Citrus Sinensis ID: 023849


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MAKKEAKEEEKAAASLAEPRTNPSVEDTGMVRNSLTLSPPKPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAFPEAQGDTHCSSEE
cccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccc
ccccHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcccHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHcccccccccccccccccccHHccEEEEEccccccccc
MAKKEAKEEEKAAASlaeprtnpsvedtgmvrnsltlsppkpswftpgrLLVIFCFINLlnyvdrgtiasngvngspkncsangtctpgtgiqgdfdlnnfqdgvlSSAFMVGLLVASPIFAslarsvnpfrliGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEasfislaapfiddnapvakKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVmkplqlkgfapaeskkAFTDIeiafpeaqgdthcssee
MAKKEAKEEEkaaaslaeprtnpsvedtgmvrNSLTlsppkpswftpGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAFpeaqgdthcssee
MakkeakeeekaaaSLAEPRTNPSVEDTGMVRNSLTLSPPKPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAFPEAQGDTHCSSEE
******************************************SWFTPGRLLVIFCFINLLNYVDRGTIASNGVNG**KNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAF*************
********************************************FTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMK************************************
************************VEDTGMVRNSLTLSPPKPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAFPE***********
*****************************************PSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMKPLQL**********AFTDIEIAFPEAQGDTH*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKKEAKEEEKAAASLAEPRTNPSVEDTGMVRNSLTLSPPKPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAFPEAQGDTHCSSEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query276 2.2.26 [Sep-21-2011]
Q9FLG8 484 Probable sphingolipid tra yes no 0.880 0.502 0.684 4e-89
F4IKF6 510 Probable sphingolipid tra no no 0.778 0.421 0.702 7e-87
Q6NMN6 492 Probable sphingolipid tra no no 0.822 0.461 0.666 9e-86
Q9GQQ0 605 Protein spinster OS=Droso no no 0.663 0.302 0.315 4e-19
Q2YDU8 528 Protein spinster homolog yes no 0.550 0.287 0.314 4e-17
Q8R0G7 528 Protein spinster homolog yes no 0.550 0.287 0.314 4e-17
Q9H2V7 528 Protein spinster homolog no no 0.568 0.297 0.306 7e-17
Q08DX7 528 Protein spinster homolog yes no 0.659 0.344 0.293 8e-17
A2CER7 498 Protein spinster homolog yes no 0.561 0.311 0.301 1e-16
Q91VM4 549 Protein spinster homolog no no 0.695 0.349 0.288 1e-15
>sp|Q9FLG8|SPNS2_ARATH Probable sphingolipid transporter spinster homolog 2 OS=Arabidopsis thaliana GN=At5g64500 PE=2 SV=1 Back     alignment and function desciption
 Score =  327 bits (839), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 203/250 (81%), Gaps = 7/250 (2%)

Query: 22  NPSVEDTGMVRNSLTLSPP--KPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKN 79
           NP +    M R+S ++  P  +PSWFTP +LL +FC +NL+NY+DRG IASNG+NGS  +
Sbjct: 12  NPRI----MERDSDSIKDPISEPSWFTPKKLLFVFCVVNLINYIDRGAIASNGINGSRGS 67

Query: 80  CSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLT 139
           C+++GTC+ G+GIQGDF+L+NF+DGVLSSAFMVGLLVASPIFASLA+SVNPFRLIGVGL+
Sbjct: 68  CTSSGTCSSGSGIQGDFNLSNFEDGVLSSAFMVGLLVASPIFASLAKSVNPFRLIGVGLS 127

Query: 140 VWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCL 199
           +WTLAV+GCG SF FW I ICRM VGVGEASF+SLAAPFIDDNAP  +K+AWL VFYMC+
Sbjct: 128 IWTLAVIGCGLSFDFWSITICRMFVGVGEASFVSLAAPFIDDNAPHDQKSAWLAVFYMCI 187

Query: 200 PSGYAIGYVYGGWVGH-YNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTD 258
           P+GYA GYVYGG VG    WR AFWGEAILM PFAVLGFV+KPL LKGFAP ++ K  TD
Sbjct: 188 PTGYAFGYVYGGVVGSVLPWRAAFWGEAILMLPFAVLGFVIKPLHLKGFAPDDTGKPRTD 247

Query: 259 IEIAFPEAQG 268
                P   G
Sbjct: 248 NLNVLPVGYG 257




Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.
Arabidopsis thaliana (taxid: 3702)
>sp|F4IKF6|SPNS3_ARATH Probable sphingolipid transporter spinster homolog 3 OS=Arabidopsis thaliana GN=At2g22730 PE=3 SV=1 Back     alignment and function description
>sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 Back     alignment and function description
>sp|Q9GQQ0|SPIN_DROME Protein spinster OS=Drosophila melanogaster GN=spin PE=1 SV=1 Back     alignment and function description
>sp|Q2YDU8|SPNS1_RAT Protein spinster homolog 1 OS=Rattus norvegicus GN=Spns1 PE=2 SV=2 Back     alignment and function description
>sp|Q8R0G7|SPNS1_MOUSE Protein spinster homolog 1 OS=Mus musculus GN=Spns1 PE=2 SV=1 Back     alignment and function description
>sp|Q9H2V7|SPNS1_HUMAN Protein spinster homolog 1 OS=Homo sapiens GN=SPNS1 PE=1 SV=1 Back     alignment and function description
>sp|Q08DX7|SPNS1_BOVIN Protein spinster homolog 1 OS=Bos taurus GN=SPNS1 PE=2 SV=1 Back     alignment and function description
>sp|A2CER7|SPNS3_DANRE Protein spinster homolog 3 OS=Danio rerio GN=spns3 PE=2 SV=1 Back     alignment and function description
>sp|Q91VM4|SPNS2_MOUSE Protein spinster homolog 2 OS=Mus musculus GN=Spns2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
224105833 468 sugar transporter/spinster transmembrane 0.865 0.510 0.816 1e-111
255554517 541 transporter, putative [Ricinus communis] 0.974 0.497 0.734 1e-109
255576025 505 transporter, putative [Ricinus communis] 0.891 0.487 0.724 1e-101
224060977 457 sugar transporter/spinster transmembrane 0.826 0.498 0.790 1e-100
297735860 534 unnamed protein product [Vitis vinifera] 0.884 0.456 0.719 1e-100
359480514 510 PREDICTED: protein spinster homolog 1-li 0.847 0.458 0.754 1e-99
356519493 530 PREDICTED: protein spinster homolog 1-li 0.873 0.454 0.720 3e-99
356527981 537 PREDICTED: protein spinster homolog 1-li 0.782 0.402 0.798 5e-99
357485271 497 Spinster-like protein [Medicago truncatu 0.862 0.478 0.733 2e-98
356531403 496 PREDICTED: protein spinster homolog 1-li 0.858 0.477 0.735 3e-98
>gi|224105833|ref|XP_002313948.1| sugar transporter/spinster transmembrane protein [Populus trichocarpa] gi|222850356|gb|EEE87903.1| sugar transporter/spinster transmembrane protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/240 (81%), Positives = 216/240 (90%), Gaps = 1/240 (0%)

Query: 30  MVRNSLTLSPPKPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPG 89
           M R+S  LSPP PSWFTP RLLVIFC INL+NYVDRG IASNGVNGS + CS +GTCT G
Sbjct: 1   MARSSTALSPPAPSWFTPKRLLVIFCVINLINYVDRGAIASNGVNGSRRTCSKSGTCTFG 60

Query: 90  TGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCG 149
           +GIQGDF+L+NF+DGVLSSAFMVGLLVA PIFASLA+SVNPFRLIGVGL+VWT+AVVGCG
Sbjct: 61  SGIQGDFNLSNFEDGVLSSAFMVGLLVACPIFASLAKSVNPFRLIGVGLSVWTVAVVGCG 120

Query: 150 FSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVY 209
           FSF+FW I ICRMLVGVGEASFISLAAPFIDDNAPVAKKT WLG+FYMC+P+GYA+GYVY
Sbjct: 121 FSFNFWTITICRMLVGVGEASFISLAAPFIDDNAPVAKKTLWLGIFYMCIPTGYALGYVY 180

Query: 210 GGWV-GHYNWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAFPEAQG 268
           GG + GH+NWR+AF+GEAILM PFAVLGFVMKPLQLKGFAPAESKKA T IE A  E QG
Sbjct: 181 GGLIGGHFNWRFAFYGEAILMLPFAVLGFVMKPLQLKGFAPAESKKALTSIETAVLEVQG 240




