Citrus Sinensis ID: 023827

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLSVM
cccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccEEEcccccHHHHHHHcccHHHHHHHHcccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccEEEccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccc
cccccccHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccEEEcccccHHHHHHccccHHHHHHHHHcccccccccccccEEcccccccccccccHHHcHcHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcccEEEcccHHHHcccccHHHHcHHcccccEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEEcc
mrfisesseeripcyrvldddgqpfpdssfvKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAaiknddfvvpqyrepgvllwRGFSMQEFAnqcfgnkadygkgrqmpihygsnkhnyftVSSTIATQLPHAVGAAYALkmdrkdacavtyfgdggtsegdfHAALnfsavteaPVIFIcrnngwaistpisdqfrsdgavvkgrAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLSVM
mrfisesseeriPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTpisdqfrsdgAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLSVM
MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEainiasaaaiKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLSVM
************PCYRVLDD****F*DSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLS**
********EERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFL***
*********ERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLSVM
**FISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLSVM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLSVM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query276 2.2.26 [Sep-21-2011]
Q54M22 441 2-oxoisovalerate dehydrog yes no 0.902 0.564 0.523 2e-77
O45924 431 2-oxoisovalerate dehydrog yes no 0.909 0.582 0.533 6e-77
P12694 445 2-oxoisovalerate dehydrog yes no 0.952 0.591 0.509 5e-74
A5A6H9 445 2-oxoisovalerate dehydrog yes no 0.952 0.591 0.509 5e-74
Q8HXY4 445 2-oxoisovalerate dehydrog N/A no 0.952 0.591 0.509 5e-74
P11960 441 2-oxoisovalerate dehydrog yes no 0.952 0.596 0.505 2e-73
P50136 442 2-oxoisovalerate dehydrog yes no 0.952 0.595 0.501 5e-73
P11178 455 2-oxoisovalerate dehydrog yes no 0.952 0.578 0.505 6e-73
P37940330 2-oxoisovalerate dehydrog yes no 0.818 0.684 0.408 4e-43
Q72GU1367 2-oxoisovalerate dehydrog yes no 0.909 0.683 0.404 3e-42
>sp|Q54M22|ODBA_DICDI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=bkdA PE=3 SV=1 Back     alignment and function desciption
 Score =  288 bits (738), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 178/256 (69%), Gaps = 7/256 (2%)

Query: 12  IPCYRVLDDDG---QPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYL 68
           IPCY ++D +G   +P  D +F K      IKMY  M+TL  MD+I Y+ QRQGRISFY+
Sbjct: 64  IPCYTIMDQEGVVSKPDQDPNFSKEE---VIKMYTTMLTLNVMDSILYDVQRQGRISFYM 120

Query: 69  TTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMP 128
           T+ GEEAI+I SAAA++  D +  QYRE GV +WRGF++ +  NQC  N+ D GKGRQMP
Sbjct: 121 TSFGEEAIHIGSAAALEMSDTIFAQYRETGVFMWRGFTINDIINQCCTNEHDLGKGRQMP 180

Query: 129 IHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNF 188
           +H+GS K N  T+SS + TQLP AVG++YA K+  +  C + YFG+G  SEGDFHAA+NF
Sbjct: 181 MHFGSRKINLQTISSPLTTQLPQAVGSSYAQKLAGEKNCTIVYFGEGAASEGDFHAAMNF 240

Query: 189 SAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKG-RAYGVRSIRVDGNDALAIYSAVH 247
           +A    P IF CRNN WAISTP  +Q++ DG   +G   YG+++IRVDGND  A+Y+   
Sbjct: 241 AAALSTPTIFFCRNNKWAISTPSKEQYKGDGIAGRGPNGYGMKTIRVDGNDIWAVYNVTK 300

Query: 248 AAREMAIGEGRPILIE 263
            AR++A+ E  P+LIE
Sbjct: 301 LARKIAVEEQVPVLIE 316
The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Dictyostelium discoideum (taxid: 44689)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 4
>sp|O45924|ODBA_CAEEL 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=Y39E4A.3 PE=1 SV=2 Back     alignment and function description
>sp|P12694|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2 Back     alignment and function description
>sp|A5A6H9|ODBA_PANTR 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Pan troglodytes GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|Q8HXY4|ODBA_MACFA 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Macaca fascicularis GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|P11960|ODBA_RAT 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) OS=Rattus norvegicus GN=Bckdha PE=1 SV=1 Back     alignment and function description
>sp|P50136|ODBA_MOUSE 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Mus musculus GN=Bckdha PE=1 SV=1 Back     alignment and function description
>sp|P11178|ODBA_BOVIN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Bos taurus GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|P37940|ODBA_BACSU 2-oxoisovalerate dehydrogenase subunit alpha OS=Bacillus subtilis (strain 168) GN=bfmBAA PE=1 SV=1 Back     alignment and function description
>sp|Q72GU1|ODBA_THET2 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C1757 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
297811017 472 hypothetical protein ARALYDRAFT_350155 [ 0.952 0.557 0.825 1e-128
18415939 472 2-oxoisovalerate dehydrogenase E1 compon 0.952 0.557 0.813 1e-128
42573319 401 2-oxoisovalerate dehydrogenase E1 compon 0.952 0.655 0.813 1e-128
9955517 414 branched-chain alpha keto-acid dehydroge 0.952 0.635 0.813 1e-128
413916414 392 hypothetical protein ZEAMMB73_816012 [Ze 0.956 0.673 0.795 1e-127
212275011 488 uncharacterized protein LOC100191513 [Ze 0.952 0.538 0.794 1e-126
356508967 474 PREDICTED: 2-oxoisovalerate dehydrogenas 0.952 0.554 0.817 1e-126
218186540 479 hypothetical protein OsI_37710 [Oryza sa 0.952 0.549 0.806 1e-126
222616745 512 hypothetical protein OsJ_35450 [Oryza sa 0.952 0.513 0.802 1e-125
108862263 487 2-oxoisovalerate dehydrogenase alpha sub 0.952 0.540 0.802 1e-125
>gi|297811017|ref|XP_002873392.1| hypothetical protein ARALYDRAFT_350155 [Arabidopsis lyrata subsp. lyrata] gi|297319229|gb|EFH49651.1| hypothetical protein ARALYDRAFT_350155 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/263 (82%), Positives = 238/263 (90%)

Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           +RFISES  ER+PCYRVLDD+GQ   +S FV+VSE VA+K+Y+DMVTLQ MD IFYEAQR
Sbjct: 93  IRFISESDSERVPCYRVLDDNGQLITNSQFVQVSEEVAVKIYSDMVTLQIMDNIFYEAQR 152

Query: 61  QGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGR+SFY T  GEEAINIASAAA+   D + PQYREPGVLLWRGF++QEFANQCFGNK+D
Sbjct: 153 QGRLSFYATAIGEEAINIASAAALTPQDVIFPQYREPGVLLWRGFTLQEFANQCFGNKSD 212

Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEG 180
           YGKGRQMP+HYGSNK NYFTVS+TIATQLP+AVGAAY+LKMDRKDACAVTYFGDGGTSEG
Sbjct: 213 YGKGRQMPVHYGSNKLNYFTVSATIATQLPNAVGAAYSLKMDRKDACAVTYFGDGGTSEG 272

Query: 181 DFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL 240
           DFHAALNF+AV EAPVIFICRNNGWAISTP SDQFRSDG VVKGRAYG+RSIRVDGNDAL
Sbjct: 273 DFHAALNFAAVMEAPVIFICRNNGWAISTPTSDQFRSDGVVVKGRAYGIRSIRVDGNDAL 332

Query: 241 AIYSAVHAAREMAIGEGRPILIE 263
           A+YSAVH AR MAI E RPILIE
Sbjct: 333 AMYSAVHTARGMAISEQRPILIE 355

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18415939|ref|NP_568209.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] gi|28393751|gb|AAO42286.1| putative branched-chain alpha keto-acid dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|28973423|gb|AAO64036.1| putative branched-chain alpha keto-acid dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|332003988|gb|AED91371.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42573319|ref|NP_974756.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] gi|332003989|gb|AED91372.1| 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9955517|emb|CAC05456.1| branched-chain alpha keto-acid dehydrogenase E1 alpha subunit-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413916414|gb|AFW56346.1| hypothetical protein ZEAMMB73_816012 [Zea mays] Back     alignment and taxonomy information
>gi|212275011|ref|NP_001130417.1| uncharacterized protein LOC100191513 [Zea mays] gi|194689064|gb|ACF78616.1| unknown [Zea mays] gi|194690354|gb|ACF79261.1| unknown [Zea mays] gi|194690522|gb|ACF79345.1| unknown [Zea mays] gi|194703080|gb|ACF85624.1| unknown [Zea mays] gi|413916413|gb|AFW56345.1| hypothetical protein ZEAMMB73_816012 [Zea mays] Back     alignment and taxonomy information
>gi|356508967|ref|XP_003523224.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|218186540|gb|EEC68967.1| hypothetical protein OsI_37710 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|222616745|gb|EEE52877.1| hypothetical protein OsJ_35450 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|108862263|gb|ABA95968.2| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi|108862264|gb|ABA95969.2| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
TAIR|locus:2184702 472 AT5G09300 "AT5G09300" [Arabido 0.952 0.557 0.779 2.6e-111
TAIR|locus:2027072 472 AT1G21400 "AT1G21400" [Arabido 0.956 0.559 0.734 1.2e-106
UNIPROTKB|B4DP47 448 BCKDHA "2-oxoisovalerate dehyd 0.989 0.609 0.487 8e-69
WB|WBGene00012713 432 Y39E4A.3 [Caenorhabditis elega 0.949 0.606 0.496 1.7e-68
FB|FBgn0037709 439 CG8199 [Drosophila melanogaste 0.913 0.574 0.503 2.1e-68
UNIPROTKB|F5H5P2 479 BCKDHA "Uncharacterized protei 0.952 0.549 0.494 2.1e-68
UNIPROTKB|P12694 445 BCKDHA "2-oxoisovalerate dehyd 0.952 0.591 0.494 2.1e-68
ZFIN|ZDB-GENE-050522-376 446 bckdha "branched chain keto ac 0.952 0.589 0.498 3.5e-68
UNIPROTKB|E2RPW4 530 B3GNT8 "Uncharacterized protei 0.952 0.496 0.494 5.6e-68
UNIPROTKB|F1PI86 480 B3GNT8 "Uncharacterized protei 0.952 0.547 0.494 5.6e-68
TAIR|locus:2184702 AT5G09300 "AT5G09300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1099 (391.9 bits), Expect = 2.6e-111, P = 2.6e-111
 Identities = 205/263 (77%), Positives = 229/263 (87%)

Query:     1 MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
             ++FISES +ER+PCYRVLDD+GQ   +S FV+VSE VA+K+Y+DMVTLQ MD IFYEAQR
Sbjct:    93 IQFISESDKERVPCYRVLDDNGQLITNSQFVQVSEEVAVKIYSDMVTLQIMDNIFYEAQR 152

Query:    61 QGRISFYLTTSGEEXXXXXXXXXXKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
             QGR+SFY T  GEE             D + PQYREPGVLLWRGF++QEFANQCFGNK+D
Sbjct:   153 QGRLSFYATAIGEEAINIASAAALTPQDVIFPQYREPGVLLWRGFTLQEFANQCFGNKSD 212

Query:   121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEG 180
             YGKGRQMP+HYGSNK NYFTVS+TIATQLP+AVGAAY+LKMD+KDACAVTYFGDGGTSEG
Sbjct:   213 YGKGRQMPVHYGSNKLNYFTVSATIATQLPNAVGAAYSLKMDKKDACAVTYFGDGGTSEG 272

Query:   181 DFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL 240
             DFHAALN +AV EAPV+FICRNNGWAISTP SDQFRSDG VVKGRAYG+RSIRVDGNDAL
Sbjct:   273 DFHAALNIAAVMEAPVLFICRNNGWAISTPTSDQFRSDGVVVKGRAYGIRSIRVDGNDAL 332

Query:   241 AIYSAVHAAREMAIGEGRPILIE 263
             A+YSAVH AREMAI E RPILIE
Sbjct:   333 AMYSAVHTAREMAIREQRPILIE 355
GO:0003863 "3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA
TAIR|locus:2027072 AT1G21400 "AT1G21400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B4DP47 BCKDHA "2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00012713 Y39E4A.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0037709 CG8199 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F5H5P2 BCKDHA "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P12694 BCKDHA "2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-376 bckdha "branched chain keto acid dehydrogenase E1, alpha polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPW4 B3GNT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI86 B3GNT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
cd02000293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosph 1e-109
COG1071358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogena 4e-89
TIGR03181341 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E 1e-86
pfam00676303 pfam00676, E1_dh, Dehydrogenase E1 component 2e-78
TIGR03182315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E 2e-45
CHL00149341 CHL00149, odpA, pyruvate dehydrogenase E1 componen 6e-27
PLN02374433 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl 4e-26
PLN02269362 PLN02269, PLN02269, Pyruvate dehydrogenase E1 comp 6e-24
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 4e-11
cd02012255 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) fami 1e-10
PRK05899 586 PRK05899, PRK05899, transketolase; Reviewed 4e-08
COG3959243 COG3959, COG3959, Transketolase, N-terminal subuni 3e-06
COG0021 663 COG0021, TktA, Transketolase [Carbohydrate transpo 7e-05
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 9e-05
cd02007195 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) fam 0.001
cd02011227 cd02011, TPP_PK, Thiamine pyrophosphate (TPP) fami 0.002
>gnl|CDD|238958 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information 
 Score =  317 bits (814), Expect = e-109
 Identities = 100/227 (44%), Positives = 133/227 (58%), Gaps = 1/227 (0%)

Query: 41  MYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKNDDFVVPQYREPGV 99
           +Y  MV ++  D    E  RQG+I  FY  + G+EA+ +  AAA++  D+V P YR+ G 
Sbjct: 1   LYRTMVLIRRFDERLLELYRQGKIGGFYHLSIGQEAVAVGVAAALRPGDWVFPTYRDHGH 60

Query: 100 LLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYAL 159
            L RG  ++E   + FG +    KGR   +H G  + N+F  +  +  Q+P A GAA AL
Sbjct: 61  ALARGVDLKEMLAELFGKETGPCKGRGGSMHIGDKEKNFFGGNGIVGGQVPLAAGAALAL 120

Query: 160 KMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDG 219
           K   +D  AV +FGDG T+EGDFH ALNF+A+ + PVIF+C NNG+AISTP S Q     
Sbjct: 121 KYRGEDRVAVCFFGDGATNEGDFHEALNFAALWKLPVIFVCENNGYAISTPTSRQTAGTS 180

Query: 220 AVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEVKC 266
              +  AYG+  IRVDGND LA+Y A   A E A   G P LIE   
Sbjct: 181 IADRAAAYGIPGIRVDGNDVLAVYEAAKEAVERARAGGGPTLIEAVT 227

PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine). Length = 293
>gnl|CDD|223997 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|213783 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|201386 pfam00676, E1_dh, Dehydrogenase E1 component Back     alignment and domain information
>gnl|CDD|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215213 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>gnl|CDD|215152 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|238970 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>gnl|CDD|235639 PRK05899, PRK05899, transketolase; Reviewed Back     alignment and domain information
>gnl|CDD|226468 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223100 COG0021, TktA, Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|238965 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>gnl|CDD|238969 cd02011, TPP_PK, Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 276
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 100.0
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 100.0
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 100.0
KOG1182 432 consensus Branched chain alpha-keto acid dehydroge 100.0
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 100.0
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 100.0
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 100.0
KOG0225394 consensus Pyruvate dehydrogenase E1, alpha subunit 100.0
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 100.0
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 100.0
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 100.0
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 100.0
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 100.0
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 100.0
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.97
PRK12754 663 transketolase; Reviewed 99.97
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 99.97
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 99.97
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 99.96
PRK12753 663 transketolase; Reviewed 99.96
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 99.96
PTZ00089 661 transketolase; Provisional 99.96
PRK05899 624 transketolase; Reviewed 99.95
PLN02790 654 transketolase 99.95
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.95
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 99.95
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.94
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 99.94
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 99.94
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 99.93
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 99.93
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 99.93
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.93
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 99.92
COG0021 663 TktA Transketolase [Carbohydrate transport and met 99.92
KOG0523 632 consensus Transketolase [Carbohydrate transport an 99.92
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 99.92
KOG0451 913 consensus Predicted 2-oxoglutarate dehydrogenase, 99.88
PRK05261 785 putative phosphoketolase; Provisional 99.86
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydro 99.85
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.83
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.83
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.82
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.82
KOG0450 1017 consensus 2-oxoglutarate dehydrogenase, E1 subunit 99.81
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.8
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.8
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.79
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.79
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.79
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.79
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.78
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.78
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 99.77
PRK06163202 hypothetical protein; Provisional 99.77
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.77
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.76
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.76
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 99.76
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.76
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.75
PRK07524535 hypothetical protein; Provisional 99.75
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.73
PRK08327569 acetolactate synthase catalytic subunit; Validated 99.72
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 99.72
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 99.72
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.72
PRK12474518 hypothetical protein; Provisional 99.71
PRK06154565 hypothetical protein; Provisional 99.71
COG2609 887 AceE Pyruvate dehydrogenase complex, dehydrogenase 99.71
PRK08266542 hypothetical protein; Provisional 99.7
PRK09124574 pyruvate dehydrogenase; Provisional 99.7
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 99.7
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 99.7
PRK11269591 glyoxylate carboligase; Provisional 99.7
PRK05858542 hypothetical protein; Provisional 99.7
PRK06546578 pyruvate dehydrogenase; Provisional 99.7
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 99.7
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.7
PRK07092530 benzoylformate decarboxylase; Reviewed 99.7
PRK07064544 hypothetical protein; Provisional 99.69
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.69
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 99.69
PRK07586514 hypothetical protein; Validated 99.69
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 99.69
PLN02573578 pyruvate decarboxylase 99.68
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 99.68
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 99.68
PRK08273597 thiamine pyrophosphate protein; Provisional 99.68
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 99.68
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 99.67
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 99.67
PRK08199557 thiamine pyrophosphate protein; Validated 99.67
PRK08611576 pyruvate oxidase; Provisional 99.67
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 99.67
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 99.67
PRK08617552 acetolactate synthase; Reviewed 99.67
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 99.67
PRK08322547 acetolactate synthase; Reviewed 99.67
PRK06112578 acetolactate synthase catalytic subunit; Validated 99.67
PRK08155564 acetolactate synthase catalytic subunit; Validated 99.67
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 99.66
PRK06457549 pyruvate dehydrogenase; Provisional 99.66
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 99.66
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 99.66
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 99.66
CHL00099585 ilvB acetohydroxyacid synthase large subunit 99.66
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 99.65
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 99.65
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 99.65
PLN02470585 acetolactate synthase 99.65
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 99.64
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.64
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 99.64
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 99.63
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 99.62
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 99.62
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.62
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 99.61
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.61
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.6
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.59
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 99.58
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.57
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 99.53
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.53
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.52
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.4
PF09364379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 99.36
KOG1185571 consensus Thiamine pyrophosphate-requiring enzyme 99.36
COG3962617 Acetolactate synthase [Amino acid transport and me 99.27
KOG1184561 consensus Thiamine pyrophosphate-requiring enzyme 99.23
KOG4166675 consensus Thiamine pyrophosphate-requiring enzyme 99.22
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 99.16
COG3960592 Glyoxylate carboligase [General function predictio 99.02
COG3957 793 Phosphoketolase [Carbohydrate transport and metabo 98.66
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 98.62
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 98.47
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 98.43
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 97.72
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 97.7
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.64
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 97.32
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 96.98
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 96.8
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 96.7
TIGR021761165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 96.62
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 96.58
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 96.56
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 96.46
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 96.4
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 95.05
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 94.84
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 94.49
PRK07119 352 2-ketoisovalerate ferredoxin reductase; Validated 94.48
PRK08611 576 pyruvate oxidase; Provisional 94.19
TIGR03297 361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 94.18
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 94.12
PRK07524 535 hypothetical protein; Provisional 94.06
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 94.02
PRK08659 376 2-oxoglutarate ferredoxin oxidoreductase subunit a 94.01
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 93.61
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 93.56
PRK08266 542 hypothetical protein; Provisional 93.54
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 93.51
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 93.33
PRK07064 544 hypothetical protein; Provisional 93.22
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 93.21
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 93.18
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 93.16
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 93.12
PRK06457 549 pyruvate dehydrogenase; Provisional 93.07
PRK06112 578 acetolactate synthase catalytic subunit; Validated 93.07
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 92.95
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 92.82
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 92.73
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 92.72
TIGR03710 562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 92.69
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 92.67
PRK08322 547 acetolactate synthase; Reviewed 92.67
PRK11269 591 glyoxylate carboligase; Provisional 92.67
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 92.63
PLN02470 585 acetolactate synthase 92.63
PRK08366 390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 92.59
PRK08273 597 thiamine pyrophosphate protein; Provisional 92.49
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 92.42
PRK07586 514 hypothetical protein; Validated 92.33
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 92.33
PRK08199 557 thiamine pyrophosphate protein; Validated 92.22
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 92.12
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 91.96
PRK08155 564 acetolactate synthase catalytic subunit; Validated 91.92
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 91.54
cd01460266 vWA_midasin VWA_Midasin: Midasin is a member of th 91.48
PRK08617 552 acetolactate synthase; Reviewed 91.43
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 91.42
PRK12474 518 hypothetical protein; Provisional 91.42
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 91.4
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 91.3
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 91.25
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 91.19
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 91.19
TIGR03394 535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 91.11
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 90.57
PRK08327 569 acetolactate synthase catalytic subunit; Validated 90.5
PRK05858 542 hypothetical protein; Provisional 90.42
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 90.26
PRK09627 375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 89.93
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 89.56
PRK09622 407 porA pyruvate flavodoxin oxidoreductase subunit al 89.45
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 89.39
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 89.38
PRK08367 394 porA pyruvate ferredoxin oxidoreductase subunit al 89.2
PRK09124 574 pyruvate dehydrogenase; Provisional 89.18
PLN02573 578 pyruvate decarboxylase 88.71
PLN02683 356 pyruvate dehydrogenase E1 component subunit beta 88.64
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 88.58
KOG4166 675 consensus Thiamine pyrophosphate-requiring enzyme 88.57
PRK06546 578 pyruvate dehydrogenase; Provisional 88.5
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 88.39
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 88.29
PRK06154 565 hypothetical protein; Provisional 88.18
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 87.75
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 87.58
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 87.18
TIGR00173 432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 86.99
PRK07092 530 benzoylformate decarboxylase; Reviewed 86.65
PRK05899 624 transketolase; Reviewed 86.37
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 86.28
PTZ00089 661 transketolase; Provisional 85.86
COG0021 663 TktA Transketolase [Carbohydrate transport and met 82.38
PLN02790 654 transketolase 81.77
COG0674 365 PorA Pyruvate:ferredoxin oxidoreductase and relate 81.44
PTZ00182 355 3-methyl-2-oxobutanate dehydrogenase; Provisional 81.22
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 80.82
PRK12753 663 transketolase; Reviewed 80.49
PRK12754 663 transketolase; Reviewed 80.41
PRK09212 327 pyruvate dehydrogenase subunit beta; Validated 80.05
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=4.1e-69  Score=492.17  Aligned_cols=262  Identities=37%  Similarity=0.618  Sum_probs=249.8

Q ss_pred             CeeEeeCCCCCCCCCCCCC--CCCHHHHHHHHHHHHHHhhHHHHHHHHHhcCccc-ccccCChhHHHHHHHHhccCCC-c
Q 023827           13 PCYRVLDDDGQPFPDSSFV--KVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKND-D   88 (276)
Q Consensus        13 ~~~~~~~~~g~~~~~~~~~--~~~~~~l~~ly~~m~~~R~~d~~~~~~~~~g~~~-~~~~~~G~Ea~~~~~~~al~~~-D   88 (276)
                      +.+++++.+|+...+....  .+++++++++|++|+++|.||+++.+++++|+++ |+|+++||||++++++.+|+++ |
T Consensus         2 ~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~y~~M~l~R~fd~k~~~l~r~G~i~gf~~~~~GqEA~~vg~~~aL~~~~D   81 (358)
T COG1071           2 SLIRVLDEDGRAVDELPGPNAALSKEELLELYRLMLLIRRFDEKMLQLQRQGKIGGFYHLYIGQEAVQVGAAAALRPGED   81 (358)
T ss_pred             CceeccCcccccccccccccccCCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccCcCCcccHHHHHHHHHHhcCCCCC
Confidence            5789999999998776443  7999999999999999999999999999999997 9999999999999999999966 9


Q ss_pred             EEEccCCcHHHHHHcCCCHHHHHHHhhcCCCCCCCCCCCccccCCCCCCccccccccccccchhhhHHHHhhhcCCCc-e
Q 023827           89 FVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDA-C  167 (276)
Q Consensus        89 ~~~~~yR~~~~~~~~G~~~~~~l~~~~~~~~~~~~G~~~~~h~~~~~~~~~~~~g~lG~~l~~A~G~A~a~k~~~~~~-~  167 (276)
                      |++++||+|++++++|+|+.++|++++|+.+|+|+|+++++|+.+++.++++.++++|.|+|+|+|+|+|.|+++.+. +
T Consensus        82 ~i~~~YR~h~~~l~~G~~~~~~~a~~~G~~~g~~kGr~~~~h~~~~~~~~~~~~~iVg~Q~~~AaG~A~a~k~~~~~~~V  161 (358)
T COG1071          82 WIFPTYRDHGHLLARGVPLKEIMAELLGKATGPCKGRGGSMHYSDKEKGFLGGSGIVGTQIPLAAGAALALKYRGTKDGV  161 (358)
T ss_pred             EeecccCccccceecCCCHHHHHHHHhccccCCCCCCCCcccccccccccCCCCceecccccHHHHHHHHHHHhCCCCcE
Confidence            999999999999999999999999999999999999999999998889999999999999999999999999999555 9


Q ss_pred             EEEEECCCcCCcchHHHHHHHHHHCCCCEEEEEEeCCccccccccCccCCcchhhhHhhcCceEEEEcCCCHHHHHHHHH
Q 023827          168 AVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVH  247 (276)
Q Consensus       168 vv~~~GDG~~~~G~~~Eal~~A~~~~Lpvi~vv~nN~~~~~~~~~~~~~~~~~~~~a~a~G~~~~~vdg~d~~~v~~a~~  247 (276)
                      ++|++|||+.++|+|||+||+|+.|+||+||+|+||+|+||+|...+...+.++.++.+||+|+++|||+|+.+++++++
T Consensus       162 a~~~~GDGat~qG~FhEalN~A~v~klPvvf~ieNN~yAiSvp~~~q~~~~~~~~ra~aygipgv~VDG~D~~avy~~~~  241 (358)
T COG1071         162 AVAFFGDGATNQGDFHEALNFAAVWKLPVVFVIENNQYAISVPRSRQTAAEIIAARAAAYGIPGVRVDGNDVLAVYEAAK  241 (358)
T ss_pred             EEEEecCCccccchHHHHHHHHHHhcCCEEEEEecCCceeecchhhcccchhHHhhhhccCCCeEEECCcCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999888777777778889999999999999999999999999


Q ss_pred             HHHHHhHccCCCEEEEEEEecCCCCCC
Q 023827          248 AAREMAIGEGRPILIEVKCLSFSIFLS  274 (276)
Q Consensus       248 ~a~~~~r~~~~P~lIe~~t~R~~g~~~  274 (276)
                      +|++++|++++|+|||+.|||+.||+.
T Consensus       242 ~A~e~AR~g~GPtLIE~~tYR~~~HS~  268 (358)
T COG1071         242 EAVERARAGEGPTLIEAVTYRYGGHST  268 (358)
T ss_pred             HHHHHHHcCCCCEEEEEEEeecCCCCC
Confidence            999999999999999999999999985

>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>KOG1182 consensus Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>KOG0451 consensus Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>KOG0450 consensus 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PLN02683 pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
1v1m_A 400 Crosstalk Between Cofactor Binding And The Phosphor 2e-71
1v16_A 400 Crosstalk Between Cofactor Binding And The Phosphor 2e-71
1dtw_A 400 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 2e-71
2bff_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-71
1x7y_A 400 Crystal Structure Of The Human Mitochondrial Branch 2e-71
1olu_A 400 Roles Of His291-Alpha And His146-Beta' In The Reduc 2e-71
1v11_A 400 Crosstalk Between Cofactor Binding And The Phosphor 2e-71
1x80_A 400 Crystal Structure Of The Human Mitochondrial Branch 3e-71
1x7w_A 400 Crystal Structure Of The Human Mitochondrial Branch 3e-71
2j9f_A 400 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 3e-71
1x7z_A 400 Crystal Structure Of The Human Mitochondrial Branch 3e-71
1x7x_A 400 Crystal Structure Of The Human Mitochondrial Branch 3e-71
2bfc_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 8e-71
2bfb_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-70
2bfd_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-70
2bfe_A 400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-69
1um9_A367 Branched-chain 2-oxo Acid Dehydrogenase (e1) From T 1e-39
3duf_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 2e-38
1w85_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1 2e-38
1w88_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1( 5e-38
3dva_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 9e-38
2bp7_A410 New Crystal Form Of The Pseudomonas Putida Branched 4e-34
1qs0_A407 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 2e-31
3exf_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-15
3exe_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-15
2ozl_A365 Human Pyruvate Dehydrogenase S264e Variant Length = 3e-15
3exh_C382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-15
3exi_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 7e-15
1ni4_A365 Human Pyruvate Dehydrogenase Length = 365 4e-13
>pdb|1V1M|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure 
Iteration: 1

 Score =  265 bits (677), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 167/264 (63%)
Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           + FI  +    IP YRV+D  GQ    S    + +   +K+Y  M  L TMD I YE+QR
Sbjct: 20  LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQR 79
Query: 61  QGRISFYLTTSGEEXXXXXXXXXXKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGRISFY+T  GEE           N D V  QYRE GVL++R + ++ F  QC+GN +D
Sbjct: 80  QGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISD 139
Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEG 180
            GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K    +   + YFG+G  SEG
Sbjct: 140 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEG 199
Query: 181 DFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL 240
           D HA  NF+A  E P+IF CRNNG+AISTP S+Q+R DG   +G  YG+ SIRVDGND  
Sbjct: 200 DAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVF 259
Query: 241 AIYSAVHAAREMAIGEGRPILIEV 264
           A+Y+A   AR  A+ E +P LIE 
Sbjct: 260 AVYNATKEARRRAVAENQPFLIEA 283
>pdb|1V16|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|1DTW|A Chain A, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BFF|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1X7Y|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1OLU|A Chain A, Roles Of His291-Alpha And His146-Beta' In The Reductive Acylation Reaction Catalyzed By Human Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1V11|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|1X80|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7W|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2J9F|A Chain A, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 400 Back     alignment and structure
>pdb|1X7Z|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7X|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BFC|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFB|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFD|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFE|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1UM9|A Chain A, Branched-chain 2-oxo Acid Dehydrogenase (e1) From Thermus Thermophilus Hb8 In Apo-form Length = 367 Back     alignment and structure
>pdb|3DUF|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|1W85|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|1W88|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1(D180n, E183q) Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|3DVA|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|2BP7|A Chain A, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 410 Back     alignment and structure
>pdb|1QS0|A Chain A, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 407 Back     alignment and structure
>pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXE|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|2OZL|A Chain A, Human Pyruvate Dehydrogenase S264e Variant Length = 365 Back     alignment and structure
>pdb|3EXH|C Chain C, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXI|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex With The Subunit-Binding Domain (Sbd) Of E2p, But Sbd Cannot Be Modeled Into The Electron Density Length = 382 Back     alignment and structure
>pdb|1NI4|A Chain A, Human Pyruvate Dehydrogenase Length = 365 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
2bfd_A 400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 1e-141
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 1e-131
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 1e-131
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 1e-128
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 2e-46
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 2e-09
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 1e-07
3l84_A 632 Transketolase; TKT, structural genomics, center fo 1e-05
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Length = 400 Back     alignment and structure
 Score =  401 bits (1033), Expect = e-141
 Identities = 133/263 (50%), Positives = 173/263 (65%)

Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           + FI  +    IP YRV+D  GQ    S    + +   +K+Y  M  L TMD I YE+QR
Sbjct: 20  LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQR 79

Query: 61  QGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGRISFY+T  GEE  ++ SAAA+ N D V  Q RE GVL++R + ++ F  QC+GN +D
Sbjct: 80  QGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISD 139

Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEG 180
            GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K    +   + YFG+G  SEG
Sbjct: 140 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEG 199

Query: 181 DFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL 240
           D HA  NF+A  E P+IF CRNNG+AISTP S+Q+R DG   +G  YG+ SIRVDGND  
Sbjct: 200 DAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVF 259

Query: 241 AIYSAVHAAREMAIGEGRPILIE 263
           A+Y+A   AR  A+ E +P LIE
Sbjct: 260 AVYNATKEARRRAVAENQPFLIE 282
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Length = 407 Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Length = 367 Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Length = 368 Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Length = 365 Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Length = 616 Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Length = 845 Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Length = 632 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
2bfd_A 400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 100.0
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 100.0
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 100.0
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 100.0
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 100.0
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 100.0
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 100.0
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 100.0
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 100.0
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.97
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 99.97
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 99.97
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 99.96
3l84_A 632 Transketolase; TKT, structural genomics, center fo 99.96
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 99.96
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 99.96
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 99.96
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 99.96
3uk1_A 711 Transketolase; structural genomics, seattle struct 99.96
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 99.96
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 99.96
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 99.94
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 99.82
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 99.75
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 99.74
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 99.73
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 99.71
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 99.71
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 99.71
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 99.71
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 99.7
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 99.7
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 99.69
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 99.69
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 99.69
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 99.68
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 99.68
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 99.67
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 99.67
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 99.66
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 99.66
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 99.65
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 99.6
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.59
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.55
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 99.08
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 93.37
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 93.24
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 93.22
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 93.19
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 92.93
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 92.44
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 92.34
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 92.2
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 91.63
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 91.56
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 91.48
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 91.42
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 91.27
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 91.12
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 91.01
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 90.69
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 90.66
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 90.52
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 90.45
1yd7_A 395 2-keto acid:ferredoxin oxidoreductase subunit alph 90.4
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 89.54
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 89.41
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 89.12
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 88.3
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 88.3
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 88.16
3l84_A 632 Transketolase; TKT, structural genomics, center fo 87.46
1qs0_B 338 2-oxoisovalerate dehydrogenase beta-subunit; heter 87.38
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 87.24
2ozl_B 341 PDHE1-B, pyruvate dehydrogenase E1 component subun 87.16
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 86.73
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 86.28
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 85.63
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 85.47
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 85.09
1ik6_A 369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 85.04
1umd_B 324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 83.39
3uk1_A 711 Transketolase; structural genomics, seattle struct 82.23
1w85_B 324 Pyruvate dehydrogenase E1 component, beta subunit; 81.25
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 80.32
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
Probab=100.00  E-value=4.2e-63  Score=465.77  Aligned_cols=274  Identities=49%  Similarity=0.846  Sum_probs=260.3

Q ss_pred             CccccCCCCCCCCeeEeeCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhhHHHHHHHHHhcCcccccccCChhHHHHHHH
Q 023827            1 MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIAS   80 (276)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~ly~~m~~~R~~d~~~~~~~~~g~~~~~~~~~G~Ea~~~~~   80 (276)
                      |+|++++....+|++||||+||+++++...+.+++++++++|+.|+++|.||+++.+++++|+++|++++.||||+++++
T Consensus        20 ~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~e~~~~~y~~M~~~r~fe~~~~~~~~~gri~~~~~~~GqEa~~vg~   99 (400)
T 2bfd_A           20 LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGS   99 (400)
T ss_dssp             CCCCCCCCSSCSCEECSBCTTSCBSCGGGCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSSCCCCCTTCHHHHHHH
T ss_pred             eeeccCcccCCCCeeEEECCCCCCCCccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcceeecCCChHHHHHHH
Confidence            67888887789999999999999987765678999999999999999999999999999999999999999999999999


Q ss_pred             HhccCCCcEEEccCCcHHHHHHcCCCHHHHHHHhhcCCCCCCCCCCCccccCCCCCCccccccccccccchhhhHHHHhh
Q 023827           81 AAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK  160 (276)
Q Consensus        81 ~~al~~~D~~~~~yR~~~~~~~~G~~~~~~l~~~~~~~~~~~~G~~~~~h~~~~~~~~~~~~g~lG~~l~~A~G~A~a~k  160 (276)
                      +.+|+++|+++++||+|++++.+|++++++|.+++++.+++++|+++++|+...+.++.+.+|+||+++|+|+|+|+|.|
T Consensus       100 ~~al~~~D~v~~~yR~~~~~~~~G~~~~~~l~e~~g~~~g~~~G~~~~~H~~~~~~~~~~~~g~lG~~lp~AvG~AlA~~  179 (400)
T 2bfd_A          100 AAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAK  179 (400)
T ss_dssp             HHTSCTTSEEECCSCCHHHHHHTTCCHHHHHHHHHTCTTCTTTTCSCSSCCCBTTTTBCCCCSSTTTHHHHHHHHHHHHH
T ss_pred             HHhcCCCCEEEecCcCHHHHHHcCCCHHHHHHHhcCCCCCCCCCCCCCcCCcccccCccccCccccccccHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999988777888889999999999999999999


Q ss_pred             hcCCCceEEEEECCCcCCcchHHHHHHHHHHCCCCEEEEEEeCCccccccccCccCCcchhhhHhhcCceEEEEcCCCHH
Q 023827          161 MDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL  240 (276)
Q Consensus       161 ~~~~~~~vv~~~GDG~~~~G~~~Eal~~A~~~~Lpvi~vv~nN~~~~~~~~~~~~~~~~~~~~a~a~G~~~~~vdg~d~~  240 (276)
                      +++++++|||++|||++++|.+||+|++|++|+||+||||+||+|+++++.....+.+++++++++|||++++|||+|++
T Consensus       180 ~~~~~~~vv~~~GDGa~~~G~~~Eal~~A~~~~lpvi~vv~NN~~~i~~~~~~~~~~~d~~~~a~a~G~~~~~VdG~D~~  259 (400)
T 2bfd_A          180 RANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVF  259 (400)
T ss_dssp             HHTCCCCEEEEEETTGGGSHHHHHHHHHHHHTTCCEEEEEEECSEETTEEGGGTCSSSTTGGGTGGGTCEEEEEETTCHH
T ss_pred             hhCCCCeEEEEECchhhhcChHHHHHHHHHHHCcCEEEEEECCceeeeecccccCCCCCHHHHHHHcCCcEEEEeCCCHH
Confidence            99999999999999999999999999999999999999999999999998887777789999999999999999999999


Q ss_pred             HHHHHHHHHHHHhHccCCCEEEEEEEecCCCCCC
Q 023827          241 AIYSAVHAAREMAIGEGRPILIEVKCLSFSIFLS  274 (276)
Q Consensus       241 ~v~~a~~~a~~~~r~~~~P~lIe~~t~R~~g~~~  274 (276)
                      ++++++++|++++|++++|+|||++|||++|||+
T Consensus       260 av~~a~~~A~~~ar~~~~P~lIe~~tyR~~gHs~  293 (400)
T 2bfd_A          260 AVYNATKEARRRAVAENQPFLIEAMTYRIGHAST  293 (400)
T ss_dssp             HHHHHHHHHHHHHHHHTCCEEEEEECCCCC--CC
T ss_pred             HHHHHHHHHHHHHHhCCCCEEEEEEeeeeCCCCC
Confidence            9999999999999999999999999999999986
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 276
d2bfda1 395 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid 1e-51
d1w85a_365 c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, Pd 4e-48
d1qs0a_407 c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B 4e-45
d1umda_362 c.36.1.11 (A:) Branched-chain alpha-keto acid dehy 7e-42
d2ozla1361 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate de 6e-40
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Length = 395 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: Branched-chain alpha-keto acid dehydrogenase, PP module
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  171 bits (434), Expect = 1e-51
 Identities = 133/266 (50%), Positives = 173/266 (65%)

Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           + FI  +    IP YRV+D  GQ    S    + +   +K+Y  M  L TMD I YE+QR
Sbjct: 15  LEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQR 74

Query: 61  QGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGRISFY+T  GEE  ++ SAAA+ N D V  Q RE GVL++R + ++ F  QC+GN +D
Sbjct: 75  QGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISD 134

Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEG 180
            GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K    +   + YFG+G  SEG
Sbjct: 135 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEG 194

Query: 181 DFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL 240
           D HA  NF+A  E P+IF CRNNG+AISTP S+Q+R DG   +G  YG+ SIRVDGND  
Sbjct: 195 DAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVF 254

Query: 241 AIYSAVHAAREMAIGEGRPILIEVKC 266
           A+Y+A   AR  A+ E +P LIE   
Sbjct: 255 AVYNATKEARRRAVAENQPFLIEAMT 280
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Length = 365 Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Length = 407 Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Length = 362 Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Length = 361 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
d2bfda1 395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 99.96
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 99.95
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 99.94
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 99.94
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 99.85
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.81
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 99.81
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.8
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.79
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.79
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.76
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.76
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.74
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.74
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.74
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.73
d2c42a2 447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 98.02
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 96.13
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 95.64
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 95.59
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 95.42
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 95.42
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 95.12
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 94.84
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 94.57
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 94.47
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 94.03
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 93.04
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 91.48
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 90.6
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 90.47
d2ozlb1192 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 88.52
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 87.76
d1ik6a1191 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 87.47
d1qs0b1204 2-oxoisovalerate dehydrogenase (E1B), Pyr module { 87.38
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 87.04
d2bfdb1203 Branched-chain alpha-keto acid dehydrogenase, Pyr 82.42
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: Branched-chain alpha-keto acid dehydrogenase, PP module
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-68  Score=499.06  Aligned_cols=273  Identities=49%  Similarity=0.846  Sum_probs=262.1

Q ss_pred             ccccCCCCCCCCeeEeeCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhhHHHHHHHHHhcCcccccccCChhHHHHHHHH
Q 023827            2 RFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASA   81 (276)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~ly~~m~~~R~~d~~~~~~~~~g~~~~~~~~~G~Ea~~~~~~   81 (276)
                      +|+.+.....+|++||||.||+++++...+.+|+|+++++||.|+++|.||+++..++++|++++++++.||||++++++
T Consensus        16 ~~~~~~~~~~~p~~r~ld~~g~~~~~~~~~~ls~e~l~~~Yr~M~~~R~~e~~~~~l~~~G~i~~~~~~~GqEA~~vg~~   95 (395)
T d2bfda1          16 EFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA   95 (395)
T ss_dssp             CCCCCCCSSCSCEECSBCTTSCBSCGGGCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSSCCCCCTTCHHHHHHHH
T ss_pred             ccCCCccCCCCCeeEEECCCCCCCCccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccccCCCChHHHHHHHH
Confidence            56666666778999999999999988888999999999999999999999999999999999999999999999999999


Q ss_pred             hccCCCcEEEccCCcHHHHHHcCCCHHHHHHHhhcCCCCCCCCCCCccccCCCCCCccccccccccccchhhhHHHHhhh
Q 023827           82 AAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKM  161 (276)
Q Consensus        82 ~al~~~D~~~~~yR~~~~~~~~G~~~~~~l~~~~~~~~~~~~G~~~~~h~~~~~~~~~~~~g~lG~~l~~A~G~A~a~k~  161 (276)
                      .+|+++||++++||+|++++++|++++++|++++|+.+++++|+++++|+.+++.++++.++++|.++|+|+|+|+|.|+
T Consensus        96 ~al~~~D~~~~~yR~h~~~la~G~~~~~~~ael~g~~~g~~~Grggs~H~~~~~~~~~~~~~ivg~~~p~A~G~A~a~k~  175 (395)
T d2bfda1          96 AALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKR  175 (395)
T ss_dssp             HTSCTTSEEECCSCCHHHHHHTTCCHHHHHHHHHTCTTCTTTTCSCSSCCCBTTTTBCCCCSSTTTHHHHHHHHHHHHHH
T ss_pred             HHcCCCCeeccccchhHhhhhhhCCHHHHHHHHhhcccCccccccccccccccccccccccccccccccHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCceEEEEECCCcCCcchHHHHHHHHHHCCCCEEEEEEeCCccccccccCccCCcchhhhHhhcCceEEEEcCCCHHH
Q 023827          162 DRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALA  241 (276)
Q Consensus       162 ~~~~~~vv~~~GDG~~~~G~~~Eal~~A~~~~Lpvi~vv~nN~~~~~~~~~~~~~~~~~~~~a~a~G~~~~~vdg~d~~~  241 (276)
                      ++.+++++|++|||++++|.|||+||+|+.|+||+||||+||+|+++++...++...++++++++||+++++|||+|+.+
T Consensus       176 ~~~~~v~v~~~GDGa~~eG~f~EalN~A~~~~lPvlfv~eNN~yaist~~~~~~~~~~i~~ra~~~gi~~~~vDG~Dv~a  255 (395)
T d2bfda1         176 ANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFA  255 (395)
T ss_dssp             HTCCCCEEEEEETTGGGSHHHHHHHHHHHHTTCCEEEEEEECSEETTEEGGGTCSSSTTGGGTGGGTCEEEEEETTCHHH
T ss_pred             cCcccccccccCCCCccchhHHHHHHHHhhcCCceEEEEEecccccccccchhhcchhHHHhhhccccceeEEecCcHHH
Confidence            99999999999999999999999999999999999999999999999999999888999999999999999999999999


Q ss_pred             HHHHHHHHHHHhHccCCCEEEEEEEecCCCCCC
Q 023827          242 IYSAVHAAREMAIGEGRPILIEVKCLSFSIFLS  274 (276)
Q Consensus       242 v~~a~~~a~~~~r~~~~P~lIe~~t~R~~g~~~  274 (276)
                      +++++++|++++|++++|+|||+.|||+.+|++
T Consensus       256 V~~a~~~A~~~~R~g~gP~lIE~~TyR~~~Hs~  288 (395)
T d2bfda1         256 VYNATKEARRRAVAENQPFLIEAMTYRIGHAST  288 (395)
T ss_dssp             HHHHHHHHHHHHHHHTCCEEEEEECCCCC--CC
T ss_pred             HHHHHHHhhhhhhccCCceEEEEeeecCCCCCC
Confidence            999999999999999999999999999999964
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2bfdb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure