCCccccceeecCCCCcccceecccCCCcccHHHHHHHHHHhcCCeEEEecccccccccccccccccCC-
Q 023691          105 LKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAE-  183 (278)
Q Consensus       105 L~~~~~~~~~~~dYINAs~V~~~~~~~~~~yIatQ~Pl~~T~~dFW~mV~e~~v~~IVmLt~~~E~~~~~kc~~YwP~~-  183 (278)
                      |....+  .+++||||||||+|+..  +++|||||||+++|++|||+||||++|.+|||||.+.|++ +.||.+|||.+ 
T Consensus        71 L~~~~~--~~~sdYINAs~I~g~~~--~~~yIaTQgPl~~T~~dFW~MVwe~~~~~IVmLt~~~E~g-~~kC~~YwP~~~  145 (314)
T 4ge6_A           71 LTKRSG--HTQTDYINASFMDGYKQ--KNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGG-RRKCGQYWPLEK  145 (314)
T ss_dssp             CCCCSS--SCCCSCCSEEEEEETTE--EEEEEEECCCCGGGHHHHHHHHHHTTCCEEEECSCSEETT-EECCCCCSCCST
T ss_pred             ccCCCC--CCCCceEEeecccCCCC--CCeEEEECCCcHHHHHHHHHHHHhcCCceEEEcccccccc-eecccccCcCCC
Confidence            986554  45789999999999864  3799999999999999999999999999999999999976 58999999975 


Q ss_pred             CCceeeeeeEEEEEEEEEecccEEEEEeeeeecCCCCCceEEEEEeeCCCCCCCCCCChHHHHHHHHHHHcC--------
Q 023691          184 DGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL--------  255 (278)
Q Consensus       184 ~~~~~~g~~~V~~~~~~~~~~~~~~r~l~v~~~~~~~~~r~V~h~~y~~Wpd~gvP~~~~~ll~~~~~~~~~--------  255 (278)
                      ++.+.||.++|++.++.. ...+++|.|++.+.+.++ .|+|+||||++|||+|+|.++..+++|++.+++.        
T Consensus       146 ~~~~~~g~~~V~~~~~~~-~~~~~~r~l~~~~~~~~~-~r~V~h~~y~~WPd~gvP~~~~~ll~~i~~v~~~~~~~~~~~  223 (314)
T 4ge6_A          146 DSRIRFGFLTVTNLGVEN-MNHYKKTTLEIHNTEERQ-KRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNM  223 (314)
T ss_dssp             TCEEEETTEEEEEEEEEE-CSSEEEEEEEEEETTTTE-EEEEEEEEECCSCSSSCCSCSHHHHHHHHHHHHHHHHHHHHS
T ss_pred             CCceecccEEEEEEEEEE-cCCceEEEEeeecccCCc-ceEEEEEEeCCCCCCCCCCCHHHHHHHHHHHHHHHhhhhccc
Confidence            567789999999998876 578999999999876665 5799999999999999999999999999877531        


Q ss_pred             ------CCCCCCEEEEcCc----chhhheecC
Q 023691          256 ------PPNFGPIVVHCRY----WENWCILHN  277 (278)
Q Consensus       256 ------~~~~~PivVHCs~----tGtfiald~  277 (278)
                            ....+||||||||    ||||||||+
T Consensus       224 ~~~~~~~~~~~PivVHCSaGvGRTGtfiaid~  255 (314)
T 4ge6_A          224 GARSKGQCPEPPIVVHCSAGIGRTGTFCSLDI  255 (314)
T ss_dssp             CCC----CCSCCEEEECSSSSHHHHHHHHHHH
T ss_pred             cccccccCCCCCEEEECCCCCcHHHHHHHHHH
Confidence                  1234799999999    999999985
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 278
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 5e-43
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 1e-41
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 3e-40
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 3e-40
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 4e-40
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-39
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-39
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 4e-39
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 1e-38
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 7e-38
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 4e-37
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-35
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 7e-35
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 6e-15
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 3e-08
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 0.001
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Human (Homo sapiens), shp-2 [TaxId: 9606]

 Score =  146 bits (370), Expect = 5e-43
 Identities = 75/236 (31%), Positives = 107/236 (45%), Gaps = 15/236 (6%)

Query: 41  EALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDK 100
             LS   E      +   +EF  LQ    K               N +KNRY +ILPFD 
Sbjct: 13  RELSKLAETTDKVKQGFWEEFETLQQQECKLLYS---RKEGQRQENKNKNRYKNILPFDH 69

Query: 101 NRVVLKQCKDYRPAARGYINASLI------STSSSEKVSQFIATQGPLPHTYEDFWEMVI 154
            RVVL       P +  YINA++I        ++S+    +IATQG L +T  DFW MV 
Sbjct: 70  TRVVLHDGDPNEPVS-DYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVF 128

Query: 155 QYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVN 214
           Q +  VIVM T+ V+  K  KC  Y+  E   +E+G + +             LR L+++
Sbjct: 129 QENSRVIVMTTKEVERGK-SKCVKYWPDEYALKEYGVMRVRNVKESAAHD-YTLRELKLS 186

Query: 215 YKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL---PPNFGPIVVHCR 267
                    +V    +  WPDHGVP D   V + L+ +++      + GP+VVHC 
Sbjct: 187 KVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCS 242
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.7
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.55
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 98.42
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 97.81
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 97.66
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 96.85
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 95.9
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 91.86
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 91.56
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 90.88
d1ywfa1 272 Phosphotyrosine protein phosphatase PtpB {Mycobact 89.4
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Human (Homo sapiens), shp-2 [TaxId: 9606]

Probab=100.00  E-value=6.7e-61  Score=427.03  Aligned_cols=237  Identities=31%  Similarity=0.481  Sum_probs=183.0

Q ss_pred             HHHHhHHHHHHHHHHHHhhcchHHHHHHHHHhHhcCCCCccccccceeecCCCCCCCCCCCCCCCCCCCeEEeeccCCCC
Q 023691           33 ADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYR  112 (278)
Q Consensus        33 ~~~~~~~~~~l~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~a~~~~n~~kNRy~~i~p~D~tRV~L~~~~~~~  112 (278)
                      ..++...-..+..+.+.......+|.+||+.|+......   ..+++.+..++|..||||.||+|||+|||+|....+ .
T Consensus         5 ~~~~~~~~~~l~~~~~~~~~~~~~~~~Ef~~l~~~~~~~---~~~~~~~~~~~N~~KNRy~~i~p~D~tRV~L~~~~~-~   80 (307)
T d2shpa1           5 AAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKL---LYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDP-N   80 (307)
T ss_dssp             GGGHHHHHHHHHC----------CHHHHHHHHHGGGGGG---CCCCHHHHSGGGGGGSSSTTCCCCTTTEEECCC-----
T ss_pred             HHHHHHHHHHHHHHhhccchhHHHHHHHHHHhhCcCCCC---CcchhhhcChhhhhcCCCCCCCCCcCCEEEccCCCC-C
Confidence            344444333333333333322257999999998643211   345678889999999999999999999999986443 2


Q ss_pred             CCCCCcccccee--------ecCCCCcccceecccCCCcccHHHHHHHHHHhcCCeEEEecccccccccccccccccCCC
Q 023691          113 PAARGYINASLI--------STSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAED  184 (278)
Q Consensus       113 ~~~~dYINAs~V--------~~~~~~~~~~yIatQ~Pl~~T~~dFW~mV~e~~v~~IVmLt~~~E~~~~~kc~~YwP~~~  184 (278)
                      .+++||||||||        +|+..  ++.|||||+|+++|++|||+||||++|.+|||||...|++ ..+|.+|||.+.
T Consensus        81 ~~~~dYINAs~i~~~~~~~~dg~~~--~~~yIatQ~Pl~~Ti~dFW~MV~e~~~~~IVmL~~~~E~~-~~kc~~YwP~~~  157 (307)
T d2shpa1          81 EPVSDYINANIIMPEFETKCNNSKP--KKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERG-KSKCVKYWPDEY  157 (307)
T ss_dssp             ---CCEEEEEEECC-------------CCCEEEECCCCTTTHHHHHHHHHHHTCCEEEECSCSEETT-EESCCCCSCCTT
T ss_pred             CcccceeeeeeecccccccCCCCCC--cceeEEECCCCccchHHHHHHHHhcccceEEeecccccCC-cccccccCCCCC
Confidence            345899999999        56643  3799999999999999999999999999999999999976 589999999988


Q ss_pred             CceeeeeeEEEEEEEEEecccEEEEEeeeeecCCCCCceEEEEEeeCCCCCCCCCCChHHHHHHHHHHHcC---CCCCCC
Q 023691          185 GPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL---PPNFGP  261 (278)
Q Consensus       185 ~~~~~g~~~V~~~~~~~~~~~~~~r~l~v~~~~~~~~~r~V~h~~y~~Wpd~gvP~~~~~ll~~~~~~~~~---~~~~~P  261 (278)
                      +...+|.+.|++.++.. ..+++.|.|.|.+.+.+...|.|+||||++|||+|+|.++..+++|++.+++.   ....+|
T Consensus       158 ~~~~~g~~~v~~~~~~~-~~~~~~r~l~l~~~~~~~~~r~V~~~~~~~Wpd~~vP~~~~~ll~li~~v~~~~~~~~~~~P  236 (307)
T d2shpa1         158 ALKEYGVMRVRNVKESA-AHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGP  236 (307)
T ss_dssp             CEEEETTEEEEEEEEEE-CSSEEEEEEEEEETTEEEEEEEEEEEEECCCCSSSCCSCHHHHHHHHHHHHHHHHHSTTCCC
T ss_pred             CceecceEEEEEEEEEe-cCCeEEEEEEEEecCCCCcceEEEEEEeCCCCCCCCCCChHHHHHHHHHHHHHhhcccCCCC
Confidence            88899999999998876 57899999999876554445799999999999999999999999999887542   223489


Q ss_pred             EEEEcCc----chhhheecC
Q 023691          262 IVVHCRY----WENWCILHN  277 (278)
Q Consensus       262 ivVHCs~----tGtfiald~  277 (278)
                      ||||||+    ||||||||+
T Consensus       237 ivVHCs~GvgRtGtfia~~~  256 (307)
T d2shpa1         237 VVVHCSAGIGRTGTFIVIDI  256 (307)
T ss_dssp             EEEECSSSSHHHHHHHHHHH
T ss_pred             EEEEeCCCCcHHHHHHHHHH
Confidence            9999999    999999874
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure