Citrus Sinensis ID: 024009
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 274 | ||||||
| 255561818 | 425 | conserved hypothetical protein [Ricinus | 1.0 | 0.644 | 0.890 | 1e-145 | |
| 225443351 | 426 | PREDICTED: kelch repeat-containing prote | 0.992 | 0.638 | 0.886 | 1e-144 | |
| 12325370 | 1036 | unknown protein; 27363-23366 [Arabidopsi | 0.996 | 0.263 | 0.864 | 1e-143 | |
| 224113255 | 424 | predicted protein [Populus trichocarpa] | 1.0 | 0.646 | 0.875 | 1e-143 | |
| 224097430 | 424 | predicted protein [Populus trichocarpa] | 1.0 | 0.646 | 0.875 | 1e-143 | |
| 145336621 | 415 | kelch-like motif-containing protein [Ara | 0.996 | 0.657 | 0.864 | 1e-141 | |
| 356526296 | 410 | PREDICTED: kelch repeat-containing prote | 0.996 | 0.665 | 0.871 | 1e-141 | |
| 297830804 | 409 | hypothetical protein ARALYDRAFT_318850 [ | 0.996 | 0.667 | 0.864 | 1e-141 | |
| 296090252 | 431 | unnamed protein product [Vitis vinifera] | 0.901 | 0.573 | 0.845 | 1e-140 | |
| 225452169 | 423 | PREDICTED: kelch repeat-containing prote | 0.894 | 0.579 | 0.848 | 1e-139 |
| >gi|255561818|ref|XP_002521918.1| conserved hypothetical protein [Ricinus communis] gi|223538843|gb|EEF40442.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 519 bits (1337), Expect = e-145, Method: Compositional matrix adjust.
Identities = 244/274 (89%), Positives = 262/274 (95%)
Query: 1 MPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAP 60
MP+EMAHSHLGMVTDGRYIYVV+GQYGPQCRGPTAHTFVLDTETK+WQD+PPLPVPRYAP
Sbjct: 152 MPKEMAHSHLGMVTDGRYIYVVSGQYGPQCRGPTAHTFVLDTETKQWQDMPPLPVPRYAP 211
Query: 61 ATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVD 120
ATQLWRGRLHVMGGS ENR+TP ++HWSLAVKDGK LEKEWRTEIPIPRGGPHRACVVV+
Sbjct: 212 ATQLWRGRLHVMGGSKENRHTPGLEHWSLAVKDGKALEKEWRTEIPIPRGGPHRACVVVN 271
Query: 121 DRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFA 180
D+L+VIGGQEGDFMAKPGSPIFKCSRRNEVVY DVYMLDD+MKWKVLPSMPKPDSHIEFA
Sbjct: 272 DQLIVIGGQEGDFMAKPGSPIFKCSRRNEVVYGDVYMLDDDMKWKVLPSMPKPDSHIEFA 331
Query: 181 WVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNG 240
WVLVNNSIVIVGGTT+KHP TKKM+L GE+FQFNL+ KW VIGKLPYRVKTTL G+WNG
Sbjct: 332 WVLVNNSIVIVGGTTDKHPVTKKMILNGEVFQFNLDNTKWSVIGKLPYRVKTTLVGFWNG 391
Query: 241 WLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLNS 274
WLYFTSGQRD+GPDDPAPRKV G+MWRTKL LNS
Sbjct: 392 WLYFTSGQRDRGPDDPAPRKVLGEMWRTKLKLNS 425
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225443351|ref|XP_002265018.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] gi|297735771|emb|CBI18458.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|12325370|gb|AAG52629.1|AC024261_16 unknown protein; 27363-23366 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224113255|ref|XP_002316438.1| predicted protein [Populus trichocarpa] gi|222865478|gb|EEF02609.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224097430|ref|XP_002310931.1| predicted protein [Populus trichocarpa] gi|222850751|gb|EEE88298.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|145336621|ref|NP_175565.2| kelch-like motif-containing protein [Arabidopsis thaliana] gi|28416695|gb|AAO42878.1| At1g51540 [Arabidopsis thaliana] gi|110743235|dbj|BAE99508.1| At1g51540 [Arabidopsis thaliana] gi|332194560|gb|AEE32681.1| kelch-like motif-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356526296|ref|XP_003531754.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297830804|ref|XP_002883284.1| hypothetical protein ARALYDRAFT_318850 [Arabidopsis lyrata subsp. lyrata] gi|297329124|gb|EFH59543.1| hypothetical protein ARALYDRAFT_318850 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|296090252|emb|CBI40071.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225452169|ref|XP_002270625.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 274 | ||||||
| TAIR|locus:2033944 | 415 | AT1G51540 [Arabidopsis thalian | 0.996 | 0.657 | 0.864 | 3.7e-135 | |
| TAIR|locus:2086528 | 426 | AT3G27220 "AT3G27220" [Arabido | 0.978 | 0.629 | 0.739 | 1e-114 | |
| UNIPROTKB|G4N9D1 | 338 | MGG_10013 "Uncharacterized pro | 0.813 | 0.659 | 0.256 | 1.3e-07 | |
| MGI|MGI:3045305 | 634 | Klhl31 "kelch-like 31" [Mus mu | 0.525 | 0.227 | 0.331 | 7.5e-06 | |
| TAIR|locus:2177542 | 666 | AT5G50310 [Arabidopsis thalian | 0.620 | 0.255 | 0.231 | 8e-06 | |
| RGD|1359445 | 354 | Klhdc8b "kelch domain containi | 0.605 | 0.468 | 0.253 | 6.9e-05 | |
| RGD|1565441 | 717 | Klhl4 "kelch-like family membe | 0.401 | 0.153 | 0.314 | 0.00034 | |
| MGI|MGI:1925517 | 354 | Klhdc8b "kelch domain containi | 0.605 | 0.468 | 0.253 | 0.00044 | |
| UNIPROTKB|Q6DFF6 | 604 | klhl20 "Kelch-like protein 20" | 0.434 | 0.197 | 0.248 | 0.00045 | |
| UNIPROTKB|F1NMM8 | 609 | KLHL20 "Kelch-like protein 20" | 0.434 | 0.195 | 0.248 | 0.00046 |
| TAIR|locus:2033944 AT1G51540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1324 (471.1 bits), Expect = 3.7e-135, P = 3.7e-135
Identities = 236/273 (86%), Positives = 255/273 (93%)
Query: 1 MPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAP 60
MP++MAHSHLGMVTDGRYIY+VTGQ+GPQCRGPTA TFVLDT+T W+D PLPVPRYAP
Sbjct: 142 MPKDMAHSHLGMVTDGRYIYIVTGQFGPQCRGPTAKTFVLDTDTNTWKDFVPLPVPRYAP 201
Query: 61 ATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVD 120
ATQLWRGRLHVMGGS ENR+TP ++HWS+AVKDGK LE EWR+EIPIPRGGPHRACVVVD
Sbjct: 202 ATQLWRGRLHVMGGSKENRFTPGLEHWSIAVKDGKSLENEWRSEIPIPRGGPHRACVVVD 261
Query: 121 DRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFA 180
DRL VIGGQEGDFMAKPGSPIFKCSRR EVV+ DVYMLD+EMKWKV+P MPKPDSHIEFA
Sbjct: 262 DRLFVIGGQEGDFMAKPGSPIFKCSRRMEVVFSDVYMLDEEMKWKVMPPMPKPDSHIEFA 321
Query: 181 WVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNG 240
W +VNNSIVIVGGTTEKHP TKKMVLVGEIFQFNLNTLKW+VIGKLPYRVKTTLAGYW+G
Sbjct: 322 WKVVNNSIVIVGGTTEKHPETKKMVLVGEIFQFNLNTLKWYVIGKLPYRVKTTLAGYWDG 381
Query: 241 WLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLN 273
LYFTSGQRDKGPDDPAPRKV +MWRTKL+LN
Sbjct: 382 QLYFTSGQRDKGPDDPAPRKVMAEMWRTKLILN 414
|
|
| TAIR|locus:2086528 AT3G27220 "AT3G27220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N9D1 MGG_10013 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3045305 Klhl31 "kelch-like 31" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177542 AT5G50310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|1359445 Klhdc8b "kelch domain containing 8B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1565441 Klhl4 "kelch-like family member 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1925517 Klhdc8b "kelch domain containing 8B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DFF6 klhl20 "Kelch-like protein 20" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NMM8 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00029590001 | SubName- Full=Chromosome chr9 scaffold_49, whole genome shotgun sequence; (418 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 274 | |||
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 2e-15 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 1e-09 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 5e-06 | |
| pfam13964 | 50 | pfam13964, Kelch_6, Kelch motif | 2e-05 | |
| TIGR03548 | 323 | TIGR03548, mutarot_permut, cyclically-permuted mut | 3e-05 | |
| smart00612 | 47 | smart00612, Kelch, Kelch domain | 2e-04 | |
| pfam13415 | 48 | pfam13415, Kelch_3, Galactose oxidase, central dom | 3e-04 | |
| pfam01344 | 46 | pfam01344, Kelch_1, Kelch motif | 4e-04 | |
| PHA02713 | 557 | PHA02713, PHA02713, hypothetical protein; Provisio | 0.001 | |
| pfam13418 | 49 | pfam13418, Kelch_4, Galactose oxidase, central dom | 0.002 |
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
Score = 75.6 bits (186), Expect = 2e-15
Identities = 52/188 (27%), Positives = 78/188 (41%), Gaps = 38/188 (20%)
Query: 41 DTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKE 100
DT+TK W +P L PR P ++ R++V+GG + V+ W KP E +
Sbjct: 317 DTKTKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSISLNTVESW-------KPGESK 369
Query: 101 WRTEIPI--PRGGPHRACVV-VDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYM 157
WR E P+ PR P CVV V++ + VIGG I K N+ + V
Sbjct: 370 WREEPPLIFPRYNP---CVVNVNNLIYVIGG------------ISK----NDELLKTVEC 410
Query: 158 LD-DEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTT-EKHPTTKKMVLVGEIFQFNL 215
+ KW P P SH + + I ++GG + + +V +N
Sbjct: 411 FSLNTNKWSKG--SPLPISHYGGCAIYHDGKIYVIGGISYIDNIKVYNIV-----ESYNP 463
Query: 216 NTLKWHVI 223
T KW +
Sbjct: 464 VTNKWTEL 471
|
Length = 534 |
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif | Back alignment and domain information |
|---|
| >gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|128874 smart00612, Kelch, Kelch domain | Back alignment and domain information |
|---|
| >gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif | Back alignment and domain information |
|---|
| >gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 274 | |||
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 100.0 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 100.0 | |
| PLN02153 | 341 | epithiospecifier protein | 100.0 | |
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 100.0 | |
| TIGR03548 | 323 | mutarot_permut cyclically-permuted mutatrotase fam | 100.0 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 100.0 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 100.0 | |
| PLN02193 | 470 | nitrile-specifier protein | 100.0 | |
| TIGR03547 | 346 | muta_rot_YjhT mutatrotase, YjhT family. Members of | 100.0 | |
| TIGR03547 | 346 | muta_rot_YjhT mutatrotase, YjhT family. Members of | 100.0 | |
| TIGR03548 | 323 | mutarot_permut cyclically-permuted mutatrotase fam | 100.0 | |
| KOG4693 | 392 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| PRK14131 | 376 | N-acetylneuraminic acid mutarotase; Provisional | 100.0 | |
| PLN02153 | 341 | epithiospecifier protein | 100.0 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 100.0 | |
| PLN02193 | 470 | nitrile-specifier protein | 100.0 | |
| KOG4693 | 392 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| PRK14131 | 376 | N-acetylneuraminic acid mutarotase; Provisional | 100.0 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 99.97 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.97 | |
| KOG1230 | 521 | consensus Protein containing repeated kelch motifs | 99.97 | |
| KOG0379 | 482 | consensus Kelch repeat-containing proteins [Genera | 99.97 | |
| KOG0379 | 482 | consensus Kelch repeat-containing proteins [Genera | 99.93 | |
| KOG4152 | 830 | consensus Host cell transcription factor HCFC1 [Ce | 99.92 | |
| KOG1230 | 521 | consensus Protein containing repeated kelch motifs | 99.9 | |
| KOG4152 | 830 | consensus Host cell transcription factor HCFC1 [Ce | 99.88 | |
| COG3055 | 381 | Uncharacterized protein conserved in bacteria [Fun | 99.86 | |
| COG3055 | 381 | Uncharacterized protein conserved in bacteria [Fun | 99.78 | |
| PF13964 | 50 | Kelch_6: Kelch motif | 99.46 | |
| KOG2437 | 723 | consensus Muskelin [Signal transduction mechanisms | 99.42 | |
| PF01344 | 47 | Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is | 99.2 | |
| PF13964 | 50 | Kelch_6: Kelch motif | 99.17 | |
| PF13415 | 49 | Kelch_3: Galactose oxidase, central domain | 99.16 | |
| PF07646 | 49 | Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is | 99.15 | |
| KOG2437 | 723 | consensus Muskelin [Signal transduction mechanisms | 99.14 | |
| PF13418 | 49 | Kelch_4: Galactose oxidase, central domain; PDB: 2 | 99.1 | |
| PF13415 | 49 | Kelch_3: Galactose oxidase, central domain | 99.02 | |
| PF01344 | 47 | Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is | 98.96 | |
| smart00612 | 47 | Kelch Kelch domain. | 98.91 | |
| PF13854 | 42 | Kelch_5: Kelch motif | 98.83 | |
| PF13418 | 49 | Kelch_4: Galactose oxidase, central domain; PDB: 2 | 98.78 | |
| smart00612 | 47 | Kelch Kelch domain. | 98.74 | |
| PF07646 | 49 | Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is | 98.68 | |
| PF07250 | 243 | Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP | 98.64 | |
| PLN02772 | 398 | guanylate kinase | 98.61 | |
| PF13854 | 42 | Kelch_5: Kelch motif | 98.44 | |
| PLN02772 | 398 | guanylate kinase | 98.27 | |
| PF03089 | 337 | RAG2: Recombination activating protein 2; InterPro | 98.21 | |
| PF07250 | 243 | Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP | 98.07 | |
| TIGR01640 | 230 | F_box_assoc_1 F-box protein interaction domain. Th | 97.84 | |
| PF07893 | 342 | DUF1668: Protein of unknown function (DUF1668); In | 97.77 | |
| PF03089 | 337 | RAG2: Recombination activating protein 2; InterPro | 97.62 | |
| TIGR01640 | 230 | F_box_assoc_1 F-box protein interaction domain. Th | 97.42 | |
| PF07893 | 342 | DUF1668: Protein of unknown function (DUF1668); In | 96.31 | |
| PF12768 | 281 | Rax2: Cortical protein marker for cell polarity | 96.15 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 95.71 | |
| PF12217 | 367 | End_beta_propel: Catalytic beta propeller domain o | 95.37 | |
| PF12768 | 281 | Rax2: Cortical protein marker for cell polarity | 95.32 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 95.1 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 94.74 | |
| cd00094 | 194 | HX Hemopexin-like repeats.; Hemopexin is a heme-bi | 93.3 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 93.13 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 93.12 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 92.57 | |
| PF03178 | 321 | CPSF_A: CPSF A subunit region; InterPro: IPR004871 | 92.54 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 92.4 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 92.38 | |
| PF09910 | 339 | DUF2139: Uncharacterized protein conserved in arch | 92.32 | |
| cd00094 | 194 | HX Hemopexin-like repeats.; Hemopexin is a heme-bi | 92.25 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 91.72 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 91.64 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 91.55 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 90.22 | |
| PF02191 | 250 | OLF: Olfactomedin-like domain; InterPro: IPR003112 | 89.8 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 89.78 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 88.65 | |
| PF09910 | 339 | DUF2139: Uncharacterized protein conserved in arch | 87.79 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 87.4 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 85.78 | |
| PF08268 | 129 | FBA_3: F-box associated domain; InterPro: IPR01318 | 85.32 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 85.29 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 84.86 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 83.12 | |
| COG1520 | 370 | FOG: WD40-like repeat [Function unknown] | 82.92 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 81.47 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 81.28 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 81.27 | |
| PF12217 | 367 | End_beta_propel: Catalytic beta propeller domain o | 80.75 | |
| smart00284 | 255 | OLF Olfactomedin-like domains. | 80.07 |
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-41 Score=302.01 Aligned_cols=237 Identities=19% Similarity=0.350 Sum_probs=215.1
Q ss_pred CCCCCcCceeeEEeCCEEEEEcCcCCCCCCCCCCeeEEEECCCCCeeeCCCCCCCCCCceEEEECCeEEEEcCCCCCCCC
Q 024009 2 PREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYT 81 (274)
Q Consensus 2 p~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~ 81 (274)
|+|.+|.++++++++++||++||.++ ....++++++||+.+++|..+++|+.+|..+++++++|.||++||.++..+.
T Consensus 318 ~m~~~r~~~~~~~~~~~lYv~GG~~~--~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~l 395 (571)
T KOG4441|consen 318 PMPSPRCRVGVAVLNGKLYVVGGYDS--GSDRLSSVERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKSL 395 (571)
T ss_pred CCCcccccccEEEECCEEEEEccccC--CCcccceEEEecCCCCceeccCCccCccccceeEEECCEEEEEecccccccc
Confidence 67899999999999999999999985 1246899999999999999999999999999999999999999999988888
Q ss_pred CCccceEeeeecCCCCCCceeeccCCCCCCCcceeEEeCCEEEEEccCCCCCCCCCCCCccccccCceeecCceEEeC-C
Q 024009 82 PEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLD-D 160 (274)
Q Consensus 82 ~~~~~~~~~~~~~d~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d-~ 160 (274)
.++|+|+ |.+++|..+++|+.+|.++++++++++||++||.+... ..++.++.|| .
T Consensus 396 ~svE~YD-------p~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~----------------~~l~sve~YDP~ 452 (571)
T KOG4441|consen 396 NSVECYD-------PVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSS----------------NCLNSVECYDPE 452 (571)
T ss_pred ccEEEec-------CCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCc----------------cccceEEEEcCC
Confidence 8888876 89999999999999999999999999999999987652 1468899999 9
Q ss_pred CCCeEecCCCCCCCccceeeEEEeCCEEEEEeccCCCCCCcccccccCceEEEEcCCCceEEeccCCCccceeeeEEEcC
Q 024009 161 EMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNG 240 (274)
Q Consensus 161 ~~~W~~~~~~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~i~~yd~~~~~W~~~~~~p~~~~~~~~~~~~~ 240 (274)
+++|+.+++|+.+|.+ +++++.+++||++||..... .+..+++|||.+++|+.+++|+.+|..++++.+++
T Consensus 453 t~~W~~~~~M~~~R~~--~g~a~~~~~iYvvGG~~~~~-------~~~~VE~ydp~~~~W~~v~~m~~~rs~~g~~~~~~ 523 (571)
T KOG4441|consen 453 TNTWTLIAPMNTRRSG--FGVAVLNGKIYVVGGFDGTS-------ALSSVERYDPETNQWTMVAPMTSPRSAVGVVVLGG 523 (571)
T ss_pred CCceeecCCccccccc--ceEEEECCEEEEECCccCCC-------ccceEEEEcCCCCceeEcccCccccccccEEEECC
Confidence 9999999999999999 45799999999999998833 35579999999999999999999999999999999
Q ss_pred EEEEEccccCCC-CCCCCceeecCCeeeeeecc
Q 024009 241 WLYFTSGQRDKG-PDDPAPRKVHGDMWRTKLLL 272 (274)
Q Consensus 241 ~l~~~GG~~~~~-~~~~~~~~~~~~~W~~~~~~ 272 (274)
+||++||..+.. ..+.++|++.+|.|+...++
T Consensus 524 ~ly~vGG~~~~~~l~~ve~ydp~~d~W~~~~~~ 556 (571)
T KOG4441|consen 524 KLYAVGGFDGNNNLNTVECYDPETDTWTEVTEP 556 (571)
T ss_pred EEEEEecccCccccceeEEcCCCCCceeeCCCc
Confidence 999999988766 66778999999999987763
|
|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02153 epithiospecifier protein | Back alignment and domain information |
|---|
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02193 nitrile-specifier protein | Back alignment and domain information |
|---|
| >TIGR03547 muta_rot_YjhT mutatrotase, YjhT family | Back alignment and domain information |
|---|
| >TIGR03547 muta_rot_YjhT mutatrotase, YjhT family | Back alignment and domain information |
|---|
| >TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein | Back alignment and domain information |
|---|
| >KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14131 N-acetylneuraminic acid mutarotase; Provisional | Back alignment and domain information |
|---|
| >PLN02153 epithiospecifier protein | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02193 nitrile-specifier protein | Back alignment and domain information |
|---|
| >KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14131 N-acetylneuraminic acid mutarotase; Provisional | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >COG3055 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3055 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13964 Kelch_6: Kelch motif | Back alignment and domain information |
|---|
| >KOG2437 consensus Muskelin [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >PF13964 Kelch_6: Kelch motif | Back alignment and domain information |
|---|
| >PF13415 Kelch_3: Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >KOG2437 consensus Muskelin [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B | Back alignment and domain information |
|---|
| >PF13415 Kelch_3: Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >smart00612 Kelch Kelch domain | Back alignment and domain information |
|---|
| >PF13854 Kelch_5: Kelch motif | Back alignment and domain information |
|---|
| >PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B | Back alignment and domain information |
|---|
| >smart00612 Kelch Kelch domain | Back alignment and domain information |
|---|
| >PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PF13854 Kelch_5: Kelch motif | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination | Back alignment and domain information |
|---|
| >PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes | Back alignment and domain information |
|---|
| >TIGR01640 F_box_assoc_1 F-box protein interaction domain | Back alignment and domain information |
|---|
| >PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function | Back alignment and domain information |
|---|
| >PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination | Back alignment and domain information |
|---|
| >TIGR01640 F_box_assoc_1 F-box protein interaction domain | Back alignment and domain information |
|---|
| >PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function | Back alignment and domain information |
|---|
| >PF12768 Rax2: Cortical protein marker for cell polarity | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes | Back alignment and domain information |
|---|
| >PF12768 Rax2: Cortical protein marker for cell polarity | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00094 HX Hemopexin-like repeats | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >cd00094 HX Hemopexin-like repeats | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >COG1520 FOG: WD40-like repeat [Function unknown] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes | Back alignment and domain information |
|---|
| >smart00284 OLF Olfactomedin-like domains | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 274 | ||||
| 2woz_A | 318 | The Novel Beta-Propeller Of The Btb-Kelch Protein K | 2e-06 | ||
| 3ii7_A | 306 | Crystal Structure Of The Kelch Domain Of Human Klhl | 1e-04 |
| >pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 | Back alignment and structure |
|
| >pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 274 | |||
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 7e-29 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 3e-18 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 5e-15 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 2e-13 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 7e-21 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 3e-16 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 4e-05 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 4e-20 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 2e-16 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 6e-10 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 5e-20 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 7e-18 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 3e-13 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 6e-11 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 3e-19 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 2e-18 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 2e-10 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 2e-08 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 4e-19 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 2e-18 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 3e-11 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 3e-11 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 2e-18 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 1e-15 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 2e-12 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 3e-15 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 5e-05 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 6e-04 |
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 | Back alignment and structure |
|---|
Score = 111 bits (279), Expect = 7e-29
Identities = 56/293 (19%), Positives = 90/293 (30%), Gaps = 55/293 (18%)
Query: 1 MPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHT--FVLDTETKKWQDL-PPLPVPR 57
P DG +YV G + +T W L P+
Sbjct: 51 FPGGPRDQATSAFIDGN-LYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKLMSHAPMGM 109
Query: 58 YAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEK------------------ 99
T + G+ +V GG +N + + + A KD ++K
Sbjct: 110 AGHVTFVHNGKAYVTGGVNQNIFNGYFEDLNEAGKDSTAIDKINAHYFDKKAEDYFFNKF 169
Query: 100 ---------EWRTEIPIPRGGPHRACVVV-DDRLLVIGGQEGDFMAKPGSPIFKCSRRNE 149
+W P G A VV D+ +I G+ AKPG R +
Sbjct: 170 LLSFDPSTQQWSYAGESPWYGTAGAAVVNKGDKTWLINGE-----AKPG------LRTDA 218
Query: 150 VVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVG-----GTTEKHPTTKKM 204
V ++ + +KW L + PD + N+S++ G G+ E + K
Sbjct: 219 V--FELDFTGNNLKWNKLAPVSSPDGVAGGFAGISNDSLIFAGGAGFKGSRENYQNGKNY 276
Query: 205 VLVGEIFQ-----FNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKG 252
G + KW G+L ++ WN L G+ G
Sbjct: 277 AHEGLKKSYSTDIHLWHNGKWDKSGELSQGRAYGVSLPWNNSLLIIGGETAGG 329
|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 274 | |||
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 100.0 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 100.0 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 100.0 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 100.0 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 100.0 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 100.0 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 100.0 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 100.0 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 100.0 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 100.0 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 100.0 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 100.0 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 100.0 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 100.0 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 100.0 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 100.0 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 99.96 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 99.96 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 98.11 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 97.84 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 97.54 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 97.44 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.29 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 97.1 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 96.83 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 96.39 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 96.28 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 96.1 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 95.85 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 95.24 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 95.19 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 95.18 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 95.06 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 94.98 | |
| 1qhu_A | 460 | Protein (hemopexin); beta propeller, HAEM binding | 94.83 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 94.81 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 94.77 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 94.68 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 94.41 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 94.31 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 94.01 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 93.99 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 93.89 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 93.38 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 93.37 | |
| 3ju4_A | 670 | Endo-N-acetylneuraminidase; endonf, polysia, high- | 93.27 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 93.18 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 92.97 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 92.94 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 92.92 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 92.72 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 92.6 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 92.58 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 92.04 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 91.93 | |
| 1pex_A | 207 | Collagenase-3, MMP-13; C-terminal hemopexin-like d | 91.89 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 91.8 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 91.12 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 90.89 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 90.86 | |
| 1pex_A | 207 | Collagenase-3, MMP-13; C-terminal hemopexin-like d | 90.78 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 90.68 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 90.66 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 90.63 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 90.62 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 90.54 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 90.45 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 90.32 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 89.82 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 89.8 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 89.78 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 89.77 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 89.76 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 89.61 | |
| 3c7x_A | 196 | Matrix metalloproteinase-14; membrane protein inte | 89.21 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 89.17 | |
| 1qhu_A | 460 | Protein (hemopexin); beta propeller, HAEM binding | 88.72 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 88.67 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 88.63 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 88.3 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 88.29 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 88.19 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 87.96 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 87.66 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 87.62 | |
| 3oyo_A | 225 | Hemopexin fold protein CP4; seeds, plant protein; | 87.42 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 87.39 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 87.12 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 86.98 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 86.91 | |
| 1itv_A | 195 | MMP9; adaptive molecular recognition, beta propell | 86.77 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 86.59 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 86.38 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 86.3 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 86.3 | |
| 1hxn_A | 219 | Hemopexin, HPX; heme, binding protein; 1.80A {Oryc | 86.22 | |
| 1su3_A | 450 | Interstitial collagenase; prodomain, hemopexin dom | 86.2 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 85.93 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 85.84 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 85.28 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 85.03 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 85.01 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 84.81 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 84.54 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 84.53 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 83.68 | |
| 3ju4_A | 670 | Endo-N-acetylneuraminidase; endonf, polysia, high- | 83.64 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 83.48 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 83.28 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 82.97 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 82.89 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 82.83 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 82.82 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 82.73 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 82.41 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 82.36 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 82.01 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 81.79 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 81.65 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 81.1 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 80.91 | |
| 3lp9_A | 227 | LS-24; SEED albumin, plant protein; HET: SPM; 2.20 | 80.77 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 80.69 | |
| 1gen_A | 218 | Gelatinase A; hydrolase, hemopexin domain, metallo | 80.67 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 80.32 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 80.13 |
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-41 Score=282.41 Aligned_cols=235 Identities=17% Similarity=0.227 Sum_probs=202.8
Q ss_pred CCCCCcCceeeEEeCCEEEEEcCcCCCCCCCCCCeeEEEECCCCCeeeCCCCCCCCCCceEEEECCeEEEEcCCCCCCCC
Q 024009 2 PREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYT 81 (274)
Q Consensus 2 p~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~ 81 (274)
++|.+|.+|++++++++||++||..+. ..++++++||+.+++|+.++++|.+|..|+++.++++||++||.......
T Consensus 47 ~~p~~r~~~~~~~~~~~lyv~GG~~~~---~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~ 123 (302)
T 2xn4_A 47 ELPSRRCRAGMVYMAGLVFAVGGFNGS---LRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGL 123 (302)
T ss_dssp CCSSCCBSCEEEEETTEEEEESCBCSS---SBCCCEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEEEEECSSCEE
T ss_pred cCCcccccceEEEECCEEEEEeCcCCC---ccccceEEECCCCCceeeCCCCCccccceEEEEECCEEEEEcCCCCCccC
Confidence 467899999999999999999998654 35689999999999999999999999999999999999999998654333
Q ss_pred CCccceEeeeecCCCCCCceeeccCCCCCCCcceeEEeCCEEEEEccCCCCCCCCCCCCccccccCceeecCceEEeC-C
Q 024009 82 PEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLD-D 160 (274)
Q Consensus 82 ~~~~~~~~~~~~~d~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d-~ 160 (274)
. +++.||+.+++|+.++++|.+|..|+++.++++||++||.... ....+++++.|| .
T Consensus 124 ~-------~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~---------------~~~~~~~~~~yd~~ 181 (302)
T 2xn4_A 124 S-------SVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVA---------------SRQCLSTVECYNAT 181 (302)
T ss_dssp E-------EEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECCEETT---------------TTEECCCEEEEETT
T ss_pred c-------eEEEEeCCCCeEeecCCCCCcccCceEEEECCEEEEEeCCCCC---------------CCccccEEEEEeCC
Confidence 3 3444458999999999999999999999999999999998644 113467899999 8
Q ss_pred CCCeEecCCCCCCCccceeeEEEeCCEEEEEeccCCCCCCcccccccCceEEEEcCCCceEEeccCCCccceeeeEEEcC
Q 024009 161 EMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNG 240 (274)
Q Consensus 161 ~~~W~~~~~~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~i~~yd~~~~~W~~~~~~p~~~~~~~~~~~~~ 240 (274)
+++|+.++++|.+|.. ++++..+++||++||..... ..+++++||+++++|+.+.++|.+|..++++.+++
T Consensus 182 ~~~W~~~~~~p~~r~~--~~~~~~~~~iyv~GG~~~~~-------~~~~~~~yd~~~~~W~~~~~~~~~r~~~~~~~~~~ 252 (302)
T 2xn4_A 182 TNEWTYIAEMSTRRSG--AGVGVLNNLLYAVGGHDGPL-------VRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNG 252 (302)
T ss_dssp TTEEEEECCCSSCCBS--CEEEEETTEEEEECCBSSSS-------BCCCEEEEETTTTEEEEECCCSSCCBSCEEEEETT
T ss_pred CCcEEECCCCcccccc--ccEEEECCEEEEECCCCCCc-------ccceEEEEeCCCCCEeeCCCCCCccccCeEEEECC
Confidence 9999999999999887 55688899999999986543 36699999999999999999999999999999999
Q ss_pred EEEEEccccCCC-CCCCCceeecCCeeeeee
Q 024009 241 WLYFTSGQRDKG-PDDPAPRKVHGDMWRTKL 270 (274)
Q Consensus 241 ~l~~~GG~~~~~-~~~~~~~~~~~~~W~~~~ 270 (274)
+||++||.+... ..+..+|++.++.|+...
T Consensus 253 ~i~v~GG~~~~~~~~~v~~yd~~~~~W~~~~ 283 (302)
T 2xn4_A 253 LLYVVGGDDGSCNLASVEYYNPTTDKWTVVS 283 (302)
T ss_dssp EEEEECCBCSSSBCCCEEEEETTTTEEEECS
T ss_pred EEEEECCcCCCcccccEEEEcCCCCeEEECC
Confidence 999999987654 456788999999998754
|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 | Back alignment and structure |
|---|
| >1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 274 | ||||
| d1zgka1 | 288 | b.68.11.1 (A:322-609) Kelch-like ECH-associated pr | 2e-06 | |
| d1zgka1 | 288 | b.68.11.1 (A:322-609) Kelch-like ECH-associated pr | 5e-04 | |
| d1k3ia3 | 387 | b.69.1.1 (A:151-537) Galactose oxidase, central do | 2e-05 | |
| d1k3ia3 | 387 | b.69.1.1 (A:151-537) Galactose oxidase, central do | 2e-04 | |
| d1k3ia3 | 387 | b.69.1.1 (A:151-537) Galactose oxidase, central do | 0.003 |
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: Kelch motif family: Kelch motif domain: Kelch-like ECH-associated protein 1, KEAP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 46.1 bits (107), Expect = 2e-06
Identities = 17/72 (23%), Positives = 25/72 (34%), Gaps = 4/72 (5%)
Query: 16 GRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGS 75
GR IY G + R ++ + W L L VPR A + G L+ +GG
Sbjct: 4 GRLIYTAGGYF----RQSLSYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGR 59
Query: 76 GENRYTPEVDHW 87
+
Sbjct: 60 NNSPDGNTDSSA 71
|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 274 | |||
| d1zgka1 | 288 | Kelch-like ECH-associated protein 1, KEAP1 {Human | 100.0 | |
| d1zgka1 | 288 | Kelch-like ECH-associated protein 1, KEAP1 {Human | 100.0 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 99.95 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 99.86 | |
| d1su3a2 | 195 | Collagenase (MMP1), C-terminal domain {Human (Homo | 94.14 | |
| d1pexa_ | 192 | Collagenase-3 (MMP-13), C-terminal domain {Human ( | 93.87 | |
| d1pexa_ | 192 | Collagenase-3 (MMP-13), C-terminal domain {Human ( | 93.85 | |
| d1itva_ | 195 | Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: | 93.71 | |
| d1su3a2 | 195 | Collagenase (MMP1), C-terminal domain {Human (Homo | 93.39 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 93.12 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 92.8 | |
| d1qhua1 | 192 | Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: | 91.79 | |
| d1hxna_ | 210 | Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: | 91.65 | |
| d1qhua1 | 192 | Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: | 89.64 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 89.44 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 89.03 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 88.37 | |
| d1gena_ | 200 | Gelatinase A (MMP-2), C-terminal domain {Human (Ho | 88.06 | |
| d1v0ea1 | 516 | Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 | 87.81 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 87.77 | |
| d1gena_ | 200 | Gelatinase A (MMP-2), C-terminal domain {Human (Ho | 86.33 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 85.95 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 85.92 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 84.18 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 82.79 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 80.78 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 80.05 |
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: Kelch motif family: Kelch motif domain: Kelch-like ECH-associated protein 1, KEAP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.5e-35 Score=244.12 Aligned_cols=239 Identities=18% Similarity=0.314 Sum_probs=205.1
Q ss_pred CCCCCcCceeeEEeCCEEEEEcCcCCCC-CCCCCCeeEEEECCCCCeeeCCCCCCCCCCceEEEECCeEEEEcCCCCCCC
Q 024009 2 PREMAHSHLGMVTDGRYIYVVTGQYGPQ-CRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRY 80 (274)
Q Consensus 2 p~~~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~~~~~d~~~~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~ 80 (274)
|+|.+|.+|+++.++++|||+||..... .....+++++||+.+++|+.++++|.+|..|+++.++++||++||......
T Consensus 36 ~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~~~ 115 (288)
T d1zgka1 36 DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIH 115 (288)
T ss_dssp CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETTEE
T ss_pred CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccceecceeccccceeeEEecceecccc
Confidence 5788999999999999999999985321 123568999999999999999999999999999999999999999876655
Q ss_pred CCCccceEeeeecCCCCCCceeeccCCCCCCCcceeEEeCCEEEEEccCCCCCCCCCCCCccccccCceeecCceEEeC-
Q 024009 81 TPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLD- 159 (274)
Q Consensus 81 ~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d- 159 (274)
....+.++ +.+++|...+.++..+.+++++..++++|++||..... ...+++.||
T Consensus 116 ~~~~~~~~-------~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~-----------------~~~~~~~~d~ 171 (288)
T d1zgka1 116 HNSVERYE-------PERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTN-----------------RLNSAECYYP 171 (288)
T ss_dssp CCCEEEEE-------TTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSC-----------------BCCCEEEEET
T ss_pred cceeeeec-------cccCccccccccccccccceeeeeeecceEecCccccc-----------------ccceEEEeec
Confidence 55555554 78999999999999999999999999999999976441 246788998
Q ss_pred CCCCeEecCCCCCCCccceeeEEEeCCEEEEEeccCCCCCCcccccccCceEEEEcCCCceEEeccCCCccceeeeEEEc
Q 024009 160 DEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWN 239 (274)
Q Consensus 160 ~~~~W~~~~~~~~~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~~~~i~~yd~~~~~W~~~~~~p~~~~~~~~~~~~ 239 (274)
.+++|...+..+..+.. ++++..+++|+++||..... .++..+.||+.+++|+.++++|.+|..++++.++
T Consensus 172 ~~~~~~~~~~~~~~~~~--~~~~~~~~~i~i~GG~~~~~-------~~~~~~~~~~~~~~~~~~~~~p~~r~~~~~~~~~ 242 (288)
T d1zgka1 172 ERNEWRMITAMNTIRSG--AGVCVLHNCIYAAGGYDGQD-------QLNSVERYDVETETWTFVAPMKHRRSALGITVHQ 242 (288)
T ss_dssp TTTEEEECCCCSSCCBS--CEEEEETTEEEEECCBCSSS-------BCCCEEEEETTTTEEEECCCCSSCCBSCEEEEET
T ss_pred ccccccccccccccccc--ccccceeeeEEEecCccccc-------cccceeeeeecceeeecccCccCcccceEEEEEC
Confidence 89999999988888876 56689999999999987655 3668999999999999999999999999999999
Q ss_pred CEEEEEccccCCC-CCCCCceeecCCeeeeeeccC
Q 024009 240 GWLYFTSGQRDKG-PDDPAPRKVHGDMWRTKLLLN 273 (274)
Q Consensus 240 ~~l~~~GG~~~~~-~~~~~~~~~~~~~W~~~~~~~ 273 (274)
++|||+||.+... ..+..+|++.++.|+...+|.
T Consensus 243 ~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p 277 (288)
T d1zgka1 243 GRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMT 277 (288)
T ss_dssp TEEEEECCBCSSCBCCEEEEEETTTTEEEEEEECS
T ss_pred CEEEEEecCCCCeecceEEEEECCCCEEEECCCCC
Confidence 9999999987655 344578999999999987764
|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|