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255554517|ref|XP_002518297.1| transporter, putative [Ricinus communis] gi|223542517|gb|EEF44057.1| transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255576025|ref|XP_002528908.1| transporter, putative [Ricinus communis] gi|223531662|gb|EEF33488.1| transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224060977|ref|XP_002300304.1| sugar transporter/spinster transmembrane protein [Populus trichocarpa] gi|222847562|gb|EEE85109.1| sugar transporter/spinster transmembrane protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297735860|emb|CBI18614.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480514|ref|XP_002273321.2| PREDICTED: protein spinster homolog 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519493|ref|XP_003528407.1| PREDICTED: protein spinster homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356527981|ref|XP_003532584.1| PREDICTED: protein spinster homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357485271|ref|XP_003612923.1| Spinster-like protein [Medicago truncatula] gi|355514258|gb|AES95881.1| Spinster-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356531403|ref|XP_003534267.1| PREDICTED: protein spinster homolog 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
TAIR|locus:2179401 484 AT5G64500 "AT5G64500" [Arabido 0.865 0.493 0.698 5.7e-91
TAIR|locus:504954889 492 AT5G65687 "AT5G65687" [Arabido 0.822 0.461 0.666 2.8e-82
TAIR|locus:2066045 510 AT2G22730 "AT2G22730" [Arabido 0.778 0.421 0.702 4.5e-82
FB|FBgn0086676 605 spin "spinster" [Drosophila me 0.471 0.214 0.338 2.1e-22
UNIPROTKB|F1NJ05 484 SPNS3 "Uncharacterized protein 0.474 0.270 0.355 5.7e-20
UNIPROTKB|H3BPQ9274 SPNS1 "Protein spinster homolo 0.565 0.569 0.313 2.2e-18
UNIPROTKB|F1RFH5 528 SPNS1 "Uncharacterized protein 0.659 0.344 0.309 4.3e-18
UNIPROTKB|Q9H2V7 528 SPNS1 "Protein spinster homolo 0.565 0.295 0.313 1.5e-17
UNIPROTKB|H3BR82 538 SPNS1 "Protein spinster homolo 0.565 0.289 0.313 1.6e-17
UNIPROTKB|E2RBY9 561 SPNS1 "Uncharacterized protein 0.565 0.278 0.318 1.7e-17
TAIR|locus:2179401 AT5G64500 "AT5G64500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 907 (324.3 bits), Expect = 5.7e-91, P = 5.7e-91
 Identities = 169/242 (69%), Positives = 200/242 (82%)

Query:    30 MVRNSLTLSPP--KPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCT 87
             M R+S ++  P  +PSWFTP +LL +FC +NL+NY+DRG IASNG+NGS  +C+++GTC+
Sbjct:    16 MERDSDSIKDPISEPSWFTPKKLLFVFCVVNLINYIDRGAIASNGINGSRGSCTSSGTCS 75

Query:    88 PGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVG 147
              G+GIQGDF+L+NF+DGVLSSAFMVGLLVASPIFASLA+SVNPFRLIGVGL++WTLAV+G
Sbjct:    76 SGSGIQGDFNLSNFEDGVLSSAFMVGLLVASPIFASLAKSVNPFRLIGVGLSIWTLAVIG 135

Query:   148 CGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGY 207
             CG SF FW I ICRM VGVGEASF+SLAAPFIDDNAP  +K+AWL VFYMC+P+GYA GY
Sbjct:   136 CGLSFDFWSITICRMFVGVGEASFVSLAAPFIDDNAPHDQKSAWLAVFYMCIPTGYAFGY 195

Query:   208 VYGGWVGHY-NWRYAFWGEAILMFPFAVLGFVMKPLQLKGFAPAESKKAFTDIEIAFPEA 266
             VYGG VG    WR AFWGEAILM PFAVLGFV+KPL LKGFAP ++ K  TD     P  
Sbjct:   196 VYGGVVGSVLPWRAAFWGEAILMLPFAVLGFVIKPLHLKGFAPDDTGKPRTDNLNVLPVG 255

Query:   267 QG 268
              G
Sbjct:   256 YG 257




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0046520 "sphingoid biosynthetic process" evidence=RCA
TAIR|locus:504954889 AT5G65687 "AT5G65687" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066045 AT2G22730 "AT2G22730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0086676 spin "spinster" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ05 SPNS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H3BPQ9 SPNS1 "Protein spinster homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFH5 SPNS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2V7 SPNS1 "Protein spinster homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BR82 SPNS1 "Protein spinster homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBY9 SPNS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 1e-20
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 1e-17
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 3e-11
COG2814 394 COG2814, AraJ, Arabinose efflux permease [Carbohyd 5e-09
TIGR00711 485 TIGR00711, efflux_EmrB, drug resistance transporte 9e-09
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 7e-08
TIGR00895 398 TIGR00895, 2A0115, benzoate transport 2e-07
COG2271 448 COG2271, UhpC, Sugar phosphate permease [Carbohydr 3e-06
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 6e-06
PRK10091 382 PRK10091, PRK10091, MFS transport protein AraJ; Pr 8e-06
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 1e-05
TIGR00881 379 TIGR00881, 2A0104, phosphoglycerate transporter fa 1e-04
COG0477 338 COG0477, ProP, Permeases of the major facilitator 2e-04
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 5e-04
TIGR00710 385 TIGR00710, efflux_Bcr_CflA, drug resistance transp 0.001
PRK03545 390 PRK03545, PRK03545, putative arabinose transporter 0.002
TIGR00891 405 TIGR00891, 2A0112, putative sialic acid transporte 0.003
pfam03137 582 pfam03137, OATP, Organic Anion Transporter Polypep 0.003
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
 Score = 89.7 bits (223), Expect = 1e-20
 Identities = 46/193 (23%), Positives = 83/193 (43%), Gaps = 18/193 (9%)

Query: 51  LVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAF 110
           L++      L+ +DRG ++                      +  D  L+  Q G++ SAF
Sbjct: 1   LLLLFLGFFLSGLDRGLLSPALPL-----------------LAEDLGLSASQAGLIVSAF 43

Query: 111 MVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEAS 170
            +G  + S +   L+      R++ +GL ++ L  +   F+ S W++ + R L+G+G  +
Sbjct: 44  SLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGA 103

Query: 171 FISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVG-HYNWRYAFWGEAILM 229
               AA  I +  P  ++   LG+F      G  +G + GG +     WR+ F   AIL 
Sbjct: 104 LYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLGWRWLFLILAILG 163

Query: 230 FPFAVLGFVMKPL 242
              A+L   +  L
Sbjct: 164 LLLALLLLFLLRL 176


MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated. Length = 352

>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|225371 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|129794 TIGR00711, efflux_EmrB, drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|225180 COG2271, UhpC, Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|182234 PRK10091, PRK10091, MFS transport protein AraJ; Provisional Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|233167 TIGR00881, 2A0104, phosphoglycerate transporter family protein Back     alignment and domain information
>gnl|CDD|223553 COG0477, ProP, Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|233099 TIGR00710, efflux_Bcr_CflA, drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>gnl|CDD|179591 PRK03545, PRK03545, putative arabinose transporter; Provisional Back     alignment and domain information
>gnl|CDD|233172 TIGR00891, 2A0112, putative sialic acid transporter Back     alignment and domain information
>gnl|CDD|217384 pfam03137, OATP, Organic Anion Transporter Polypeptide (OATP) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 276
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.93
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.93
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.93
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.92
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.91
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.91
PRK03545 390 putative arabinose transporter; Provisional 99.91
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.9
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.9
PRK11663 434 regulatory protein UhpC; Provisional 99.9
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.9
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.9
TIGR00891 405 2A0112 putative sialic acid transporter. 99.89
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.89
PRK10091 382 MFS transport protein AraJ; Provisional 99.89
TIGR00893 399 2A0114 d-galactonate transporter. 99.89
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.89
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.89
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.88
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.88
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.88
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.88
PRK12307 426 putative sialic acid transporter; Provisional 99.88
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.87
PRK03699 394 putative transporter; Provisional 99.87
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.87
PRK10642 490 proline/glycine betaine transporter; Provisional 99.87
PRK09705 393 cynX putative cyanate transporter; Provisional 99.87
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.87
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.87
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.87
TIGR00895 398 2A0115 benzoate transport. 99.87
PLN00028 476 nitrate transmembrane transporter; Provisional 99.87
PRK03893 496 putative sialic acid transporter; Provisional 99.87
TIGR00898 505 2A0119 cation transport protein. 99.87
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.86
KOG2533 495 consensus Permease of the major facilitator superf 99.86
PRK10504 471 putative transporter; Provisional 99.86
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.86
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.85
TIGR00900 365 2A0121 H+ Antiporter protein. 99.85
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.85
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.85
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.85
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.85
PRK09952 438 shikimate transporter; Provisional 99.85
PRK11043 401 putative transporter; Provisional 99.85
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.84
KOG2532 466 consensus Permease of the major facilitator superf 99.84
KOG0254 513 consensus Predicted transporter (major facilitator 99.84
PRK05122 399 major facilitator superfamily transporter; Provisi 99.84
PRK10054 395 putative transporter; Provisional 99.84
PRK15075 434 citrate-proton symporter; Provisional 99.84
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.83
PRK12382 392 putative transporter; Provisional 99.83
PRK10133 438 L-fucose transporter; Provisional 99.83
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.83
TIGR00805 633 oat sodium-independent organic anion transporter. 99.83
PRK09874 408 drug efflux system protein MdtG; Provisional 99.82
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 99.82
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.82
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.81
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.81
PRK03633 381 putative MFS family transporter protein; Provision 99.8
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.8
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.8
PTZ00207 591 hypothetical protein; Provisional 99.8
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.79
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.78
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.78
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.78
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.78
KOG3764 464 consensus Vesicular amine transporter [Intracellul 99.77
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 99.75
PRK10489 417 enterobactin exporter EntS; Provisional 99.75
KOG0569 485 consensus Permease of the major facilitator superf 99.75
KOG2615 451 consensus Permease of the major facilitator superf 99.75
PRK15011 393 sugar efflux transporter B; Provisional 99.74
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.74
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.74
TIGR00901 356 2A0125 AmpG-related permease. 99.71
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.71
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.71
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.7
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.7
PRK10642490 proline/glycine betaine transporter; Provisional 99.69
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.68
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.68
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.68
PRK11010 491 ampG muropeptide transporter; Validated 99.67
PRK15011393 sugar efflux transporter B; Provisional 99.67
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.67
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.67
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 99.67
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.66
PRK05122399 major facilitator superfamily transporter; Provisi 99.65
PRK11902 402 ampG muropeptide transporter; Reviewed 99.65
PRK09528420 lacY galactoside permease; Reviewed 99.65
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 99.65
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.64
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.64
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.64
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.62
PRK10489417 enterobactin exporter EntS; Provisional 99.62
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.61
PRK09528 420 lacY galactoside permease; Reviewed 99.61
KOG2325 488 consensus Predicted transporter/transmembrane prot 99.61
PRK12382392 putative transporter; Provisional 99.61
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.6
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.6
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.6
PRK03893496 putative sialic acid transporter; Provisional 99.59
PRK03699394 putative transporter; Provisional 99.59
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.59
TIGR00893399 2A0114 d-galactonate transporter. 99.59
PRK09874408 drug efflux system protein MdtG; Provisional 99.58
PRK03545390 putative arabinose transporter; Provisional 99.56
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.56
PRK03633381 putative MFS family transporter protein; Provision 99.56
PRK09705393 cynX putative cyanate transporter; Provisional 99.55
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.55
TIGR00891405 2A0112 putative sialic acid transporter. 99.55
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.54
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 99.53
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.53
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.52
PRK11663434 regulatory protein UhpC; Provisional 99.5
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.5
TIGR00895398 2A0115 benzoate transport. 99.49
PLN00028476 nitrate transmembrane transporter; Provisional 99.49
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.49
TIGR00897402 2A0118 polyol permease family. This family of prot 99.49
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.48
PRK09952438 shikimate transporter; Provisional 99.48
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.47
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.47
PRK11010491 ampG muropeptide transporter; Validated 99.45
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.44
PRK15075434 citrate-proton symporter; Provisional 99.44
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.44
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.44
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.43
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.43
PRK10504471 putative transporter; Provisional 99.42
TIGR00898505 2A0119 cation transport protein. 99.42
PRK12307426 putative sialic acid transporter; Provisional 99.41
TIGR00900365 2A0121 H+ Antiporter protein. 99.4
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.4
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.4
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.4
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.4
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.39
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.38
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.37
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 99.36
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.36
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.36
KOG0569485 consensus Permease of the major facilitator superf 99.36
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.35
PRK10054395 putative transporter; Provisional 99.35
COG2270438 Permeases of the major facilitator superfamily [Ge 99.33
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.33
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.33
PRK10091382 MFS transport protein AraJ; Provisional 99.32
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 99.32
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.31
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.3
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 99.3
PRK11902402 ampG muropeptide transporter; Reviewed 99.3
PRK11195393 lysophospholipid transporter LplT; Provisional 99.3
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 99.29
TIGR00896355 CynX cyanate transporter. This family of proteins 99.28
PRK11646400 multidrug resistance protein MdtH; Provisional 99.28
PRK09848448 glucuronide transporter; Provisional 99.26
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.26
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.25
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.25
KOG2563 480 consensus Permease of the major facilitator superf 99.25
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.25
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.24
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.23
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 99.23
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.22
PRK09669 444 putative symporter YagG; Provisional 99.21
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 99.19
PRK10133438 L-fucose transporter; Provisional 99.18
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.16
TIGR00901356 2A0125 AmpG-related permease. 99.15
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.14
PRK10429473 melibiose:sodium symporter; Provisional 99.14
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.13
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.12
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.11
PRK11043401 putative transporter; Provisional 99.1
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.09
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.08
KOG3626 735 consensus Organic anion transporter [Secondary met 99.08
PRK10429 473 melibiose:sodium symporter; Provisional 99.07
PF13347428 MFS_2: MFS/sugar transport protein 99.07
PRK09669444 putative symporter YagG; Provisional 99.07
PF13347 428 MFS_2: MFS/sugar transport protein 99.06
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.06
COG0477 338 ProP Permeases of the major facilitator superfamil 99.04
KOG3762618 consensus Predicted transporter [General function 99.03
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.0
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.99
KOG3764464 consensus Vesicular amine transporter [Intracellul 98.93
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.9
PRK11652394 emrD multidrug resistance protein D; Provisional 98.89
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.88
PRK11462460 putative transporter; Provisional 98.88
KOG2532466 consensus Permease of the major facilitator superf 98.88
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.87
KOG2816 463 consensus Predicted transporter ADD1 (major facili 98.85
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.84
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.8
COG2211467 MelB Na+/melibiose symporter and related transport 98.8
PRK11462 460 putative transporter; Provisional 98.8
PRK09848 448 glucuronide transporter; Provisional 98.79
KOG4686 459 consensus Predicted sugar transporter [Carbohydrat 98.79
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.78
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.78
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.77
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.73
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.73
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 98.72
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.72
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.7
KOG0254513 consensus Predicted transporter (major facilitator 98.69
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.68
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.66
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 98.65
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.64
COG2211 467 MelB Na+/melibiose symporter and related transport 98.5
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.47
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 98.43
KOG2533495 consensus Permease of the major facilitator superf 98.43
KOG2816463 consensus Predicted transporter ADD1 (major facili 98.41
PRK15462493 dipeptide/tripeptide permease D; Provisional 98.32
KOG0637 498 consensus Sucrose transporter and related proteins 98.32
KOG2615451 consensus Permease of the major facilitator superf 98.3
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 98.17
PTZ00207591 hypothetical protein; Provisional 98.15
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 98.13
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 98.1
PF1283277 MFS_1_like: MFS_1 like family 98.04
PRK03612 521 spermidine synthase; Provisional 97.98
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.84
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.82
KOG4332 454 consensus Predicted sugar transporter [Carbohydrat 97.81
KOG1237 571 consensus H+/oligopeptide symporter [Amino acid tr 97.75
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.73
COG2270 438 Permeases of the major facilitator superfamily [Ge 97.73
KOG3098 461 consensus Uncharacterized conserved protein [Funct 97.42
KOG2563480 consensus Permease of the major facilitator superf 97.34
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.32
KOG3098461 consensus Uncharacterized conserved protein [Funct 97.2
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 97.1
KOG1330493 consensus Sugar transporter/spinster transmembrane 97.01
KOG2325488 consensus Predicted transporter/transmembrane prot 96.89
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 96.85
TIGR00805633 oat sodium-independent organic anion transporter. 96.76
KOG3574 510 consensus Acetyl-CoA transporter [Inorganic ion tr 96.75
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 96.72
COG3202 509 ATP/ADP translocase [Energy production and convers 96.64
KOG3762 618 consensus Predicted transporter [General function 96.49
KOG3626735 consensus Organic anion transporter [Secondary met 96.39
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 96.1
KOG1479406 consensus Nucleoside transporter [Nucleotide trans 94.96
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 94.92
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 94.77
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 94.75
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 94.7
KOG3097 390 consensus Predicted membrane protein [Function unk 94.7
KOG0637498 consensus Sucrose transporter and related proteins 94.15
KOG1479 406 consensus Nucleoside transporter [Nucleotide trans 93.85
KOG3810 433 consensus Micronutrient transporters (folate trans 93.67
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 93.48
KOG4332454 consensus Predicted sugar transporter [Carbohydrat 93.08
KOG3880 409 consensus Predicted small molecule transporter inv 90.79
COG4262 508 Predicted spermidine synthase with an N-terminal m 90.27
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 89.78
KOG3810433 consensus Micronutrient transporters (folate trans 89.44
KOG3880409 consensus Predicted small molecule transporter inv 89.14
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 88.72
PRK10263 1355 DNA translocase FtsK; Provisional 88.23
PF03219491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 84.49
PF12805 284 FUSC-like: FUSC-like inner membrane protein yccS 84.26
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 80.63
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
Probab=99.93  E-value=8.4e-25  Score=191.57  Aligned_cols=183  Identities=17%  Similarity=0.292  Sum_probs=166.1

Q ss_pred             ChhhHHHHHHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCCccccccccCCCchhHHHHHHHHHHHHHHHHhHHHHhh
Q 023849           46 TPGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLA  125 (276)
Q Consensus        46 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~g~l~  125 (276)
                      .+|+.+..+++.++..++|+..++...                 |.+++|+|++..+.+++.+.+.+++.+++++.|++.
T Consensus         5 ~~~~~~~~~~~~~~~~~~d~~~~~~~~-----------------~~l~~~~~~s~~~~g~~~s~~~~~~~~~~~~~g~l~   67 (412)
T TIGR02332         5 LFRRLIIFLFILFIFSFLDRINIGFAG-----------------LTMGKDLGLSATMFGLAATLFYAAYVICGIPSNIML   67 (412)
T ss_pred             ehhHHHHHHHHHHHHHHhhhhhHHHHH-----------------HhhHhhcCCCHHHHHHHHHHHHHHHHHHHhhHHHHH
Confidence            356778888888999999999988743                 689999999999999999999999999999999999


Q ss_pred             hccCChhhHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhhhhhhhcHHHHHhhcCcchhhhHHHHHHHHHhhhhhhH
Q 023849          126 RSVNPFRLIGVGLTVWTLAVVGCGFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAI  205 (276)
Q Consensus       126 d~~grr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~  205 (276)
                      ||+|||+++..+.++..++.++++++++++.+++.|++.|++.+...+....++.|++|+++|++++++++.+..+|.++
T Consensus        68 dr~G~r~~~~~~~~~~~~~~~~~~~~~~~~~l~~~r~l~G~~~~~~~~~~~~~~~~~~~~~~rg~~~~~~~~~~~~g~~~  147 (412)
T TIGR02332        68 AIIGARRWIAGIMVLWGIASTATMFATGPESLYLLRILVGIAEAGFLPGILLYLTFWFPAYFRARANALFMIAMPVTMAL  147 (412)
T ss_pred             HHhChHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHhhHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhc-------ccchhHHHHHhHHHHHHHHHHHHhhcccccC
Q 023849          206 GYVYGGWVG-------HYNWRYAFWGEAILMFPFAVLGFVMKPLQLK  245 (276)
Q Consensus       206 g~~~~~~l~-------~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (276)
                      ++.+++++.       ..|||+.|++.+++.++..++.+++.||+++
T Consensus       148 ~~~~~~~l~~~~~~~~~~gwr~~f~~~~~~~l~~~~~~~~~~~~~p~  194 (412)
T TIGR02332       148 GLILSGYILALDGLMALKGWQWLFLLEGFPSVILGVMTWFWLDDSPD  194 (412)
T ss_pred             HHHHHHHHHhCCCCCCccchhHHHHHHHHHHHHHHHHHhhccCCCcc
Confidence            999998875       2599999999988887776666666677654



This protein is a part of the Major Facilitator Superfamily (Pfam family pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. (PubMed:9315705) as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.

>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1237 consensus H+/oligopeptide symporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG3097 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3810 consensus Micronutrient transporters (folate transporter family) [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3880 consensus Predicted small molecule transporter involved in cellular pH homeostasis (Batten disease protein in human) [General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG3810 consensus Micronutrient transporters (folate transporter family) [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG3880 consensus Predicted small molecule transporter involved in cellular pH homeostasis (Batten disease protein in human) [General function prediction only] Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>PF12805 FUSC-like: FUSC-like inner membrane protein yccS Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 6e-09
2cfq_A417 Lactose permease; transport, transport mechanism, 7e-06
2cfq_A 417 Lactose permease; transport, transport mechanism, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
 Score = 55.1 bits (133), Expect = 6e-09
 Identities = 22/151 (14%), Positives = 46/151 (30%), Gaps = 6/151 (3%)

Query: 95  DFDLNNFQDGVLSSAFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGCGF---- 150
           +   +    G   S   +    +  I  S++   NP   +  GL +    ++  GF    
Sbjct: 56  EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWA 115

Query: 151 SFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYG 210
           + S  ++ +   L G  +          +       ++   + V+      G  I  +  
Sbjct: 116 TSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLF 175

Query: 211 GWV--GHYNWRYAFWGEAILMFPFAVLGFVM 239
                   +W  A +  A      A+  F M
Sbjct: 176 LLGMAWFNDWHAALYMPAFCAILVALFAFAM 206


>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Length = 417 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Length = 417 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.92
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.92
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.89
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.89
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.88
2xut_A 524 Proton/peptide symporter family protein; transport 99.84
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.69
2cfq_A417 Lactose permease; transport, transport mechanism, 99.61
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.6
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.58
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.56
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.5
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.26
2xut_A524 Proton/peptide symporter family protein; transport 99.07
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
Probab=99.92  E-value=5.1e-24  Score=186.15  Aligned_cols=181  Identities=18%  Similarity=0.182  Sum_probs=154.9

Q ss_pred             hhhHHHHHHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCCccccccccCCCchhHHHHHHHHHHHHHHHHhHHHHhhh
Q 023849           47 PGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLAR  126 (276)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~g~l~d  126 (276)
                      .++.+.++++.++...++...++.                 .+|.+.+++|++..+.+++.+.+.++..++++++|+++|
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~~~g~s~~~~g~~~~~~~~~~~i~~~~~G~l~d   86 (438)
T 3o7q_A           24 YIIPFALLCSLFFLWAVANNLNDI-----------------LLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMK   86 (438)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHH-----------------HHHHHHHHSCCCSHHHHHHHHHHHHHHHTTHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHhHHH-----------------HHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhHHHHHH
Confidence            344555556666666666555543                 347899999999999999999999999999999999999


Q ss_pred             ccCChhhHHHHHHHHHHHHHHH---hhhhhHHHHHHHHHHHHhhhhhhhhcHHHHHhhcCcchhhhHHHHHHHHHhhhhh
Q 023849          127 SVNPFRLIGVGLTVWTLAVVGC---GFSFSFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGY  203 (276)
Q Consensus       127 ~~grr~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~r~l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~  203 (276)
                      |+|||+++.++.++.+++.+++   .++++++.++++|++.|++.+...+...+++.|++|+++|++++++.+.+..+|.
T Consensus        87 r~g~r~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~G~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~g~  166 (438)
T 3o7q_A           87 KLSYKAGIITGLFLYALGAALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNSFGA  166 (438)
T ss_dssp             HSCHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSTTHHHHHHHHHHHHHHHH
T ss_pred             HhcchHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHHHHHhhHHHhhhhHHHHHHHHcCchhHHHHHHHHHHHHHHHH
Confidence            9999999999999999999998   8889999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHhhc-cc-c-------------------------hhHHHHHhHHHHHHHHHHHHhh-ccccc
Q 023849          204 AIGYVYGGWVG-HY-N-------------------------WRYAFWGEAILMFPFAVLGFVM-KPLQL  244 (276)
Q Consensus       204 ~~g~~~~~~l~-~~-~-------------------------w~~~~~~~~~~~~~~~~~~~~~-~~~~~  244 (276)
                      +++|.+++.+. .. +                         ||+.|++.+++.++..++.++. .|+++
T Consensus       167 ~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~p~~~  235 (438)
T 3o7q_A          167 IIAVVFGQSLILSNVPHQSQDVLDKMSPEQLSAYKHSLVLSVQTPYMIIVAIVLLVALLIMLTKFPALQ  235 (438)
T ss_dssp             HHHHHHTTHHHHTSSCCCCHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCT
T ss_pred             HHHHHHHHHHHhcccccccccccccCCcchhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHcCCccc
Confidence            99999998886 33 2                         9999988887776666555444 34433



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 276
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 4e-09
d1pv7a_417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 7e-04
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 54.7 bits (130), Expect = 4e-09
 Identities = 20/198 (10%), Positives = 48/198 (24%), Gaps = 22/198 (11%)

Query: 49  RLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSS 108
           ++ +   F     Y+ R   A                         +   +    G   S
Sbjct: 25  QIFLGIFFGYAAYYLVRKNFA------------------LAMPYLVEQGFSRGDLGFALS 66

Query: 109 AFMVGLLVASPIFASLARSVNPFRLIGVGLTVWTLAVVGC----GFSFSFWMIAICRMLV 164
              +    +  I  S++   NP   +  GL +    ++        + S  ++ +   L 
Sbjct: 67  GISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLC 126

Query: 165 GVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSGYAIGYVYGGWVGHYNWRYAFWG 224
           G  +          +       ++   + V+      G  I  +       +   +    
Sbjct: 127 GWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAAL 186

Query: 225 EAILMFPFAVLGFVMKPL 242
                    V  F    +
Sbjct: 187 YMPAFCAILVALFAFAMM 204


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.92
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.7
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.63
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.62
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.92  E-value=3.2e-25  Score=191.55  Aligned_cols=181  Identities=14%  Similarity=0.075  Sum_probs=157.7

Q ss_pred             hhhHHHHHHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCCccccccccCCCchhHHHHHHHHHHHHHHHHhHHHHhhh
Q 023849           47 PGRLLVIFCFINLLNYVDRGTIASNGVNGSPKNCSANGTCTPGTGIQGDFDLNNFQDGVLSSAFMVGLLVASPIFASLAR  126 (276)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~g~l~d  126 (276)
                      +|.++..++++++..++++..++..                 .|.++ |+|++.++.|++.+++.++++++++++|+++|
T Consensus        23 ~w~i~~~~~~~~~~~~~~~~~~~~~-----------------~p~~~-~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~D   84 (447)
T d1pw4a_          23 RWQIFLGIFFGYAAYYLVRKNFALA-----------------MPYLV-EQGFSRGDLGFALSGISIAYGFSKFIMGSVSD   84 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTSHHHH-----------------HHHTT-SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH-----------------HHHHH-HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4556666777788888887777653                 36665 58999999999999999999999999999999


Q ss_pred             ccCChhhHHHHHHHHHHHHHHHhhhh----hHHHHHHHHHHHHhhhhhhhhcHHHHHhhcCcchhhhHHHHHHHHHhhhh
Q 023849          127 SVNPFRLIGVGLTVWTLAVVGCGFSF----SFWMIAICRMLVGVGEASFISLAAPFIDDNAPVAKKTAWLGVFYMCLPSG  202 (276)
Q Consensus       127 ~~grr~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~r~l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g  202 (276)
                      |+|||+++.++.++.+++.++++++.    +++.++++|++.|++.+...+....++.|++|+++|++++++.+.+..+|
T Consensus        85 r~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g  164 (447)
T d1pw4a_          85 RSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVG  164 (447)
T ss_dssp             HSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHH
T ss_pred             HcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchh
Confidence            99999999999999999998887764    67889999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHhhc--ccchhHHHHHhHHHHHHHHHHHHhhcccccC
Q 023849          203 YAIGYVYGGWVG--HYNWRYAFWGEAILMFPFAVLGFVMKPLQLK  245 (276)
Q Consensus       203 ~~~g~~~~~~l~--~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (276)
                      .+++|.+++.+.  ..+||+.|++.+++.++..++.+++.++.++
T Consensus       165 ~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~  209 (447)
T d1pw4a_         165 GGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQ  209 (447)
T ss_dssp             HTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSST
T ss_pred             hhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccchh
Confidence            999999888776  5689999999998888877777776655443



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure