Citrus Sinensis ID: 023728

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQLFCSSMQIALTHGCGNRERAQFANSEQDPVGMKPDKLKWMLHTWFS

ccEEEccccccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccEEEEcccccccccccHHHHHHccccccccccccccccccccccccccccEEEEccc

ccEEEEcccccHccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccHHHHHcHHHHHHHHHHHHHHcHHHHHccHHHHHHHccccccccccccHHHHHcccEEEEEEccccccccccccccccccHHHcccccccccccccccccEEEEEHHHcccccHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccHHHHHHHHHHcc

msfvfrgsradletgfpgfiperrtvrihagrpvnsnSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGhtelrlqmppaiafASRGRLQGLRLQLALLDREFDELDYETLRaldadnvptaasmseeeintlpvhkykvsgsqsgassmqlgsssspaekKLETSIsvgnlktedeltCTVCleqvnvgeivrslpclhqlFCSSMQIALThgcgnreraqfanseqdpvgmkpdkLKWMLHTWFS

msfvfrgsradletgfpgfipeRRTVRihagrpvnsNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGASsmqlgsssspaeKKLETSISvgnlktedelTCTVCLEQVNVGEIVRSLPCLHQLFCSSMQIALTHGCGNRERAQfanseqdpvgmkpdKLKWMLHTWFS

MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCqqlhaqaqahaVASGLLGHTELRLQMPPAIAFASrgrlqglrlqlallDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVsgsqsgassmqlgssssPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQLFCSSMQIALTHGCGNRERAQFANSEQDPVGMKPDKLKWMLHTWFS

***********LETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALD********************************************************LKTEDELTCTVCLEQVNVGEIVRSLPCLHQLFCSSMQIALTHGCGN********************LKWMLHTW**

*SFVFR*SRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRM*************************LRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETL*********************LPV*****************************************ELTCTVCLEQVNVGEIVRSLPCLHQLFCSSMQIALTHGCG**********************KWMLHTWFS

MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYK************************ETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQLFCSSMQIALTHGCGNRERAQFANSEQDPVGMKPDKLKWMLHTWFS

*SFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHA***GLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVP*AASMSEEEINTLPVHKYKVSG*********************************DELTCTVCLEQVNVGEIVRSLPCLHQLFCSSMQIALTHGCGNRERAQFANSEQDPVGMKPDKLKWMLHTWFS

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		278	2.2.26 [Sep-21-2011]
Q9M2S6		273	E3 ubiquitin-protein liga	yes	no	0.830	0.846	0.714	2e-87

>sp\|Q9M2S6\|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1	Back alignment and function desciption

 Score =  322 bits (824), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 189/235 (80%), Gaps = 4/235 (1%)

Query: 1   MSFVFRGSRADLETGFPG-FIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSS 59
           MSFVFRGSR DLE+GF G F+PERR +R+H  RPVNSNSLAFLVTVLLLFMILNSHQM  
Sbjct: 1   MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPP 60

Query: 60  NFLLWIVLGIFLLATSLRMYATC-QQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRG 118
           NFLLW+VLG+FL+AT+LRMYATC Q         A ASGL  HTELRL +PP+IA A+RG
Sbjct: 61  NFLLWLVLGVFLMATTLRMYATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRG 120

Query: 119 RLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGA 178
           RLQGLRLQLALLDREFD+LDYETLRALD+DNV T  SMSEEEIN LPVHKYKV   ++G 
Sbjct: 121 RLQGLRLQLALLDREFDDLDYETLRALDSDNVST-TSMSEEEINALPVHKYKVLDPENGC 179

Query: 179 SSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQL 233
           S  +  S+SS AEK L+ S +     TEDELTC+VCLEQV VGEIVR+LPCLHQ 
Sbjct: 180 SLAKQASTSSSAEKMLD-SANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQF 233

E3 ubiquitin-protein ligase that acts as a positive regulator of abscisic acid-related stress signal transduction.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		278
359486786		275	PREDICTED: E3 ubiquitin-protein ligase S	0.838	0.847	0.765	1e-91
224104393		275	predicted protein [Populus trichocarpa]	0.834	0.843	0.737	7e-91
359807355		274	uncharacterized protein LOC100777936 [Gl	0.838	0.850	0.791	1e-90
363807434		274	uncharacterized protein LOC100816448 [Gl	0.838	0.850	0.782	4e-90
307136233		275	protein binding protein [Cucumis melo su	0.838	0.847	0.766	9e-90
449441410		275	PREDICTED: E3 ubiquitin-protein ligase S	0.838	0.847	0.766	1e-89
255581543		276	protein binding protein, putative [Ricin	0.838	0.844	0.75	2e-88
147779997		262	hypothetical protein VITISV_012400 [Viti	0.794	0.843	0.752	5e-88
297820308		272	zinc finger family protein [Arabidopsis	0.830	0.849	0.717	9e-88
224109496		276	predicted protein [Populus trichocarpa]	0.838	0.844	0.766	2e-86

>gi\|359486786\|ref\|XP_002283148.2\| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Vitis vinifera] gi\|296086209\|emb\|CBI31650.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  342 bits (876), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 180/235 (76%), Positives = 204/235 (86%), Gaps = 2/235 (0%)

Query: 1   MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSN 60
           MSFVFRGSRAD+E+GFPGFIPERR VR+HA RPVN+NSLAFLVTVLLLFMILNSHQMS N
Sbjct: 1   MSFVFRGSRADIESGFPGFIPERRAVRVHAARPVNTNSLAFLVTVLLLFMILNSHQMSPN 60

Query: 61  FLLWIVLGIFLLATSLRMYATC-QQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGR 119
           FL+W+VLGIFL+AT+LRMYATC Q         A ASGLLGHTELRL MPP+IA A+RGR
Sbjct: 61  FLIWLVLGIFLMATTLRMYATCQQLQAQAQAHAAAASGLLGHTELRLHMPPSIALATRGR 120

Query: 120 LQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGAS 179
           LQGLRLQLALLDREFD+LDYETLRALD++NVPT  SMSEEEIN LPVHKYKV+G+Q G S
Sbjct: 121 LQGLRLQLALLDREFDDLDYETLRALDSENVPTTPSMSEEEINALPVHKYKVAGTQGGGS 180

Query: 180 SMQLGSSSSPAEKKLETSISVGNLKT-EDELTCTVCLEQVNVGEIVRSLPCLHQL 233
           SMQ GSSS+ AEKK + + +V + K  +DELTC+VCLEQVNVGE++RSLPCLHQ 
Sbjct: 181 SMQQGSSSASAEKKQDINNAVASTKAPDDELTCSVCLEQVNVGELIRSLPCLHQF 235

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224104393\|ref\|XP_002313422.1\| predicted protein [Populus trichocarpa] gi\|222849830\|gb\|EEE87377.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359807355\|ref\|NP_001241380.1\| uncharacterized protein LOC100777936 [Glycine max] gi\|255645784\|gb\|ACU23384.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|363807434\|ref\|NP_001242131.1\| uncharacterized protein LOC100816448 [Glycine max] gi\|255641194\|gb\|ACU20874.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|307136233\|gb\|ADN34069.1\| protein binding protein [Cucumis melo subsp. melo]	Back alignment and taxonomy information

>gi\|449441410\|ref\|XP_004138475.1\| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255581543\|ref\|XP_002531577.1\| protein binding protein, putative [Ricinus communis] gi\|223528807\|gb\|EEF30813.1\| protein binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|147779997\|emb\|CAN60068.1\| hypothetical protein VITISV_012400 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297820308\|ref\|XP_002878037.1\| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi\|297323875\|gb\|EFH54296.1\| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|224109496\|ref\|XP_002315216.1\| predicted protein [Populus trichocarpa] gi\|222864256\|gb\|EEF01387.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		278
TAIR\|locus:2100021		273	SDIR1 "SALT- AND DROUGHT-INDUC	0.827	0.842	0.628	8.9e-70
DICTYBASE\|DDB_G0282479		320	DDB_G0282479 "E3 ubiquitin-pro	0.104	0.090	0.413	4.1e-06
TAIR\|locus:2010582		634	AT1G04790 [Arabidopsis thalian	0.082	0.036	0.521	6e-05

TAIR\|locus:2100021 SDIR1 "SALT- AND DROUGHT-INDUCED RING FINGER1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 707 (253.9 bits), Expect = 8.9e-70, P = 8.9e-70
 Identities = 147/234 (62%), Positives = 164/234 (70%)

Query:     1 MSFVFRGSRADLETGFPG-FIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSS 59
             MSFVFRGSR DLE+GF G F+PERR +R+H  RPVNSNSLAFLVTVLLLFMILNSHQM  
Sbjct:     1 MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPP 60

Query:    60 NFLLWIVLGIFLLATSLRMYATCXXXXXXXXX-XXVASGLLGHTELRLQMPPAIAFASXX 118
             NFLLW+VLG+FL+AT+LRMYATC             ASGL  HTELRL +PP+IA A+  
Sbjct:    61 NFLLWLVLGVFLMATTLRMYATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRG 120

Query:   119 XXXXXXXXXXXXDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVXXXXXXX 178
                         DREFD+LDYETLRALD+DNV T  SMSEEEIN LPVHKYKV       
Sbjct:   121 RLQGLRLQLALLDREFDDLDYETLRALDSDNVSTT-SMSEEEINALPVHKYKVLDPENGC 179

Query:   179 XXXXXXXXXXPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQ 232
                        AEK L+ S +     TEDELTC+VCLEQV VGEIVR+LPCLHQ
Sbjct:   180 SLAKQASTSSSAEKMLD-SANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQ 232

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA

GO:0009414 "response to water deprivation" evidence=IEP

GO:0009651 "response to salt stress" evidence=IEP

GO:0009737 "response to abscisic acid stimulus" evidence=IEP

GO:0009789 "positive regulation of abscisic acid mediated signaling pathway" evidence=IMP

GO:0016567 "protein ubiquitination" evidence=IDA

GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA

GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA

GO:0006301 "postreplication repair" evidence=RCA

GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA

GO:0009086 "methionine biosynthetic process" evidence=RCA

DICTYBASE\|DDB_G0282479 DDB_G0282479 "E3 ubiquitin-protein ligase DMA2" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

TAIR\|locus:2010582 AT1G04790 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9M2S6	SDIR1_ARATH	6, ., 3, ., 2, ., -	0.7148	0.8309	0.8461	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00018451001	SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (275 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		278
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	0.001

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

 Score = 35.8 bits (83), Expect = 0.001
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%)

Query: 210 TCTVCLEQVNVGEIVRSLPCLHQLFCSS 237
            C +CL++   GE V  LPC H +F   
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGH-VFHKE 28

Length = 46

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		278
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	99.51
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.23
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	98.83
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.73
PHA02929		238	N1R/p28-like protein; Provisional	98.6
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.31
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.3
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.2
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.17
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	98.15
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.09
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.05
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	97.89
PHA02926		242	zinc finger-like protein; Provisional	97.85
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	97.85
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	97.72
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.7
PF14634		44	zf-RING_5: zinc-RING finger domain	97.54
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	97.53
KOG0801		205	consensus Predicted E3 ubiquitin ligase [Posttrans	97.46
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	97.45
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	97.43
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	97.34
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.19
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	97.18
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	97.13
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	97.1
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	96.94
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	96.91
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	96.88
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	96.86
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	96.84
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	96.64
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	96.54
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	96.53
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	96.5
KOG4445		368	consensus Uncharacterized conserved protein, conta	96.46
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	96.35
KOG0825		1134	consensus PHD Zn-finger protein [General function	95.95
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	95.52
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	95.35
COG5219		1525	Uncharacterized conserved protein, contains RING Z	94.79
KOG1941		518	consensus Acetylcholine receptor-associated protei	94.76
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	94.54
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	94.52
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	92.95
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	92.76
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	92.47
PF12906		47	RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A.	92.44
PF14446		54	Prok-RING_1: Prokaryotic RING finger family 1	91.71
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	90.67
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	90.6
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	90.16
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	90.04
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	89.85
KOG2034		911	consensus Vacuolar sorting protein PEP3/VPS18 [Int	89.8
KOG0297		391	consensus TNF receptor-associated factor [Signal t	89.77
PHA02825		162	LAP/PHD finger-like protein; Provisional	88.35
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	87.04
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	86.87
PHA03096		284	p28-like protein; Provisional	84.94
KOG3039		303	consensus Uncharacterized conserved protein [Funct	84.03
PHA02862		156	5L protein; Provisional	81.49
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	80.19
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	80.14

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.51  E-value=9.8e-15  Score=139.09  Aligned_cols=66  Identities=26%  Similarity=0.563  Sum_probs=55.1

Q ss_pred             CCCHHHHhcCCeeEeecCCCCCCCCcccCCCCCCchhhhcccccccCCCCCCCCcccccccccccCCCeeEEeCCCCccC
Q 023728          155 SMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQLF  234 (278)
Q Consensus       155 g~SeeeI~~LPv~~~~~~~~~~~ss~~~~sSSss~~e~kq~s~~a~~~~k~~d~~tCsICLEdf~~GE~Vr~LPC~H~FH  234 (278)
                      .+.+..+.++|+.+|+....                              .+...+|+||||+|++||++|.|||.|.||
T Consensus       206 r~~k~~l~~~p~~~f~~~~~------------------------------~~~~~~CaIClEdY~~GdklRiLPC~H~FH  255 (348)
T KOG4628|consen  206 RLIKRLLKKLPVRTFTKGDD------------------------------EDATDTCAICLEDYEKGDKLRILPCSHKFH  255 (348)
T ss_pred             hhHHHHHhhCCcEEeccccc------------------------------cCCCceEEEeecccccCCeeeEecCCCchh
Confidence            56889999999999986431                              012259999999999999999999999999


Q ss_pred             hhhHHHHHhcC---CCCcc
Q 023728          235 CSSMQIALTHG---CGNRE  250 (278)
Q Consensus       235 ~~CId~WLkrs---cg~~~  250 (278)
                      ..|||+||.+.   |+-=+
T Consensus       256 ~~CIDpWL~~~r~~CPvCK  274 (348)
T KOG4628|consen  256 VNCIDPWLTQTRTFCPVCK  274 (348)
T ss_pred             hccchhhHhhcCccCCCCC
Confidence            99999999977   66533

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A	Back alignment and domain information

>PF14446 Prok-RING_1: Prokaryotic RING finger family 1	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		278
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	3e-07
2ect_A		78	Ring finger protein 126; metal binding protein, st	3e-07
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	6e-07
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	7e-07
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	2e-06
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	2e-06
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	6e-04
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	6e-04

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91	Back alignment and structure

 Score = 46.6 bits (111), Expect = 3e-07
 Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 5/48 (10%)

Query: 189 PAEK----KLET-SISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLH 231
           PA K     L    ++  +     E+ C +C  +   G++   LPC H
Sbjct: 16  PASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHH 63

PyMOL of 2l0b

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		278
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.51
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.37
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.33
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	99.2
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.18
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.18
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.16
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	99.05
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.01
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	98.98
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.96
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.92
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.91
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.87
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.84
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.77
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.77
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.72
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.71
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.71
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.71
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.7
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.68
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.6
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	98.58
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.56
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.56
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.55
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.48
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.48
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.46
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	98.44
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.43
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.43
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.4
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.38
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.36
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.33
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.27
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.23
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.23
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.18
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	98.16
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	98.15
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.13
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.11
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.1
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.03
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.02
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.01
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.0
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	97.98
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	97.94
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	97.9
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	97.78
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	97.65
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	97.63
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	97.62
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	97.49
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	97.49
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	97.47
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	97.43
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	97.33
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.11
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	96.92
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	96.83
2ea5_A		68	Cell growth regulator with ring finger domain prot	96.72
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	96.68
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	96.6
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	96.52
3nw0_A		238	Non-structural maintenance of chromosomes element	96.2
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	93.65
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	91.79
1wil_A		89	KIAA1045 protein; ring finger domain, structural g	86.82
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	86.7

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

Probab=99.51  E-value=1.8e-14  Score=110.90  Aligned_cols=66  Identities=23%  Similarity=0.438  Sum_probs=56.1

Q ss_pred             CCCCCCCHHHHhcCCeeEeecCCCCCCCCcccCCCCCCchhhhcccccccCCCCCCCCcccccccccccCCCeeEEeCCC
Q 023728          151 PTAASMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCL  230 (278)
Q Consensus       151 ~~~~g~SeeeI~~LPv~~~~~~~~~~~ss~~~~sSSss~~e~kq~s~~a~~~~k~~d~~tCsICLEdf~~GE~Vr~LPC~  230 (278)
                      ....+++++.|++||..+++....                             ..+++..|+||+++|..++.++.|||+
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~~-----------------------------~~~~~~~C~IC~~~~~~~~~~~~l~C~   62 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDHG-----------------------------AVGQEMCCPICCSEYVKGDVATELPCH   62 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTCS-----------------------------SSSSCSEETTTTEECCTTCEEEEETTT
T ss_pred             cCCCCCCHHHHHhCCCeeeccccc-----------------------------ccCCCCCCcccChhhcCCCcEEecCCC
Confidence            445689999999999888864321                             124678999999999999999999999


Q ss_pred             CccChhhHHHHHhcC
Q 023728          231 HQLFCSSMQIALTHG  245 (278)
Q Consensus       231 H~FH~~CId~WLkrs  245 (278)
                      |.||..||++||+++
T Consensus        63 H~Fh~~Ci~~wl~~~   77 (91)
T 2l0b_A           63 HYFHKPCVSIWLQKS   77 (91)
T ss_dssp             EEEEHHHHHHHHTTT
T ss_pred             ChHHHHHHHHHHHcC
Confidence            999999999999875

PyMOL of 2l0b

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		278
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	1e-05

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 39.9 bits (93), Expect = 1e-05
 Identities = 11/32 (34%), Positives = 16/32 (50%)

Query: 206 EDELTCTVCLEQVNVGEIVRSLPCLHQLFCSS 237
           +D + C VCL ++  GE  R LP     F + 
Sbjct: 3   DDGVECAVCLAELEDGEEARFLPRCGHGFHAE 34

PyMOL of d1iyma_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		278
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.35
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	99.19
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.93
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.88
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.87
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.83
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.62
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.53
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.34
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.32
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.3
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.25
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.18
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.01
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	97.98
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	97.83
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	97.16
d1wila_		89	Hypothetical protein KIAA1045 {Human (Homo sapiens	87.3
d1wewa_		78	Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop	86.15

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.35  E-value=1.4e-13  Score=96.14  Aligned_cols=41  Identities=32%  Similarity=0.647  Sum_probs=37.3

Q ss_pred             CCCcccccccccccCCCeeEEeC-CCCccChhhHHHHHhcCC
Q 023728          206 EDELTCTVCLEQVNVGEIVRSLP-CLHQLFCSSMQIALTHGC  246 (278)
Q Consensus       206 ~d~~tCsICLEdf~~GE~Vr~LP-C~H~FH~~CId~WLkrsc  246 (278)
                      +++.+|+||+++|.+|+.++.+| |+|.||.+||++||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~   44 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHS   44 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCC
Confidence            46778999999999999999986 999999999999998763

PyMOL of d1iyma_

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure