Citrus Sinensis ID: 023927

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----

MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLHDPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI

ccccccccccccccccccccccccccccEEEEEEcccccEEEEEEccccccEEEEEEcccccccccEEEEEEEccEEEEEEEcccccEEEEEEEEEccEEcccccccccccEEEEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEEEEccEEEccccEEEEccccccccccccccccccccccccEEEEEEcccEEEEEEcccccccccccccccccccEEEEEEEccccccEEEcccEEEEccccccccccEEEEccccccccccccc

cccccccccHHHcccccHHHHHccccccEEEEEEcccccEEEEEEccccccEEEEEEEcccccccccEEEEEEEcEEEEEEEcccccEEEEEEEEcccccccccccccccccEEEEEEEccccEEEEEccccccEEEEEccccccccEEEEEEEEEEEEccccEEEEEccccccccccccccccEccccccEEEEEccccEEEEEcccccHHHHHccHHHHccccEEEEEEcccccccEEEcccEEEEcccccccccccEEEEcccccccccEcc

missswgaplaftkgfnlqhvsdglygrhlfvyswpdgelkqtldlgntglipleirflhdpskdigfVGCALASTMVRfsktqdgswnhEVAISVKSLKVqnwilpempglITDFLISLDDRFLYFsnwlhgdirqyniedpknpvltgqiwvgglfrkgspvvavtddgqpyqsdvpevqghrlrggpqMIQLSLDGKRLYVTNSlfsawdcqfypelkekgshmlqidvnsekggmainpnffvdfeaepdgpalahemrypggdctsdiwi

MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLHDPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVpevqghrlrgGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHemrypggdctsdiwi

*****WGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLHDPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTD*********************QMIQLSLDGKRLYVTNSLFSAWDCQFYP**********************INPNFFVDF**************************

***SSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLHDPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		275	2.2.26 [Sep-21-2011]
O23264		490	Selenium-binding protein	yes	no	1.0	0.561	0.792	1e-130
Q93WN0		487	Selenium-binding protein	no	no	1.0	0.564	0.781	1e-130
Q9LK38		480	Selenium-binding protein	no	no	1.0	0.572	0.781	1e-128
Q569D5		472	Selenium-binding protein	yes	no	1.0	0.582	0.632	1e-100
Q52KZ7		472	Selenium-binding protein	N/A	no	1.0	0.582	0.625	5e-98
Q6DCH7		472	Selenium-binding protein	N/A	no	1.0	0.582	0.621	2e-97
Q5RF48		472	Selenium-binding protein	yes	no	0.996	0.580	0.625	5e-96
Q13228		472	Selenium-binding protein	yes	no	0.996	0.580	0.618	1e-95
Q8VIF7		472	Selenium-binding protein	yes	no	0.996	0.580	0.625	1e-95
P17563		472	Selenium-binding protein	yes	no	0.996	0.580	0.614	5e-95

>sp\|O23264\|SEBP1_ARATH Selenium-binding protein 1 OS=Arabidopsis thaliana GN=SBP1 PE=1 SV=1	Back alignment and function desciption

 Score =  465 bits (1197), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/275 (79%), Positives = 245/275 (89%)

Query: 1   MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLH 60
           MIS+SWGAP AF+KGFNLQHV+DGLYG HL VYSWP GE+KQ +DLG TGL+PLEIRFLH
Sbjct: 216 MISTSWGAPKAFSKGFNLQHVADGLYGSHLHVYSWPGGEIKQLIDLGPTGLLPLEIRFLH 275

Query: 61  DPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISL 120
           DPSKD GFVG AL+S M+RF K  D +W+HEV ISVK LKV+NWILPEMPGLITDFLISL
Sbjct: 276 DPSKDTGFVGSALSSNMIRFFKNSDETWSHEVVISVKPLKVENWILPEMPGLITDFLISL 335

Query: 121 DDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPE 180
           DDRF+YF NWLHGDIRQYNIEDPKNPVLTGQIWVGGL +KGSPV AV +DG  +Q +VP+
Sbjct: 336 DDRFIYFVNWLHGDIRQYNIEDPKNPVLTGQIWVGGLLQKGSPVKAVGEDGNTFQFEVPQ 395

Query: 181 VQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMA 240
           ++G  LRGGPQMIQLSLDGKRLY TNSLFSAWD QFYPE+ EKGSH++QIDV++EKGG+ 
Sbjct: 396 IKGKSLRGGPQMIQLSLDGKRLYATNSLFSAWDRQFYPEIMEKGSHIIQIDVDTEKGGLT 455

Query: 241 INPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 275
           INP+FFVDF  EPDGP+LAHEMRYPGGDCTSDIWI
Sbjct: 456 INPDFFVDFGDEPDGPSLAHEMRYPGGDCTSDIWI 490

Binds cadmium and mediates lower sensitivity to stress requiring glutathione (GSH) for tolerance (e.g. cadmium, selenate, and hydrogen peroxide excess). Probably helps to detoxify cadmium potentially through direct binding.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q93WN0\|SEBP2_ARATH Selenium-binding protein 2 OS=Arabidopsis thaliana GN=SBP2 PE=2 SV=1	Back alignment and function description

>sp\|Q9LK38\|SEBP3_ARATH Selenium-binding protein 3 OS=Arabidopsis thaliana GN=SBP3 PE=2 SV=1	Back alignment and function description

>sp\|Q569D5\|SBP1_XENTR Selenium-binding protein 1 OS=Xenopus tropicalis GN=selenbp1 PE=2 SV=1	Back alignment and function description

>sp\|Q52KZ7\|SBP1A_XENLA Selenium-binding protein 1-A OS=Xenopus laevis GN=selenbp1-a PE=2 SV=1	Back alignment and function description

>sp\|Q6DCH7\|SBP1B_XENLA Selenium-binding protein 1-B OS=Xenopus laevis GN=selenbp1-b PE=2 SV=1	Back alignment and function description

>sp\|Q5RF48\|SBP1_PONAB Selenium-binding protein 1 OS=Pongo abelii GN=SELENBP1 PE=2 SV=1	Back alignment and function description

>sp\|Q13228\|SBP1_HUMAN Selenium-binding protein 1 OS=Homo sapiens GN=SELENBP1 PE=1 SV=2	Back alignment and function description

>sp\|Q8VIF7\|SBP1_RAT Selenium-binding protein 1 OS=Rattus norvegicus GN=Selenbp1 PE=1 SV=1	Back alignment and function description

>sp\|P17563\|SBP1_MOUSE Selenium-binding protein 1 OS=Mus musculus GN=Selenbp1 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		275
224055825		483	predicted protein [Populus trichocarpa]	1.0	0.569	0.850	1e-137
255559184		475	selenium-binding protein, putative [Rici	1.0	0.578	0.850	1e-137
224129200		483	predicted protein [Populus trichocarpa]	1.0	0.569	0.850	1e-137
356525197		484	PREDICTED: selenium-binding protein 2 [G	1.0	0.568	0.843	1e-137
225433514		473	PREDICTED: selenium-binding protein 1 [V	1.0	0.581	0.832	1e-136
356512429		488	PREDICTED: selenium-binding protein 2-li	1.0	0.563	0.836	1e-135
388515077		487	unknown [Lotus japonicus]	1.0	0.564	0.832	1e-134
356568342		484	PREDICTED: selenium-binding protein 1-li	1.0	0.568	0.825	1e-134
449441386		481	PREDICTED: selenium-binding protein 2-li	1.0	0.571	0.818	1e-134
356540103		480	PREDICTED: selenium-binding protein 1-li	1.0	0.572	0.825	1e-134

>gi\|224055825\|ref\|XP_002298672.1\| predicted protein [Populus trichocarpa] gi\|222845930\|gb\|EEE83477.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 254/275 (92%)

Query: 1   MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLH 60
           MISSSWGAP AFTKGFN QHVSDGLYGRHL VYSWP+GELKQTLDLG+TGL+PLEIRFLH
Sbjct: 209 MISSSWGAPAAFTKGFNPQHVSDGLYGRHLHVYSWPNGELKQTLDLGSTGLLPLEIRFLH 268

Query: 61  DPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISL 120
           +PSKD GFVGCAL S MVRF KT D SW+HEVAISVK LKVQNWILPEMPGLITDFL+SL
Sbjct: 269 NPSKDTGFVGCALTSNMVRFFKTPDESWSHEVAISVKPLKVQNWILPEMPGLITDFLLSL 328

Query: 121 DDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPE 180
           DDRFLYF NWLHGD+RQYNIEDPKNPVL GQ+WVGGL +KGSPVVA  +DG+ +Q DVPE
Sbjct: 329 DDRFLYFVNWLHGDVRQYNIEDPKNPVLKGQVWVGGLIQKGSPVVAEGEDGKTWQYDVPE 388

Query: 181 VQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMA 240
           +QGHRLRGGPQMIQLSLDGKRLYVTNSLFS WD QFYPE+ EKGSHMLQIDV++EKGG+A
Sbjct: 389 IQGHRLRGGPQMIQLSLDGKRLYVTNSLFSTWDRQFYPEVVEKGSHMLQIDVDTEKGGLA 448

Query: 241 INPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 275
           INPN+FVDF +EPDGP+LAHEMRYPGGDCTSDIWI
Sbjct: 449 INPNYFVDFASEPDGPSLAHEMRYPGGDCTSDIWI 483

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255559184\|ref\|XP_002520613.1\| selenium-binding protein, putative [Ricinus communis] gi\|223540174\|gb\|EEF41749.1\| selenium-binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224129200\|ref\|XP_002328915.1\| predicted protein [Populus trichocarpa] gi\|222839345\|gb\|EEE77682.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356525197\|ref\|XP_003531213.1\| PREDICTED: selenium-binding protein 2 [Glycine max]	Back alignment and taxonomy information

>gi\|225433514\|ref\|XP_002267004.1\| PREDICTED: selenium-binding protein 1 [Vitis vinifera] gi\|298205245\|emb\|CBI17304.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356512429\|ref\|XP_003524921.1\| PREDICTED: selenium-binding protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|388515077\|gb\|AFK45600.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|356568342\|ref\|XP_003552370.1\| PREDICTED: selenium-binding protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|449441386\|ref\|XP_004138463.1\| PREDICTED: selenium-binding protein 2-like [Cucumis sativus] gi\|449495262\|ref\|XP_004159781.1\| PREDICTED: selenium-binding protein 2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356540103\|ref\|XP_003538530.1\| PREDICTED: selenium-binding protein 1-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		275
TAIR\|locus:2129351		490	SBP1 "selenium-binding protein	1.0	0.561	0.792	1.3e-123
TAIR\|locus:2129356		487	SBP2 "selenium-binding protein	1.0	0.564	0.781	2.7e-123
TAIR\|locus:2095183		480	SBP3 "selenium-binding protein	1.0	0.572	0.781	3.6e-121
UNIPROTKB\|Q13228		472	SELENBP1 "Selenium-binding pro	0.996	0.580	0.618	9.3e-91
RGD\|620571		472	Selenbp1 "selenium binding pro	0.996	0.580	0.625	1.5e-90
UNIPROTKB\|Q8VIF7		472	Selenbp1 "Selenium-binding pro	0.996	0.580	0.625	1.5e-90
ZFIN\|ZDB-GENE-040426-1436		473	selenbp1 "selenium binding pro	0.985	0.572	0.620	1.5e-90
UNIPROTKB\|F1PNH6		502	SELENBP1 "Uncharacterized prot	0.996	0.545	0.625	2.5e-90
UNIPROTKB\|Q2KJ32		472	SELENBP1 "Selenium-binding pro	0.996	0.580	0.621	1.4e-89
MGI\|MGI:96825		472	Selenbp1 "selenium binding pro	0.996	0.580	0.614	1.7e-89

TAIR\|locus:2129351 SBP1 "selenium-binding protein 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1215 (432.8 bits), Expect = 1.3e-123, P = 1.3e-123
 Identities = 218/275 (79%), Positives = 245/275 (89%)

Query:     1 MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLH 60
             MIS+SWGAP AF+KGFNLQHV+DGLYG HL VYSWP GE+KQ +DLG TGL+PLEIRFLH
Sbjct:   216 MISTSWGAPKAFSKGFNLQHVADGLYGSHLHVYSWPGGEIKQLIDLGPTGLLPLEIRFLH 275

Query:    61 DPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISL 120
             DPSKD GFVG AL+S M+RF K  D +W+HEV ISVK LKV+NWILPEMPGLITDFLISL
Sbjct:   276 DPSKDTGFVGSALSSNMIRFFKNSDETWSHEVVISVKPLKVENWILPEMPGLITDFLISL 335

Query:   121 DDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPE 180
             DDRF+YF NWLHGDIRQYNIEDPKNPVLTGQIWVGGL +KGSPV AV +DG  +Q +VP+
Sbjct:   336 DDRFIYFVNWLHGDIRQYNIEDPKNPVLTGQIWVGGLLQKGSPVKAVGEDGNTFQFEVPQ 395

Query:   181 VQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMA 240
             ++G  LRGGPQMIQLSLDGKRLY TNSLFSAWD QFYPE+ EKGSH++QIDV++EKGG+ 
Sbjct:   396 IKGKSLRGGPQMIQLSLDGKRLYATNSLFSAWDRQFYPEIMEKGSHIIQIDVDTEKGGLT 455

Query:   241 INPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 275
             INP+FFVDF  EPDGP+LAHEMRYPGGDCTSDIWI
Sbjct:   456 INPDFFVDFGDEPDGPSLAHEMRYPGGDCTSDIWI 490

GO:0005634 "nucleus" evidence=ISM

GO:0008430 "selenium binding" evidence=IEA;ISS

GO:0046686 "response to cadmium ion" evidence=IEP;IDA

GO:0000103 "sulfate assimilation" evidence=IEP

GO:0042542 "response to hydrogen peroxide" evidence=IDA

GO:0071291 "cellular response to selenium ion" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

TAIR\|locus:2129356 SBP2 "selenium-binding protein 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2095183 SBP3 "selenium-binding protein 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q13228 SELENBP1 "Selenium-binding protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|620571 Selenbp1 "selenium binding protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8VIF7 Selenbp1 "Selenium-binding protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1436 selenbp1 "selenium binding protein 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PNH6 SELENBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KJ32 SELENBP1 "Selenium-binding protein 1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:96825 Selenbp1 "selenium binding protein 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O23264	SEBP1_ARATH	No assigned EC number	0.7927	1.0	0.5612	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_I3319	hypothetical protein (484 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		275
pfam05694		461	pfam05694, SBP56, 56kDa selenium binding protein (	1e-163

>gnl\|CDD\|218697 pfam05694, SBP56, 56kDa selenium binding protein (SBP56)	Back alignment and domain information

 Score =  459 bits (1184), Expect = e-163
 Identities = 153/282 (54%), Positives = 191/282 (67%), Gaps = 22/282 (7%)

Query: 1   MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLH 60
           MISS WGAP  F  GF+ + + DG YG  L  +     +  QT+DLG  G +PLE+RFLH
Sbjct: 195 MISSEWGAPNMFEDGFDPEDLLDGKYGHRLHFWDLRRRKHVQTIDLGEEGQMPLEVRFLH 254

Query: 61  DPSKDIGFVGCALASTMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEM-------PGLI 113
           DP+K  GFVGCAL+S++ R+ K  DG W  E  I + +  V+ WILP M       P L+
Sbjct: 255 DPTKAYGFVGCALSSSIWRWYKDDDGKWAAEKVIEIPAEPVEGWILPPMLKGFGAVPPLV 314

Query: 114 TDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQP 173
           TD L+SLDDRFLY S W HGD+RQY+I DP NP LTGQ+ +GG+ R+             
Sbjct: 315 TDILLSLDDRFLYVSCWGHGDLRQYDISDPFNPKLTGQVRLGGIIRRA------------ 362

Query: 174 YQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVN 233
                P V+G RL GGPQM+QLSLDGKRLYVTNSL+SAWD QFYP+  +KG  ML+IDV+
Sbjct: 363 ---PHPAVKGRRLNGGPQMVQLSLDGKRLYVTNSLYSAWDDQFYPDGVKKGGWMLKIDVD 419

Query: 234 SEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 275
            + GG++++PNFFVDF  EPDGPA AHE+R PGGDC+SD W 
Sbjct: 420 PDNGGLSLDPNFFVDFGKEPDGPARAHEIRLPGGDCSSDSWC 461

This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homologue of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport. Length = 461

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		275
KOG0918		476	consensus Selenium-binding protein [Inorganic ion	100.0
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	100.0
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	100.0
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.97
PRK11028		330	6-phosphogluconolactonase; Provisional	99.91
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.72
PRK11028		330	6-phosphogluconolactonase; Provisional	99.67
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.54
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	99.39
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	99.38
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.27
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.26
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	99.26
PRK02888		635	nitrous-oxide reductase; Validated	99.19
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.18
COG3391		381	Uncharacterized conserved protein [Function unknow	99.15
PRK02888		635	nitrous-oxide reductase; Validated	98.99
COG3391		381	Uncharacterized conserved protein [Function unknow	98.97
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.93
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.92
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.83
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.67
TIGR02276		42	beta_rpt_yvtn 40-residue YVTN family beta-propelle	98.57
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.5
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	98.32
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	98.13
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	98.08
PRK04792		448	tolB translocation protein TolB; Provisional	98.05
PRK03629		429	tolB translocation protein TolB; Provisional	97.99
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	97.91
KOG2110		391	consensus Uncharacterized conserved protein, conta	97.91
PRK02889		427	tolB translocation protein TolB; Provisional	97.9
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	97.87
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	97.87
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	97.84
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	97.81
PRK04922		433	tolB translocation protein TolB; Provisional	97.8
PRK02889		427	tolB translocation protein TolB; Provisional	97.79
PRK01742		429	tolB translocation protein TolB; Provisional	97.78
PRK04922		433	tolB translocation protein TolB; Provisional	97.77
PRK00178		430	tolB translocation protein TolB; Provisional	97.74
PRK04792		448	tolB translocation protein TolB; Provisional	97.74
PRK03629		429	tolB translocation protein TolB; Provisional	97.72
PRK01029		428	tolB translocation protein TolB; Provisional	97.7
KOG0266		456	consensus WD40 repeat-containing protein [General	97.68
KOG0282		503	consensus mRNA splicing factor [Function unknown]	97.64
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	97.63
KOG0643		327	consensus Translation initiation factor 3, subunit	97.62
PRK00178		430	tolB translocation protein TolB; Provisional	97.62
KOG0315		311	consensus G-protein beta subunit-like protein (con	97.51
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	97.51
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	97.49
PRK01742		429	tolB translocation protein TolB; Provisional	97.49
PRK05137		435	tolB translocation protein TolB; Provisional	97.48
KOG2096		420	consensus WD40 repeat protein [General function pr	97.48
KOG0772		641	consensus Uncharacterized conserved protein, conta	97.47
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	97.45
PRK05137		435	tolB translocation protein TolB; Provisional	97.44
KOG1539		910	consensus WD repeat protein [General function pred	97.43
PRK01029		428	tolB translocation protein TolB; Provisional	97.43
KOG2110		391	consensus Uncharacterized conserved protein, conta	97.4
KOG1407		313	consensus WD40 repeat protein [Function unknown]	97.33
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	97.22
KOG0639		705	consensus Transducin-like enhancer of split protei	97.21
KOG2315		566	consensus Predicted translation initiation factor	97.12
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	97.02
PRK04043		419	tolB translocation protein TolB; Provisional	97.01
PTZ00421		493	coronin; Provisional	96.97
KOG0293		519	consensus WD40 repeat-containing protein [Function	96.94
PRK04043		419	tolB translocation protein TolB; Provisional	96.93
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	96.84
KOG2055		514	consensus WD40 repeat protein [General function pr	96.82
PTZ00420		568	coronin; Provisional	96.74
PTZ00420		568	coronin; Provisional	96.73
KOG2096		420	consensus WD40 repeat protein [General function pr	96.69
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	96.65
KOG2139		445	consensus WD40 repeat protein [General function pr	96.64
KOG0318		603	consensus WD40 repeat stress protein/actin interac	96.63
KOG0318		603	consensus WD40 repeat stress protein/actin interac	96.57
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	96.56
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	96.5
KOG1407		313	consensus WD40 repeat protein [Function unknown]	96.49
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	96.45
PF08309		42	LVIVD: LVIVD repeat; InterPro: IPR013211 This repe	96.44
KOG2055		514	consensus WD40 repeat protein [General function pr	96.41
KOG0266		456	consensus WD40 repeat-containing protein [General	96.38
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	96.33
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	96.33
COG5276		370	Uncharacterized conserved protein [Function unknow	96.3
TIGR03606		454	non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH	96.2
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	96.05
PF03022		287	MRJP: Major royal jelly protein; InterPro: IPR0035	95.95
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	95.93
KOG0293		519	consensus WD40 repeat-containing protein [Function	95.87
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	95.85
KOG3881		412	consensus Uncharacterized conserved protein [Funct	95.82
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	95.77
TIGR03606		454	non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH	95.66
KOG0294		362	consensus WD40 repeat-containing protein [Function	95.62
COG3823		262	Glutamine cyclotransferase [Posttranslational modi	95.57
COG4946		668	Uncharacterized protein related to the periplasmic	95.48
COG4946		668	Uncharacterized protein related to the periplasmic	95.46
KOG0288		459	consensus WD40 repeat protein TipD [General functi	95.4
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	95.34
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	95.29
PF01731		86	Arylesterase: Arylesterase; InterPro: IPR002640 Th	95.11
KOG0771		398	consensus Prolactin regulatory element-binding pro	95.1
TIGR02276		42	beta_rpt_yvtn 40-residue YVTN family beta-propelle	95.06
PF03088		89	Str_synth: Strictosidine synthase; InterPro: IPR01	95.05
KOG0286		343	consensus G-protein beta subunit [General function	95.04
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	94.96
KOG0772		641	consensus Uncharacterized conserved protein, conta	94.96
KOG0263		707	consensus Transcription initiation factor TFIID, s	94.9
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	94.89
KOG0315		311	consensus G-protein beta subunit-like protein (con	94.88
PTZ00421		493	coronin; Provisional	94.74
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	94.73
KOG0278		334	consensus Serine/threonine kinase receptor-associa	94.7
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	94.7
COG5276		370	Uncharacterized conserved protein [Function unknow	94.66
KOG0316		307	consensus Conserved WD40 repeat-containing protein	94.58
KOG0639		705	consensus Transducin-like enhancer of split protei	94.56
KOG0640		430	consensus mRNA cleavage stimulating factor complex	94.47
PF01436		28	NHL: NHL repeat; InterPro: IPR001258 The NHL repea	94.44
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	94.39
KOG0645		312	consensus WD40 repeat protein [General function pr	93.96
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	93.83
KOG1273		405	consensus WD40 repeat protein [General function pr	93.75
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	93.75
KOG0275		508	consensus Conserved WD40 repeat-containing protein	93.63
KOG0973		942	consensus Histone transcription regulator HIRA, WD	93.57
KOG1520		376	consensus Predicted alkaloid synthase/Surface muci	93.54
KOG0646		476	consensus WD40 repeat protein [General function pr	93.49
KOG0303		472	consensus Actin-binding protein Coronin, contains	93.44
KOG2111		346	consensus Uncharacterized conserved protein, conta	93.21
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	93.18
KOG0278		334	consensus Serine/threonine kinase receptor-associa	93.11
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	93.09
KOG1274		933	consensus WD40 repeat protein [General function pr	92.96
COG4257		353	Vgb Streptogramin lyase [Defense mechanisms]	92.95
PLN00181		793	protein SPA1-RELATED; Provisional	92.92
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	92.87
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	92.83
PF13449		326	Phytase-like: Esterase-like activity of phytase	92.81
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	92.79
KOG0263		707	consensus Transcription initiation factor TFIID, s	92.68
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	92.37
KOG0646		476	consensus WD40 repeat protein [General function pr	92.01
KOG0279		315	consensus G protein beta subunit-like protein [Sig	91.83
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	91.58
KOG1539		910	consensus WD repeat protein [General function pred	91.53
KOG0283		712	consensus WD40 repeat-containing protein [Function	91.52
KOG3881		412	consensus Uncharacterized conserved protein [Funct	91.43
KOG2315		566	consensus Predicted translation initiation factor	91.1
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	91.08
smart00135		43	LY Low-density lipoprotein-receptor YWTD domain. T	90.98
KOG0918		476	consensus Selenium-binding protein [Inorganic ion	90.86
KOG0310		487	consensus Conserved WD40 repeat-containing protein	90.85
KOG0973		942	consensus Histone transcription regulator HIRA, WD	90.82
PLN00181		793	protein SPA1-RELATED; Provisional	90.7
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	90.64
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	90.6
KOG2106		626	consensus Uncharacterized conserved protein, conta	90.53
PF01731		86	Arylesterase: Arylesterase; InterPro: IPR002640 Th	90.36
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	90.34
KOG0286		343	consensus G-protein beta subunit [General function	90.33
KOG0310		487	consensus Conserved WD40 repeat-containing protein	90.19
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	90.15
TIGR03118		336	PEPCTERM_chp_1 conserved hypothetical protein TIGR	89.98
KOG0296		399	consensus Angio-associated migratory cell protein	89.76
KOG2314		698	consensus Translation initiation factor 3, subunit	89.72
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	89.66
TIGR03032		335	conserved hypothetical protein TIGR03032. This pro	89.18
PRK13616		591	lipoprotein LpqB; Provisional	88.98
PF09826		521	Beta_propel: Beta propeller domain; InterPro: IPR0	88.73
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	88.63
KOG0290		364	consensus Conserved WD40 repeat-containing protein	88.41
KOG0283		712	consensus WD40 repeat-containing protein [Function	88.38
PF02333		381	Phytase: Phytase; InterPro: IPR003431 Phytase (3.1	88.32
PF02333		381	Phytase: Phytase; InterPro: IPR003431 Phytase (3.1	88.15
PF09826		521	Beta_propel: Beta propeller domain; InterPro: IPR0	88.11
PF13449		326	Phytase-like: Esterase-like activity of phytase	88.09
TIGR03118		336	PEPCTERM_chp_1 conserved hypothetical protein TIGR	87.86
KOG2111		346	consensus Uncharacterized conserved protein, conta	87.56
KOG0282		503	consensus mRNA splicing factor [Function unknown]	87.45
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	87.39
smart00135		43	LY Low-density lipoprotein-receptor YWTD domain. T	87.23
KOG0289		506	consensus mRNA splicing factor [General function p	86.83
KOG0279		315	consensus G protein beta subunit-like protein [Sig	86.81
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	86.77
KOG0294		362	consensus WD40 repeat-containing protein [Function	86.75
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	86.67
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	86.4
KOG2048		691	consensus WD40 repeat protein [General function pr	86.15
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	86.04
KOG1274		933	consensus WD40 repeat protein [General function pr	85.8
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	85.76
PF05935		477	Arylsulfotrans: Arylsulfotransferase (ASST); Inter	85.58
KOG2048		691	consensus WD40 repeat protein [General function pr	85.42
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	85.42
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	85.42
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	85.37
KOG0295		406	consensus WD40 repeat-containing protein [Function	84.7
KOG2314		698	consensus Translation initiation factor 3, subunit	84.66
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	84.21
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	84.18
KOG0289		506	consensus mRNA splicing factor [General function p	84.03
COG2133		399	Glucose/sorbosone dehydrogenases [Carbohydrate tra	83.9
KOG0288		459	consensus WD40 repeat protein TipD [General functi	83.71
KOG1273		405	consensus WD40 repeat protein [General function pr	83.69
KOG0308		735	consensus Conserved WD40 repeat-containing protein	83.68
KOG1063		764	consensus RNA polymerase II elongator complex, sub	83.33
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	83.28
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	82.92
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	82.78
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	82.64
KOG2321		703	consensus WD40 repeat protein [General function pr	82.17
KOG0267		825	consensus Microtubule severing protein katanin p80	82.15
COG4247		364	Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph	82.03
KOG0647		347	consensus mRNA export protein (contains WD40 repea	81.89
PF03022		287	MRJP: Major royal jelly protein; InterPro: IPR0035	81.64
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	81.47
KOG0275		508	consensus Conserved WD40 repeat-containing protein	81.45
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	81.06
PF03088		89	Str_synth: Strictosidine synthase; InterPro: IPR01	80.98
KOG0296		399	consensus Angio-associated migratory cell protein	80.46
PF07676		39	PD40: WD40-like Beta Propeller Repeat; InterPro: I	80.43
KOG4547		541	consensus WD40 repeat-containing protein [General	80.04

>KOG0918 consensus Selenium-binding protein [Inorganic ion transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=2.4e-92  Score=667.13  Aligned_cols=275  Identities=71%  Similarity=1.262  Sum_probs=271.8

Q ss_pred             CcccccCCCcCCcCCCccccccCCccCCeEEEEECCCCCeeEEEECCCCCccceEEEEEeCCCCCEEEEeeccCCcEEEE
Q 023927            1 MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLHDPSKDIGFVGCALASTMVRF   80 (275)
Q Consensus         1 m~ss~~~~p~~~~~g~~~~~~~~g~~~d~I~v~d~~~~k~~~~i~Lg~~G~gP~~v~f~f~P~g~~~YV~~eL~stV~~~   80 (275)
                      |||||||+|+.+++||++.+++++.|+.++|+|++.++++.|+++|+..|..|++|||+|+|+..++||.|+++++|++|
T Consensus       202 mIstewgap~~~~~gf~~~~v~d~lyg~~lhvy~w~~~~~~QtidL~~~gllpleiRfLh~p~~~~~fvg~Al~s~i~~~  281 (476)
T KOG0918|consen  202 MISTEWGAPNALRKGFNPADVEDGLYGSHLHVYQWSPGELKQTIDLGDTGLLPLEIRFLHNPSKATGFVGCALSSNIFRF  281 (476)
T ss_pred             EEeecccCchhhhcCCChhHhhccceeeeeEEEecCCccceeEEecCCCCcceEEeeeccCCCcccceeeeeccCCceee
Confidence            99999999999999999999999999999999999999999999999889999999999999999999999999999999


Q ss_pred             EeCCCCCeeEEEEEEecCccccccccCCCCCceeEEEEcCCCCEEEEEeCCCCcEEEEEecCCCCCeEEEEEEecceeec
Q 023927           81 SKTQDGSWNHEVAISVKSLKVQNWILPEMPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRK  160 (275)
Q Consensus        81 ~~~~~G~~~~~~vi~i~~~~~~g~~~~~~~~~~adI~iSpDgrfLYVSNrg~~sIavfdI~~~~~~~lv~~v~~gG~~~~  160 (275)
                      ++.++++|.++.++++++.++++|.+++||+..+||.||+|+||||||||.|+.|+||||+||.+++|.+||.+||++.+
T Consensus       282 ~k~~~~tws~~~visvp~~kv~~w~~~eMP~LITDilISmDDRFLYvs~WLHGDirQYdIsDP~n~kLtgQi~lGG~i~~  361 (476)
T KOG0918|consen  282 FKNSDDTWSAEVVISVPPLKVENWILPEMPGLITDILISLDDRFLYVSNWLHGDIRQYDISDPKNPKLTGQIFLGGSIQK  361 (476)
T ss_pred             eeccccccceeEEEecCccccccccCcccchhhheeEEeecCcEEEEEeeeecceeeeccCCCCCcceEEEEEECcEeec
Confidence            99877999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceeeecCCCCCCCCCCccccCcccCCCCceEEECCCCCEEEEEeCCCCCcccccccccccCCcEEEEEEeeCCCCCee
Q 023927          161 GSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMA  240 (275)
Q Consensus       161 ~~~~~v~~~~~~~~~~~~~~~~G~~~~g~Pr~~~LSpDGk~LyVANsl~~~wd~Q~yp~~~~~~~~~~~~d~d~~~G~l~  240 (275)
                      +++|+|++++.+..++++..++|++++|||+|||||.|||||||+|||||+||+|||||++++|++|+++|||+++|+|+
T Consensus       362 ~s~vkvl~~e~~~~~~ea~~vKGrkl~GGPQMlQLSLDGKRLYVt~SLys~WD~QFYPE~v~~G~~miqidvdt~~g~~~  441 (476)
T KOG0918|consen  362 GSPVKVLEEEGLKKQPEALYVKGRKLRGGPQMLQLSLDGKRLYVTNSLYSAWDRQFYPELVSKGSHMIQIDVDTVKGGLS  441 (476)
T ss_pred             CCceEEeccccccCCCccceecCccccCCceeEEeccCCcEEEEEchhhhhhHhhhCHHHHhcCceEEEEeeeccCCcee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccceeEecCCCCCCCcceeeeecCCCCcCccccC
Q 023927          241 INPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI  275 (275)
Q Consensus       241 ~~~~f~vdf~~~~~g~~~~h~~r~~ggd~~sd~~~  275 (275)
                      +|++|+|||++||+||++||||||||||||||||+
T Consensus       442 lN~~flvDf~~ep~gPsL~hemRypggdCtsdiwi  476 (476)
T KOG0918|consen  442 LNPDFLVDFGKEPDGPSLAHEMRYPGGDCTSDIWI  476 (476)
T ss_pred             eCccceEEccCCCCCcchhhhcccCCCcccccccC
Confidence            99999999999999999999999999999999997

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>PF08309 LVIVD: LVIVD repeat; InterPro: IPR013211 This repeat is found in bacterial and archaeal cell surface proteins, many of which are hypothetical	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>COG5276 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat	Back alignment and domain information

>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>COG5276 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG4257 Vgb Streptogramin lyase [Defense mechanisms]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>PF13449 Phytase-like: Esterase-like activity of phytase	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>smart00135 LY Low-density lipoprotein-receptor YWTD domain	Back alignment and domain information

>KOG0918 consensus Selenium-binding protein [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>TIGR03032 conserved hypothetical protein TIGR03032	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3	Back alignment and domain information

>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3	Back alignment and domain information

>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats	Back alignment and domain information

>PF13449 Phytase-like: Esterase-like activity of phytase	Back alignment and domain information

>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>smart00135 LY Low-density lipoprotein-receptor YWTD domain	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		275
2ece_A		462	X-Ray Structure Of Hypothetical Selenium-Binding Pr		2e-45

>pdb|2ECE|A Chain A, X-Ray Structure Of Hypothetical Selenium-Binding Protein From Sulfolobus Tokodaii, St0059 Length = 462

Back alignment and structure

Iteration: 1

Score = 179 bits (453), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 109/284 (38%), Positives = 162/284 (57%), Gaps = 40/284 (14%) Query: 1 MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLH 60 ++SS W P G L+H+ D YG + + + +L LG + LE+R LH Sbjct: 202 LVSSEWAVPNTIEDGLKLEHLKDR-YGNRIHFWDLRKRKRIHSLTLGEENRMALELRPLH 260 Query: 61 DPSKDIGFVGCALA----STMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEM------- 109 DP+K +GF+ ++ S+ + +DG WN E I + + ++ LPE+ Sbjct: 261 DPTKLMGFINMVVSLKDLSSSIWLWFYEDGKWNAEKVIEIPAEPLEG-NLPEILKPFKAV 319 Query: 110 PGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTD 169 P L+TD ISLDD+FLY S W G++RQY+I +P PVLTG++ +GG+F Sbjct: 320 PPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIF----------- 368 Query: 170 DGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPE-LKEKGSHML 228 +++D P GH+L G PQM+++S DG+R+YVTNSL+S WD QFYPE LK M+ Sbjct: 369 ----HRADHP--AGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFYPEGLK---GWMV 419 Query: 229 QIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSD 272 +++ N GG+ I+ FFVDF G A +H++R GGD +SD Sbjct: 420 KLNANPS-GGLEIDKEFFVDF-----GEARSHQVRLSGGDASSD 457

PyMOL of 2ece

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		275
2ece_A		462	462AA long hypothetical selenium-binding protein;	6e-99
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	2e-04
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	4e-04

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Length = 462	Back alignment and structure

 Score =  296 bits (759), Expect = 6e-99
 Identities = 102/284 (35%), Positives = 155/284 (54%), Gaps = 36/284 (12%)

Query: 1   MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLH 60
           ++SS W  P     G  L+H+ D  YG  +  +     +   +L LG    + LE+R LH
Sbjct: 202 LVSSEWAVPNTIEDGLKLEHLKD-RYGNRIHFWDLRKRKRIHSLTLGEENRMALELRPLH 260

Query: 61  DPSKDIGFVGCALA----STMVRFSKTQDGSWNHEVAISVKSLKVQNWI------LPEMP 110
           DP+K +GF+   ++    S+ +     +DG WN E  I + +  ++  +         +P
Sbjct: 261 DPTKLMGFINMVVSLKDLSSSIWLWFYEDGKWNAEKVIEIPAEPLEGNLPEILKPFKAVP 320

Query: 111 GLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDD 170
            L+TD  ISLDD+FLY S W  G++RQY+I +P  PVLTG++ +GG+F +          
Sbjct: 321 PLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIFHRA--------- 371

Query: 171 GQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQI 230
                       GH+L G PQM+++S DG+R+YVTNSL+S WD QFYPE       M+++
Sbjct: 372 --------DHPAGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFYPE--GLKGWMVKL 421

Query: 231 DVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIW 274
           + N   GG+ I+  FFVDF     G A +H++R  GGD +SD +
Sbjct: 422 NAN-PSGGLEIDKEFFVDF-----GEARSHQVRLSGGDASSDSY 459

PyMOL of 2ece

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Length = 433	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		275
2ece_A		462	462AA long hypothetical selenium-binding protein;	100.0
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.84
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.84
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.78
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.73
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.67
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.66
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.64
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.63
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.62
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.59
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.56
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.54
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.52
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.52
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.51
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.48
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	99.46
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.46
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.46
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	99.45
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	99.45
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.44
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.44
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	99.43
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.4
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.4
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	99.39
2ece_A		462	462AA long hypothetical selenium-binding protein;	99.39
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.37
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	99.37
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	99.36
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.35
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	99.33
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.33
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.31
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.3
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	99.27
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	99.26
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.24
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.24
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.22
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	99.19
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.18
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	99.17
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	99.17
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	99.15
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	99.13
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	99.1
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.1
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	99.1
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.06
3kya_A		496	Putative phosphatase; structural genomics, joint c	99.02
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.01
2p4o_A		306	Hypothetical protein; putative lactonase, structur	98.99
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	98.99
2qe8_A		343	Uncharacterized protein; structural genomics, join	98.95
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	98.93
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	98.91
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	98.9
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	98.87
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	98.86
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	98.83
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	98.82
2p4o_A		306	Hypothetical protein; putative lactonase, structur	98.81
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	98.78
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	98.77
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	98.77
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	98.77
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	98.77
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	98.76
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	98.75
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.74
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	98.71
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	98.71
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	98.7
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.62
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.6
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	98.6
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	98.58
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	98.58
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	98.53
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	98.53
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.52
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	98.52
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	98.51
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	98.51
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	98.5
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	98.5
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.5
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	98.49
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.48
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.48
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	98.47
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	98.46
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.46
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	98.46
2qe8_A		343	Uncharacterized protein; structural genomics, join	98.46
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	98.45
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.43
2g8s_A		353	Glucose/sorbosone dehydrogenases; bladed beta-prop	98.42
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	98.42
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	98.42
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.42
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	98.41
3amr_A		355	3-phytase; beta-propeller, phytate, MYO-inositol h	98.41
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	98.4
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	98.39
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	98.37
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	98.36
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	98.35
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	98.34
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	98.33
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	98.33
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	98.32
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	98.31
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	98.29
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	98.29
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	98.28
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	98.27
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	98.27
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	98.26
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	98.23
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	98.23
3ow8_A		321	WD repeat-containing protein 61; structural genomi	98.21
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	98.21
3sbq_A		638	Nitrous-oxide reductase; beta-propeller, cupredoxi	98.19
3kya_A		496	Putative phosphatase; structural genomics, joint c	98.18
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	98.17
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	98.16
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	98.13
3amr_A		355	3-phytase; beta-propeller, phytate, MYO-inositol h	98.13
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	98.11
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	98.1
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	98.08
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	98.07
3ow8_A		321	WD repeat-containing protein 61; structural genomi	98.07
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	98.06
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	98.05
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	98.04
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	98.04
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	98.03
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	98.02
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	98.02
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	98.02
1k32_A		1045	Tricorn protease; protein degradation, substrate g	98.01
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	98.01
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	98.0
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	97.98
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	97.97
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	97.97
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	97.95
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	97.93
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	97.93
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	97.92
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	97.92
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	97.92
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	97.91
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	97.89
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	97.89
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	97.88
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.88
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	97.87
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	97.87
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	97.86
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	97.86
2g8s_A		353	Glucose/sorbosone dehydrogenases; bladed beta-prop	97.85
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	97.84
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	97.84
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	97.84
3jrp_A		379	Fusion protein of protein transport protein SEC13	97.81
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	97.81
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	97.79
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	97.79
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	97.79
1cru_A		454	Protein (soluble quinoprotein glucose dehydrogena;	97.79
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	97.79
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	97.77
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.76
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	97.75
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	97.75
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	97.74
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	97.74
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	97.73
1cru_A		454	Protein (soluble quinoprotein glucose dehydrogena;	97.73
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	97.7
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	97.7
2p9w_A		334	MAL S 1 allergenic protein; beta propeller; 1.35A	97.7
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	97.69
3jrp_A		379	Fusion protein of protein transport protein SEC13	97.69
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	97.68
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	97.68
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	97.68
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	97.67
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	97.65
2p9w_A		334	MAL S 1 allergenic protein; beta propeller; 1.35A	97.64
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	97.64
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	97.61
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	97.61
3sbq_A		638	Nitrous-oxide reductase; beta-propeller, cupredoxi	97.59
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	97.59
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	97.58
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.57
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	97.57
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	97.57
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	97.57
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	97.56
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	97.55
3das_A		347	Putative oxidoreductase; aldose sugar dehydrogenas	97.55
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	97.55
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	97.55
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	97.54
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	97.52
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	97.47
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	97.45
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	97.45
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	97.42
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	97.42
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	97.42
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	97.41
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	97.41
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	97.41
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	97.41
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	97.37
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	97.36
3das_A		347	Putative oxidoreductase; aldose sugar dehydrogenas	97.36
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	97.36
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	97.33
1k32_A		1045	Tricorn protease; protein degradation, substrate g	97.33
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	97.32
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	97.3
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	97.26
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	97.21
2pm7_B		297	Protein transport protein SEC13, protein transport	97.21
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	97.21
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	97.2
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	97.2
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	97.17
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.17
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	97.17
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	97.15
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	97.13
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	97.08
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	97.07
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	97.06
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	97.06
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	97.05
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	97.02
3jro_A		753	Fusion protein of protein transport protein SEC13	96.99
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	96.98
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	96.97
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	96.97
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	96.95
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	96.95
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	96.94
3jro_A		753	Fusion protein of protein transport protein SEC13	96.92
2pm7_B		297	Protein transport protein SEC13, protein transport	96.91
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	96.9
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	96.88
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	96.87
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	96.87
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	96.85
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	96.8
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	96.69
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	96.69
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	96.61
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	96.48
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	96.46
3q6k_A		381	43.2 kDa salivary protein; beta propeller, binding	96.44
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	96.44
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	96.39
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	96.26
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	96.17
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	96.02
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	95.97
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	95.96
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	95.91
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	95.75
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	95.65
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	95.56
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	95.25
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	95.18
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	95.16
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	94.93
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	94.79
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	94.79
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	94.57
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	94.22
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	94.08
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	93.81
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	93.8
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	93.6
4a9v_A		592	PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona	93.27
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	93.25
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	93.17
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	91.13
3q6k_A		381	43.2 kDa salivary protein; beta propeller, binding	90.84
3ei3_A		1158	DNA damage-binding protein 1; UV-damage, DDB, nucl	90.18
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	88.35
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	88.15
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	86.7
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	85.5
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	83.32
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	80.55

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

Probab=100.00  E-value=5.1e-73  Score=552.82  Aligned_cols=247  Identities=42%  Similarity=0.828  Sum_probs=227.8

Q ss_pred             CcccccCCCcCCcCCCccccccCCccCCeEEEEECCCCCeeEEEECCCCCccceEEEEEeCCCCCEEEEeec-----cCC
Q 023927            1 MISSSWGAPLAFTKGFNLQHVSDGLYGRHLFVYSWPDGELKQTLDLGNTGLIPLEIRFLHDPSKDIGFVGCA-----LAS   75 (275)
Q Consensus         1 m~ss~~~~p~~~~~g~~~~~~~~g~~~d~I~v~d~~~~k~~~~i~Lg~~G~gP~~v~f~f~P~g~~~YV~~e-----L~s   75 (275)
                      |||||||+|+.|+.|++++++.+ +++++|++||+++++++++++++.+|.+||||+|+|||+++++||+||     |++
T Consensus       202 mvsS~wg~p~~~~~g~~~~~~~~-~~~d~V~v~D~~~~k~~~tI~vg~~g~~P~~i~f~~~Pdg~~aYV~~e~~~~~Lss  280 (462)
T 2ece_A          202 LVSSEWAVPNTIEDGLKLEHLKD-RYGNRIHFWDLRKRKRIHSLTLGEENRMALELRPLHDPTKLMGFINMVVSLKDLSS  280 (462)
T ss_dssp             EEECBCCCHHHHTTCCCTTTHHH-HSCCEEEEEETTTTEEEEEEESCTTEEEEEEEEECSSTTCCEEEEEEEEETTTCCE
T ss_pred             EEEccCcCccccccccchhhhhh-ccCCEEEEEECCCCcEeeEEecCCCCCccceeEeeECCCCCEEEEEEeeeccCCCc
Confidence            89999999999999999999988 999999999999999999999986789999999999999999999999     999


Q ss_pred             cEEEEEeCCCCCeeEEEEEEecCccccccccCCC-------CCceeEEEEcCCCCEEEEEeCCCCcEEEEEecCCCCCeE
Q 023927           76 TMVRFSKTQDGSWNHEVAISVKSLKVQNWILPEM-------PGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVL  148 (275)
Q Consensus        76 tV~~~~~~~~G~~~~~~vi~i~~~~~~g~~~~~~-------~~~~adI~iSpDgrfLYVSNrg~~sIavfdI~~~~~~~l  148 (275)
                      +|+++++++ |.|+++|+|.+++.++.+ .++++       ++.|++|+||+||||||||||+||+|+||||++++++++
T Consensus       281 ~V~v~~~d~-g~~~~~~vIdi~~~~v~~-~lp~~~~~f~~~~~~pa~I~lS~DGrfLYVSnrg~d~VavfdV~d~~~~~l  358 (462)
T 2ece_A          281 SIWLWFYED-GKWNAEKVIEIPAEPLEG-NLPEILKPFKAVPPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVL  358 (462)
T ss_dssp             EEEEEEEET-TEEEEEEEEEECCEECCS-SCCGGGGGGTEECCCCCCEEECTTSCEEEEEETTTTEEEEEECSSTTSCEE
T ss_pred             eEEEEEecC-CceeEEEEEeCCCccccc-cccccccccccCCCceeEEEECCCCCEEEEEeCCCCEEEEEEecCCCCcEE
Confidence            999999975 999999999988766554 33322       378999999999999999999999999999988889999


Q ss_pred             EEEEEecceeecCCceeeecCCCCCCCCCCccccCcccCCCCceEEECCCCCEEEEEeCCCCCcccccccccccCCcEEE
Q 023927          149 TGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHML  228 (275)
Q Consensus       149 v~~v~~gG~~~~~~~~~v~~~~~~~~~~~~~~~~G~~~~g~Pr~~~LSpDGk~LyVANsl~~~wd~Q~yp~~~~~~~~~~  228 (275)
                      +++|++||++.+               +.  .++|+++.|+||+|+||||||||||||+|||+||+||||+  +++++|+
T Consensus       359 v~~I~tGG~~~~---------------~~--~~~G~~~~ggPr~~~lSpDGk~LyVaNsl~~~wd~Qfyp~--~~~~~~~  419 (462)
T 2ece_A          359 TGKVKLGGIFHR---------------AD--HPAGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFYPE--GLKGWMV  419 (462)
T ss_dssp             EEEEECBTTTTC---------------BC--CTTSCCCCSCCCCEEECTTSSEEEEECCCCHHHHHHHSTT--CCCCEEE
T ss_pred             EEEEEeCCeecc---------------cc--ccccccCCCCCCEEEEcCCCCEEEEEcCCcccccccccCC--CCceEEE
Confidence            999999997633               21  2378888899999999999999999999999999999999  7899999


Q ss_pred             EEEeeCCCCCeeeccceeEecCCCCCCCcceeeeecCCCCcCccccC
Q 023927          229 QIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI  275 (275)
Q Consensus       229 ~~d~d~~~G~l~~~~~f~vdf~~~~~g~~~~h~~r~~ggd~~sd~~~  275 (275)
                      ++|+|+++| |+++++|+|||++     +|||||||||||||||||+
T Consensus       420 ~~~vd~~~G-L~~~~~f~vdf~~-----~~~h~~r~~ggd~~sd~~~  460 (462)
T 2ece_A          420 KLNANPSGG-LEIDKEFFVDFGE-----ARSHQVRLSGGDASSDSYC  460 (462)
T ss_dssp             EEEECTTSC-EEEEEEEEEECTT-----SEEEEEEETTCCTTTCCCS
T ss_pred             EEEecCCCC-ceeCCCEEeeccc-----CcceeeecCCCCcCccccc
Confidence            999999999 9999999999988     7999999999999999996

PyMOL of 2ece

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor}	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A*	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A*	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A*	Back alignment and structure

>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ...	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		275
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	99.88
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.77
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.59
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.55
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.52
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.5
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	99.47
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.39
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.32
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.29
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.23
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.22
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.11
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.09
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.07
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	99.06
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.06
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.04
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.04
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	98.92
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	98.87
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	98.8
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	98.74
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.69
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.67
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	98.65
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	98.63
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	98.57
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.52
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	98.42
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.41
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	98.35
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.35
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	98.32
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	98.3
d1tbga_		340	beta1-subunit of the signal-transducing G protein	98.29
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.28
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	98.25
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	98.24
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.22
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	98.19
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	98.18
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	98.15
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.14
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	98.12
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	98.0
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	97.95
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	97.86
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	97.82
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	97.76
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	97.76
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	97.67
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	97.64
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	97.48
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	97.48
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	97.44
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	97.37
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	97.23
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	97.13
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	97.02
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	97.01
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	96.94
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	96.89
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	96.87
d1tbga_		340	beta1-subunit of the signal-transducing G protein	96.83
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	96.44
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	95.68
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	95.52
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	95.52
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	95.31
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	95.05
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	95.04
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	94.88
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	94.6
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	94.35
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	94.29
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	93.98
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	93.72
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	93.5
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	92.92
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	92.41
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	91.81
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	91.76
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	86.93
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	81.81

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: 3-carboxy-cis,cis-mucoante lactonizing enzyme
family: 3-carboxy-cis,cis-mucoante lactonizing enzyme
domain: 3-carboxy-cis,cis-mucoante lactonizing enzyme
species: Neurospora crassa [TaxId: 5141]

Probab=99.88  E-value=1.3e-21  Score=179.74  Aligned_cols=172  Identities=9%  Similarity=0.101  Sum_probs=115.9

Q ss_pred             cCCccCCeEEEEECCCC-Cee--EEEECCCCCccceEEEEEeCCCCCEEEEeeccCCcEEEEEeCCCCC--eeEEEEEEe
Q 023927           22 SDGLYGRHLFVYSWPDG-ELK--QTLDLGNTGLIPLEIRFLHDPSKDIGFVGCALASTMVRFSKTQDGS--WNHEVAISV   96 (275)
Q Consensus        22 ~~g~~~d~I~v~d~~~~-k~~--~~i~Lg~~G~gP~~v~f~f~P~g~~~YV~~eL~stV~~~~~~~~G~--~~~~~vi~i   96 (275)
                      +.+...++|++|+++.. ++.  ..+.....|.+|||++|  ||+++++||++|++++|.+|.++....  +...+.+.+
T Consensus       161 v~d~g~d~v~~~~~~~~g~~~~~~~~~~~~~g~gPr~i~f--~pdg~~~yv~~e~~~~V~v~~~~~~~~~~~~~~~~~~~  238 (365)
T d1jofa_         161 SADLTANKLWTHRKLASGEVELVGSVDAPDPGDHPRWVAM--HPTGNYLYALMEAGNRICEYVIDPATHMPVYTHHSFPL  238 (365)
T ss_dssp             EEETTTTEEEEEEECTTSCEEEEEEEECSSTTCCEEEEEE--CTTSSEEEEEETTTTEEEEEEECTTTCCEEEEEEEEES
T ss_pred             EeeCCCCEEEEEEccCCCceeeccceeecCCCCceEEEEE--CCCCceEEEeccCCCEEEEEEecCCCceEEEEeeeecc
Confidence            44566789999987764 333  24455557899999987  999999999999999999999864322  233344444


Q ss_pred             cCcccccc--ccCCCCCceeEEEEcCCCCEEEEEeCCCCc-----EEEEEecCCCCCeEEEEEEecceeecCCceeeecC
Q 023927           97 KSLKVQNW--ILPEMPGLITDFLISLDDRFLYFSNWLHGD-----IRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTD  169 (275)
Q Consensus        97 ~~~~~~g~--~~~~~~~~~adI~iSpDgrfLYVSNrg~~s-----IavfdI~~~~~~~lv~~v~~gG~~~~~~~~~v~~~  169 (275)
                      .+......  ....-...+++|++||||||||||||++++     |+.|++...+.  +...... ...           
T Consensus       239 ~~~~~~~~~~~~~~~~~~~~~i~~spdG~~lyvsnr~~~~~~~~~i~~~~~~~~g~--~~~~~~~-~~~-----------  304 (365)
T d1jofa_         239 IPPGIPDRDPETGKGLYRADVCALTFSGKYMFASSRANKFELQGYIAGFKLRDCGS--IEKQLFL-SPT-----------  304 (365)
T ss_dssp             SCTTCCCBCTTTSSBSEEEEEEEECTTSSEEEEEEEESSTTSCCEEEEEEECTTSC--EEEEEEE-EEC-----------
T ss_pred             ccccccccccccccccCCccceEECCCCCEEEEEcccCCCccceEEEEEEecCCCc--eeeEeEe-eEE-----------
Confidence            33211110  000122468899999999999999999887     99999965432  2211111 110           


Q ss_pred             CCCCCCCCCccccCcccCCCCceEEECC-CCCEEEEEeCCCCCcccccccccccCCcEEEEEEeeCCCCC
Q 023927          170 DGQPYQSDVPEVQGHRLRGGPQMIQLSL-DGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGG  238 (275)
Q Consensus       170 ~~~~~~~~~~~~~G~~~~g~Pr~~~LSp-DGk~LyVANsl~~~wd~Q~yp~~~~~~~~~~~~d~d~~~G~  238 (275)
                                ...|++    ||.|+++| ||+||||||        |.     ++...++++  |.++++
T Consensus       305 ----------~~~G~~----p~~i~~~p~~G~~l~va~--------~~-----s~~v~v~~~--~~~~l~  345 (365)
T d1jofa_         305 ----------PTSGGH----SNAVSPCPWSDEWMAITD--------DQ-----EGWLEIYRW--KDEFLH  345 (365)
T ss_dssp             ----------SSCCTT----CCCEEECTTCTTEEEEEC--------SS-----SCEEEEEEE--ETTEEE
T ss_pred             ----------EcCCCC----ccEEEecCCCCCEEEEEe--------CC-----CCeEEEEEE--eCCcCc
Confidence                      113666    99999998 899999999        75     555566655  555443

PyMOL of d1jofa_

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure