Citrus Sinensis ID: 024115

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--

MIFSSRACKLLHVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYRPPKIENGEESSADTSSENSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANFVIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIVGWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHCKACDAEQLDISSMEDDGSDKIEGLPF

ccccccHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEcEEEEEccccccccccccccEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccHHHHHHHHHccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

cccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHcccccccccccccccccccccccEcccEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHcccccHHHHHHHHHHHHHEEEEEEccccEEEEEEccEcccccccccccccccccccEEEcEccccccccEccccccccccccHcccccc

MIFSSRACKLLHVKLVQYWCLSFhnicwihfvgsernmskltLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAigklyrppkiengeessadtssensrgtmagLEAINFITvatphlgsrgnkqvpflFGVTAFEKAANFVIHLIFRRtgrhlflndndegrppllrrmvededENYFMSALCAFKRRVAYSNACYDHIvgwrtssirrnselpkwedsldekyphivhhehckacdaeqldissmeddgsdkieglpf

mifssracKLLHVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIerkrnlrkisfvahsvgglvaRYAIGKlyrppkiengeessadtsseNSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANFVIHLIFrrtgrhlflndndegrpPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIvgwrtssirrnseLPKWEDSLDEKYPHIVHHEHCKACDAEQLDISSmeddgsdkieglpf

*****RACKLLHVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYR************************GLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANFVIHLIFRRTGRHLFLNDN******LLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIVGWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHCKAC***********************

MIFSSRACKLLHVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYRPPKI*************NSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANFVIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIVGWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHC*******************KIEGLPF

MIFSSRACKLLHVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYRPPKIEN**************GTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANFVIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIVGWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHCKACDAEQLDISSMEDDGSDKIEGLPF

*IFSSRACKLLHVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYRPPK****************RGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANFVIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIVGWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHCKACDAEQLD*****************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		272	2.2.26 [Sep-21-2011]
Q08448		450	Putative lipase YOR059C O	yes	no	0.753	0.455	0.253	4e-11
P53118		685	Putative lipase ROG1 OS=S	no	no	0.522	0.207	0.315	2e-09
O14162		785	Putative lipase C4A8.10 O	yes	no	0.566	0.196	0.284	9e-08
Q04093		687	Putative lipase YDR444W O	no	no	0.724	0.286	0.253	2e-07
Q12103		647	Putative lipase YDL109C O	no	no	0.536	0.225	0.283	2e-05

>sp\|Q08448\|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR059C PE=1 SV=1	Back alignment and function desciption

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 109/233 (46%), Gaps = 28/233 (12%)

Query: 29  IHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRN--LRKISFVAHSVGGLVARYAI 86
           I+F+  +  M K T DG++++G R   EV E I   ++  + K+S + +S GGLVAR+ I
Sbjct: 42  IYFLPKQNAMFK-TFDGIEIIGYRTLIEVCEFIRDYKDGKITKLSVMGYSQGGLVARFMI 100

Query: 87  GKLYRPPKIENGEESSADTSSENSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTA 146
           GK+     +   +E   D            +E   FIT+ATPHLG          +  +A
Sbjct: 101 GKM-----LTEFKELFED------------IEPQLFITMATPHLGVEFYNPTGIAYK-SA 142

Query: 147 FEKAANFVIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSN 206
              A   +   I  ++GR +F+ ++      +L ++ + E    ++ AL  FK R+A++N
Sbjct: 143 LYSALRTLGSTILGKSGREMFIANSSNN---ILVKLSQGE----YLEALSLFKWRIAFAN 195

Query: 207 ACYDHIVGWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHCKACDAEQLDISSM 259
              D  V + T+ I        +++ L   +   +     K    + +D++++
Sbjct: 196 VKNDRTVAFYTAFITDCDPFIDFDNKLKYTFEEKIPGSGYKGILPKIVDLNAL 248

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -

>sp\|P53118\|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1	Back alignment and function description

>sp\|O14162\|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2	Back alignment and function description

>sp\|Q04093\|YD444_YEAST Putative lipase YDR444W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR444W PE=1 SV=1	Back alignment and function description

>sp\|Q12103\|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		272
225465987		362	PREDICTED: putative lipase ROG1-like [Vi	0.863	0.649	0.774	1e-101
297745025		360	unnamed protein product [Vitis vinifera]	0.863	0.652	0.774	1e-101
224112821		360	predicted protein [Populus trichocarpa]	0.863	0.652	0.740	1e-100
224053679		355	predicted protein [Populus trichocarpa]	0.863	0.661	0.744	1e-100
357439153		354	hypothetical protein MTR_1g040460 [Medic	0.856	0.658	0.748	1e-98
356575126		356	PREDICTED: putative lipase YOR059C-like	0.856	0.654	0.741	5e-95
255539889		404	catalytic, putative [Ricinus communis] g	0.852	0.574	0.727	3e-93
449458335		360	PREDICTED: putative lipase YOR059C-like	0.863	0.652	0.685	1e-92
449502230		360	PREDICTED: LOW QUALITY PROTEIN: putative	0.863	0.652	0.685	2e-92
356534801		357	PREDICTED: putative lipase ROG1-like [Gl	0.856	0.652	0.716	3e-90

>gi\|225465987\|ref\|XP_002264100.1\| PREDICTED: putative lipase ROG1-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 202/235 (85%)

Query: 34  SERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYRPP 93
           SERN S LTLDGVDVMGERLA+EV+EVI++K  +RKISFV+HSVGGLVARYAIG+LYRPP
Sbjct: 72  SERNASMLTLDGVDVMGERLAEEVIEVIKQKPEVRKISFVSHSVGGLVARYAIGRLYRPP 131

Query: 94  KIENGEESSADTSSENSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANF 153
           + EN ++ S +   ENSRGT+ GLEA+NFITVATPHLGSRGNKQVPFLFGV  FEKAA  
Sbjct: 132 RSENEDDPSDNICEENSRGTIYGLEAMNFITVATPHLGSRGNKQVPFLFGVPVFEKAATS 191

Query: 154 VIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIV 213
           VIHLIFRRTGRHLFL D+DEG PPLLRRM+ED  E +FMSAL  F RRV YSN  YDHIV
Sbjct: 192 VIHLIFRRTGRHLFLTDDDEGNPPLLRRMIEDCGELHFMSALHTFTRRVIYSNVGYDHIV 251

Query: 214 GWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHCKACDAEQLDISSMEDDGSDKIE 268
           GWRTSSIRRNSELPKWED ++EKYPHIV  EHCKACDAEQ + SSMEDDG DK+E
Sbjct: 252 GWRTSSIRRNSELPKWEDVVNEKYPHIVFEEHCKACDAEQCEPSSMEDDGLDKLE 306

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297745025\|emb\|CBI38617.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224112821\|ref\|XP_002332699.1\| predicted protein [Populus trichocarpa] gi\|222832953\|gb\|EEE71430.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224053679\|ref\|XP_002297925.1\| predicted protein [Populus trichocarpa] gi\|118486798\|gb\|ABK95234.1\| unknown [Populus trichocarpa] gi\|222845183\|gb\|EEE82730.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357439153\|ref\|XP_003589853.1\| hypothetical protein MTR_1g040460 [Medicago truncatula] gi\|355478901\|gb\|AES60104.1\| hypothetical protein MTR_1g040460 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356575126\|ref\|XP_003555693.1\| PREDICTED: putative lipase YOR059C-like [Glycine max]	Back alignment and taxonomy information

>gi\|255539889\|ref\|XP_002511009.1\| catalytic, putative [Ricinus communis] gi\|223550124\|gb\|EEF51611.1\| catalytic, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449458335\|ref\|XP_004146903.1\| PREDICTED: putative lipase YOR059C-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449502230\|ref\|XP_004161582.1\| PREDICTED: LOW QUALITY PROTEIN: putative lipase YOR059C-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356534801\|ref\|XP_003535940.1\| PREDICTED: putative lipase ROG1-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		272
TAIR\|locus:2176172		357	AT5G51180 [Arabidopsis thalian	0.852	0.649	0.697	1e-84
TAIR\|locus:2117527		418	AT4G25770 "AT4G25770" [Arabido	0.856	0.557	0.540	1.1e-57
TAIR\|locus:2201901		412	AT1G10040 [Arabidopsis thalian	0.772	0.509	0.546	1.6e-54
ASPGD\|ASPL0000041214		465	AN3084 [Emericella nidulans (t	0.227	0.133	0.469	3e-13
DICTYBASE\|DDB_G0275671		412	DDB_G0275671 "esterase/lipase/	0.220	0.145	0.491	4.2e-12
SGD\|S000005585		450	YOR059C "Lipid particle protei	0.220	0.133	0.396	1.4e-08
CGD\|CAL0005636		434	orf19.4128 [Candida albicans (	0.75	0.470	0.274	1.5e-08
UNIPROTKB\|Q59KL3		434	CaO19.4128 "Potential lipid pa	0.75	0.470	0.274	1.5e-08
CGD\|CAL0002871		556	orf19.4574 [Candida albicans (	0.334	0.163	0.326	8.3e-07
UNIPROTKB\|Q5AMS2		556	CaO19.12043 "Putative uncharac	0.334	0.163	0.326	8.3e-07

TAIR\|locus:2176172 AT5G51180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 848 (303.6 bits), Expect = 1.0e-84, P = 1.0e-84
 Identities = 164/235 (69%), Positives = 196/235 (83%)

Query:    34 SERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYRPP 93
             SE+N+S LTLDGVDVMGERLA EVL++I+RK N+ KISFVAHS+GGL ARYAIGKLY+P 
Sbjct:    70 SEKNVSALTLDGVDVMGERLAAEVLDIIQRKPNICKISFVAHSLGGLAARYAIGKLYKPA 129

Query:    94 KIENGEESSADTSSENSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANF 153
               E+ ++S AD+S E  +GT+ GLEA+NFITVATPHLGS GNKQVPFLFG ++ EK A  
Sbjct:   130 NQEDVKDSVADSSQETPKGTICGLEAMNFITVATPHLGSMGNKQVPFLFGFSSIEKVAGL 189

Query:   154 VIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIV 213
             +IH IF+RTGRHLFL D +EG+PPLLRRMVED D+ +F+SAL AFKRRVAYSN  +DH+V
Sbjct:   190 IIHWIFKRTGRHLFLKDEEEGKPPLLRRMVEDTDDCHFISALRAFKRRVAYSNVGHDHVV 249

Query:   214 GWRTSSIRRNSELPKWEDSLDEKYPHIVHHEHCKACDAEQLDISSMEDDGSDKIE 268
             GW+T+SIRR+SELPKWEDSL+EKYPHIV+ E CKACD E  DI   E+  SD IE
Sbjct:   250 GWKTASIRRDSELPKWEDSLNEKYPHIVYEELCKACDME--DIPEGENH-SDDIE 301

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:2117527 AT4G25770 "AT4G25770" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201901 AT1G10040 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000041214 AN3084 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0275671 DDB_G0275671 "esterase/lipase/thioesterase domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

SGD\|S000005585 YOR059C "Lipid particle protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

CGD\|CAL0005636 orf19.4128 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|Q59KL3 CaO19.4128 "Potential lipid particle serine esterase" [Candida albicans SC5314 (taxid:237561)]	Back alignment and assigned GO terms

CGD\|CAL0002871 orf19.4574 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5AMS2 CaO19.12043 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		272
pfam05057		214	pfam05057, DUF676, Putative serine esterase (DUF67	6e-58
COG1075		336	COG1075, LipA, Predicted acetyltransferases and hy	0.003

>gnl\|CDD\|218405 pfam05057, DUF676, Putative serine esterase (DUF676)	Back alignment and domain information

 Score =  183 bits (467), Expect = 6e-58
 Identities = 85/192 (44%), Positives = 112/192 (58%), Gaps = 14/192 (7%)

Query: 29  IHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGK 88
           I F+ S  N+SK T  G+DVMGERLA EVLE ++   + +KISFV HS+GGL+ARYAIGK
Sbjct: 37  IVFLMSSNNVSK-TFKGIDVMGERLANEVLEFVQDGSDGKKISFVGHSLGGLIARYAIGK 95

Query: 89  LYRPPKIENGEESSADTSSENSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFE 148
           LY                S   +G   GLE +NFIT+A+PHLG  GN  +    G+   E
Sbjct: 96  LYDSA------------MSTTFKGFFKGLEPMNFITLASPHLGVLGNSPLINW-GLWFLE 142

Query: 149 KAANFVIHLIFRRTGRHLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNAC 208
           K    +      +TGR LFL D  +G   LL +++ DE +  F+SAL AFKRR+ Y+N  
Sbjct: 143 KLKKSLSMGQLGKTGRDLFLKDVYDGINSLLYKLLTDESDLKFISALGAFKRRILYANVV 202

Query: 209 YDHIVGWRTSSI 220
            D+I    TS +
Sbjct: 203 NDYIAPLYTSKL 214

This family of proteins are probably serine esterase type enzymes with an alpha/beta hydrolase fold. Length = 214

>gnl\|CDD\|224001 COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		272
PF05057		217	DUF676: Putative serine esterase (DUF676); InterPr	99.95
KOG4372		405	consensus Predicted alpha/beta hydrolase [General	99.77
PLN02824		294	hydrolase, alpha/beta fold family protein	99.65
PLN02965		255	Probable pheophorbidase	99.64
PRK03592		295	haloalkane dehalogenase; Provisional	99.62
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	99.61
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	99.61
PRK00870		302	haloalkane dehalogenase; Provisional	99.57
PLN03087		481	BODYGUARD 1 domain containing hydrolase; Provision	99.56
PLN02679		360	hydrolase, alpha/beta fold family protein	99.54
PRK07581		339	hypothetical protein; Validated	99.54
PRK10349		256	carboxylesterase BioH; Provisional	99.54
PRK06489		360	hypothetical protein; Provisional	99.51
PRK03204		286	haloalkane dehalogenase; Provisional	99.51
PLN02298		330	hydrolase, alpha/beta fold family protein	99.5
PLN02385		349	hydrolase; alpha/beta fold family protein	99.5
PHA02857		276	monoglyceride lipase; Provisional	99.48
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	99.48
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	99.47
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	99.46
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	99.46
PLN02578		354	hydrolase	99.45
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	99.45
PRK08775		343	homoserine O-acetyltransferase; Provisional	99.44
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	99.44
TIGR01392		351	homoserO_Ac_trn homoserine O-acetyltransferase. Th	99.44
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	99.39
PRK10673		255	acyl-CoA esterase; Provisional	99.39
PLN02211		273	methyl indole-3-acetate methyltransferase	99.39
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	99.38
PRK10749		330	lysophospholipase L2; Provisional	99.38
PLN02894		402	hydrolase, alpha/beta fold family protein	99.37
KOG4178		322	consensus Soluble epoxide hydrolase [Lipid transpo	99.31
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	99.31
PRK00175		379	metX homoserine O-acetyltransferase; Provisional	99.3
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	99.29
PLN03084		383	alpha/beta hydrolase fold protein; Provisional	99.27
KOG1454		326	consensus Predicted hydrolase/acyltransferase (alp	99.25
PRK06765		389	homoserine O-acetyltransferase; Provisional	99.21
PLN02511		388	hydrolase	99.21
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	99.18
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	99.18
PRK10985		324	putative hydrolase; Provisional	99.13
PLN02652		395	hydrolase; alpha/beta fold family protein	99.12
TIGR01838		532	PHA_synth_I poly(R)-hydroxyalkanoic acid synthase,	99.1
PRK05855		582	short chain dehydrogenase; Validated	99.04
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	99.03
PRK05077		414	frsA fermentation/respiration switch protein; Revi	99.0
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	98.94
KOG4409		365	consensus Predicted hydrolase/acyltransferase (alp	98.9
PF07819		225	PGAP1: PGAP1-like protein; InterPro: IPR012908 The	98.88
TIGR01836		350	PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth	98.86
COG1647		243	Esterase/lipase [General function prediction only]	98.85
TIGR03100		274	hydr1_PEP hydrolase, ortholog 1, exosortase system	98.84
PRK13604		307	luxD acyl transferase; Provisional	98.74
KOG2382		315	consensus Predicted alpha/beta hydrolase [General	98.73
KOG1455		313	consensus Lysophospholipase [Lipid transport and m	98.72
PRK11071		190	esterase YqiA; Provisional	98.68
PRK10566		249	esterase; Provisional	98.65
PLN02633		314	palmitoyl protein thioesterase family protein	98.58
PLN02733		440	phosphatidylcholine-sterol O-acyltransferase	98.56
PRK07868		994	acyl-CoA synthetase; Validated	98.54
PF06028		255	DUF915: Alpha/beta hydrolase of unknown function (	98.48
COG0596		282	MhpC Predicted hydrolases or acyltransferases (alp	98.45
KOG2984		277	consensus Predicted hydrolase [General function pr	98.45
PF00326		213	Peptidase_S9: Prolyl oligopeptidase family This fa	98.45
PF02089		279	Palm_thioest: Palmitoyl protein thioesterase; Inte	98.44
PLN02606		306	palmitoyl-protein thioesterase	98.42
PLN02872		395	triacylglycerol lipase	98.29
PF02450		389	LCAT: Lecithin:cholesterol acyltransferase; InterP	98.26
COG1075		336	LipA Predicted acetyltransferases and hydrolases w	98.18
PF01674		219	Lipase_2: Lipase (class 2); InterPro: IPR002918 Li	98.17
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	98.15
KOG2541		296	consensus Palmitoyl protein thioesterase [Lipid tr	98.09
PLN02442		283	S-formylglutathione hydrolase	98.08
PRK11460		232	putative hydrolase; Provisional	98.01
TIGR02821		275	fghA_ester_D S-formylglutathione hydrolase. This m	97.98
COG3208		244	GrsT Predicted thioesterase involved in non-riboso	97.95
KOG4667		269	consensus Predicted esterase [Lipid transport and	97.94
PF02230		216	Abhydrolase_2: Phospholipase/Carboxylesterase; Int	97.9
KOG3724		973	consensus Negative regulator of COPII vesicle form	97.87
TIGR03101		266	hydr2_PEP hydrolase, ortholog 2, exosortase system	97.84
COG2021		368	MET2 Homoserine acetyltransferase [Amino acid tran	97.75
cd00741		153	Lipase Lipase. Lipases are esterases that can hydr	97.74
PF08840		213	BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term	97.66
TIGR01839		560	PHA_synth_II poly(R)-hydroxyalkanoic acid synthase	97.63
TIGR03230		442	lipo_lipase lipoprotein lipase. Members of this pr	97.62
PF09752		348	DUF2048: Uncharacterized conserved protein (DUF204	97.61
TIGR01840		212	esterase_phb esterase, PHB depolymerase family. Th	97.61
COG0429		345	Predicted hydrolase of the alpha/beta-hydrolase fo	97.53
PLN00021		313	chlorophyllase	97.52
PF01764		140	Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr	97.47
KOG2564		343	consensus Predicted acetyltransferases and hydrola	97.43
cd00707		275	Pancreat_lipase_like Pancreatic lipase-like enzyme	97.3
KOG2369		473	consensus Lecithin:cholesterol acyltransferase (LC	97.29
KOG1838		409	consensus Alpha/beta hydrolase [General function p	97.24
KOG2029		697	consensus Uncharacterized conserved protein [Funct	97.18
COG4814		288	Uncharacterized protein with an alpha/beta hydrola	97.17
COG3545		181	Predicted esterase of the alpha/beta hydrolase fol	97.16
PF06821		171	Ser_hydrolase: Serine hydrolase; InterPro: IPR0106	97.1
COG3243		445	PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me	97.1
cd00519		229	Lipase_3 Lipase (class 3). Lipases are esterases t	97.09
PLN02517		642	phosphatidylcholine-sterol O-acyltransferase	97.04
KOG1552		258	consensus Predicted alpha/beta hydrolase [General	97.03
PF05448		320	AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0	96.96
COG1506		620	DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept	96.86
TIGR03502		792	lipase_Pla1_cef extracellular lipase, Pla-1/cef fa	96.83
PF06500		411	DUF1100: Alpha/beta hydrolase of unknown function	96.79
PF01738		218	DLH: Dienelactone hydrolase family; InterPro: IPR0	96.77
PF05990		233	DUF900: Alpha/beta hydrolase of unknown function (	96.71
PF00975		229	Thioesterase: Thioesterase domain; InterPro: IPR00	96.69
PF05728		187	UPF0227: Uncharacterised protein family (UPF0227);	96.58
PF00756		251	Esterase: Putative esterase; InterPro: IPR000801 T	96.5
PF06342		297	DUF1057: Alpha/beta hydrolase of unknown function	96.5
PLN02571		413	triacylglycerol lipase	96.39
PLN02408		365	phospholipase A1	96.38
PLN02324		415	triacylglycerol lipase	96.22
PLN02454		414	triacylglycerol lipase	96.2
KOG2205		424	consensus Uncharacterized conserved protein [Funct	96.18
PF05277		345	DUF726: Protein of unknown function (DUF726); Inte	96.17
PLN00413		479	triacylglycerol lipase	96.12
PF08538		303	DUF1749: Protein of unknown function (DUF1749); In	96.03
PRK10162		318	acetyl esterase; Provisional	95.94
PLN02802		509	triacylglycerol lipase	95.94
COG2945		210	Predicted hydrolase of the alpha/beta superfamily	95.93
PLN02310		405	triacylglycerol lipase	95.83
COG4188		365	Predicted dienelactone hydrolase [General function	95.82
PRK04940		180	hypothetical protein; Provisional	95.78
PF08386		103	Abhydrolase_4: TAP-like protein; InterPro: IPR0135	95.75
PLN02162		475	triacylglycerol lipase	95.6
PF00151		331	Lipase: Lipase; InterPro: IPR013818 Triglyceride l	95.59
PLN02753		531	triacylglycerol lipase	95.45
PLN02934		515	triacylglycerol lipase	95.44
PLN03037		525	lipase class 3 family protein; Provisional	95.37
COG4757		281	Predicted alpha/beta hydrolase [General function p	95.19
COG3458		321	Acetyl esterase (deacetylase) [Secondary metabolit	95.19
PLN02719		518	triacylglycerol lipase	95.16
PLN02761		527	lipase class 3 family protein	95.16
TIGR00976		550	/NonD putative hydrolase, CocE/NonD family. This m	95.15
PRK10439		411	enterobactin/ferric enterobactin esterase; Provisi	95.13
PF06259		177	Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR	95.1
PF11187		224	DUF2974: Protein of unknown function (DUF2974); In	94.97
PRK05371		767	x-prolyl-dipeptidyl aminopeptidase; Provisional	94.97
COG3319		257	Thioesterase domains of type I polyketide synthase	94.84
COG0412		236	Dienelactone hydrolase and related enzymes [Second	94.81
PF03096		283	Ndr: Ndr family; InterPro: IPR004142 This family c	94.67
COG2819		264	Predicted hydrolase of the alpha/beta superfamily	94.63
KOG2931		326	consensus Differentiation-related gene 1 protein (	94.33
PLN02847		633	triacylglycerol lipase	94.28
PRK10115		686	protease 2; Provisional	94.17
COG3571		213	Predicted hydrolase of the alpha/beta-hydrolase fo	94.13
smart00824		212	PKS_TE Thioesterase. Peptide synthetases are invol	93.94
PF10230		266	DUF2305: Uncharacterised conserved protein (DUF230	93.94
PF01083		179	Cutinase: Cutinase; InterPro: IPR000675 Aerial pla	93.93
PF10503		220	Esterase_phd: Esterase PHB depolymerase	93.84
COG4782		377	Uncharacterized protein conserved in bacteria [Fun	93.81
PF07224		307	Chlorophyllase: Chlorophyllase; InterPro: IPR01082	93.31
COG3150		191	Predicted esterase [General function prediction on	93.05
KOG4569		336	consensus Predicted lipase [Lipid transport and me	92.9
KOG1551		371	consensus Uncharacterized conserved protein [Funct	92.82
KOG4391		300	consensus Predicted alpha/beta hydrolase BEM46 [Ge	92.62
COG0400		207	Predicted esterase [General function prediction on	92.61
PRK10252		1296	entF enterobactin synthase subunit F; Provisional	92.46
PF12715		390	Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8	92.3
PF05705		240	DUF829: Eukaryotic protein of unknown function (DU	92.14
KOG2385		633	consensus Uncharacterized conserved protein [Funct	91.41
KOG4627		270	consensus Kynurenine formamidase [Amino acid trans	91.13
PF11288		207	DUF3089: Protein of unknown function (DUF3089); In	91.04
COG0627		316	Predicted esterase [General function prediction on	90.61
KOG4372		405	consensus Predicted alpha/beta hydrolase [General	89.61
COG2382		299	Fes Enterochelin esterase and related enzymes [Ino	89.19
KOG4840		299	consensus Predicted hydrolases or acyltransferases	89.09
PF08237		225	PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum	88.92
TIGR01849		406	PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase,	88.79
PTZ00472		462	serine carboxypeptidase (CBP1); Provisional	88.58
PF07859		211	Abhydrolase_3: alpha/beta hydrolase fold A web pag	84.91
KOG4540		425	consensus Putative lipase essential for disintegra	84.17
COG5153		425	CVT17 Putative lipase essential for disintegration	84.17
PF06057		192	VirJ: Bacterial virulence protein (VirJ); InterPro	83.68
PF05677		365	DUF818: Chlamydia CHLPS protein (DUF818); InterPro	83.3
KOG3101		283	consensus Esterase D [General function prediction	82.42
PF12740		259	Chlorophyllase2: Chlorophyllase enzyme; InterPro:	81.35
KOG2624		403	consensus Triglyceride lipase-cholesterol esterase	81.11

>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases	Back alignment and domain information

Probab=99.95  E-value=1.4e-27  Score=207.95  Aligned_cols=196  Identities=39%  Similarity=0.578  Sum_probs=153.6

Q ss_pred             ccchhhhhhhhhhhh-ccCCcceEEEEccCCCCCCCCCCcHHHHHHHHHHHHHHHHHHhcC-CCeEEEEEechhHHHHHH
Q 024115            7 ACKLLHVKLVQYWCL-SFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRN-LRKISFVAHSVGGLVARY   84 (272)
Q Consensus         7 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~s~~n~~~~t~~g~~~~~~~lA~~v~~ll~~~~~-~~~i~lVGHSmGG~VaR~   84 (272)
                      ..||.++++...... .+.. .++.+..+..|.. +|++|++.+|++++++|.+.++.... ..+|+||||||||+|+|+
T Consensus        17 ~~d~~~~~~~l~~~~~~~~~-~~i~~~~~~~n~~-~T~~gI~~~g~rL~~eI~~~~~~~~~~~~~IsfIgHSLGGli~r~   94 (217)
T PF05057_consen   17 PADMRYLKNHLEKIPEDLPN-ARIVVLGYSNNEF-KTFDGIDVCGERLAEEILEHIKDYESKIRKISFIGHSLGGLIARY   94 (217)
T ss_pred             HHHHHHHHHHHHHhhhhcch-hhhhhhccccccc-ccchhhHHHHHHHHHHHHHhccccccccccceEEEecccHHHHHH
Confidence            578989988877631 1221 1445556666655 89999999999999999999984322 369999999999999999


Q ss_pred             HHHhhcCCCCcCCCCCCccccccccccccccccccceeEEecCCCCCCCCCCCcccchhhhHHHHHHHHHHHHHHhhccc
Q 024115           85 AIGKLYRPPKIENGEESSADTSSENSRGTMAGLEAINFITVATPHLGSRGNKQVPFLFGVTAFEKAANFVIHLIFRRTGR  164 (272)
Q Consensus        85 al~~l~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~v~~atP~~G~~~~~~~p~~~g~~~~~~~~~~~~~~~~~~s~~  164 (272)
                      |+..++.....              ....+.+.++..|++++|||+|+..........|.++++++.+.+....++.+|+
T Consensus        95 al~~~~~~~~~--------------~~~~~~~~~~~~fitlatPH~G~~~~~~~~v~~g~~~~~~~~~~~~~~~l~~tG~  160 (217)
T PF05057_consen   95 ALGLLHDKPQY--------------FPGFFQKIKPHNFITLATPHLGSRYASSTLVNFGLWLLSKLKKSLSLRQLGRTGR  160 (217)
T ss_pred             HHHHhhhcccc--------------ccccccceeeeeEEEeCCCCCCCcccccccchhhhHHHHHHHHHhhHHHhCcchH
Confidence            99886654310              0012334467899999999999998776545567777888887776778899999


Q ss_pred             chhccCCCCCchhhHhhhccCCcchHHHHHhccCCccEEEEecCCCeeecceec
Q 024115          165 HLFLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIVGWRTS  218 (272)
Q Consensus       165 ~l~l~d~~~~~~~~L~~l~~~~~~~d~~~~L~~f~~p~L~~~g~~D~iVP~~sa  218 (272)
                      ||++.|......++|.+|+.++++..|.++|++|++++||+|..+|.+||+.|+
T Consensus       161 ~L~l~D~~~~~~~~l~~l~~~~~~~~f~~~L~~F~~~~l~an~~~D~~V~~~s~  214 (217)
T PF05057_consen  161 QLFLSDSKDNENPLLYKLSQDEPDLSFIEALKRFKRRVLYANIVNDRYVPFHSE  214 (217)
T ss_pred             hhccccccCCCCCchHHHhcCCCchHHHHHHHhCCCEEEEEccCCCCccceecC
Confidence            999998766667889999876666789999999999999999999999999983

>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional	Back alignment and domain information

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK07581 hypothetical protein; Validated	Back alignment and domain information

>PRK10349 carboxylesterase BioH; Provisional	Back alignment and domain information

>PRK06489 hypothetical protein; Provisional	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>PLN02578 hydrolase	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism]	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PRK00175 metX homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>PLN03084 alpha/beta hydrolase fold protein; Provisional	Back alignment and domain information

>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PRK06765 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>PLN02652 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>PRK05077 frsA fermentation/respiration switch protein; Reviewed	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT)	Back alignment and domain information

>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit	Back alignment and domain information

>COG1647 Esterase/lipase [General function prediction only]	Back alignment and domain information

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated	Back alignment and domain information

>PRK13604 luxD acyl transferase; Provisional	Back alignment and domain information

>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>PRK11071 esterase YqiA; Provisional	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>PLN02633 palmitoyl protein thioesterase family protein	Back alignment and domain information

>PLN02733 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>PRK07868 acyl-CoA synthetase; Validated	Back alignment and domain information

>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>KOG2984 consensus Predicted hydrolase [General function prediction only]	Back alignment and domain information

>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification	Back alignment and domain information

>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children	Back alignment and domain information

>PLN02606 palmitoyl-protein thioesterase	Back alignment and domain information

>PLN02872 triacylglycerol lipase	Back alignment and domain information

>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2	Back alignment and domain information

>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02442 S-formylglutathione hydrolase	Back alignment and domain information

>PRK11460 putative hydrolase; Provisional	Back alignment and domain information

>TIGR02821 fghA_ester_D S-formylglutathione hydrolase	Back alignment and domain information

>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG4667 consensus Predicted esterase [Lipid transport and metabolism]	Back alignment and domain information

>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases	Back alignment and domain information

>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated	Back alignment and domain information

>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>cd00741 Lipase Lipase	Back alignment and domain information

>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH	Back alignment and domain information

>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II	Back alignment and domain information

>TIGR03230 lipo_lipase lipoprotein lipase	Back alignment and domain information

>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function	Back alignment and domain information

>TIGR01840 esterase_phb esterase, PHB depolymerase family	Back alignment and domain information

>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>PLN00021 chlorophyllase	Back alignment and domain information

>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides []	Back alignment and domain information

>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes	Back alignment and domain information

>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism]	Back alignment and domain information

>KOG1838 consensus Alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>KOG2029 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic	Back alignment and domain information

>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism]	Back alignment and domain information

>cd00519 Lipase_3 Lipase (class 3)	Back alignment and domain information

>PLN02517 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins	Back alignment and domain information

>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family	Back alignment and domain information

>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate []	Back alignment and domain information

>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway	Back alignment and domain information

>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []	Back alignment and domain information

>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO	Back alignment and domain information

>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae	Back alignment and domain information

>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold	Back alignment and domain information

>PLN02571 triacylglycerol lipase	Back alignment and domain information

>PLN02408 phospholipase A1	Back alignment and domain information

>PLN02324 triacylglycerol lipase	Back alignment and domain information

>PLN02454 triacylglycerol lipase	Back alignment and domain information

>KOG2205 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins	Back alignment and domain information

>PLN00413 triacylglycerol lipase	Back alignment and domain information

>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function	Back alignment and domain information

>PRK10162 acetyl esterase; Provisional	Back alignment and domain information

>PLN02802 triacylglycerol lipase	Back alignment and domain information

>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>PLN02310 triacylglycerol lipase	Back alignment and domain information

>COG4188 Predicted dienelactone hydrolase [General function prediction only]	Back alignment and domain information

>PRK04940 hypothetical protein; Provisional	Back alignment and domain information

>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PLN02162 triacylglycerol lipase	Back alignment and domain information

>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3	Back alignment and domain information

>PLN02753 triacylglycerol lipase	Back alignment and domain information

>PLN02934 triacylglycerol lipase	Back alignment and domain information

>PLN03037 lipase class 3 family protein; Provisional	Back alignment and domain information

>COG4757 Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PLN02719 triacylglycerol lipase	Back alignment and domain information

>PLN02761 lipase class 3 family protein	Back alignment and domain information

>TIGR00976 /NonD putative hydrolase, CocE/NonD family	Back alignment and domain information

>PRK10439 enterobactin/ferric enterobactin esterase; Provisional	Back alignment and domain information

>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria	Back alignment and domain information

>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function	Back alignment and domain information

>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional	Back alignment and domain information

>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3	Back alignment and domain information

>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only]	Back alignment and domain information

>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown]	Back alignment and domain information

>PLN02847 triacylglycerol lipase	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>smart00824 PKS_TE Thioesterase	Back alignment and domain information

>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function	Back alignment and domain information

>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids []	Back alignment and domain information

>PF10503 Esterase_phd: Esterase PHB depolymerase	Back alignment and domain information

>COG4782 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3	Back alignment and domain information

>COG3150 Predicted esterase [General function prediction only]	Back alignment and domain information

>KOG4569 consensus Predicted lipase [Lipid transport and metabolism]	Back alignment and domain information

>KOG1551 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only]	Back alignment and domain information

>COG0400 Predicted esterase [General function prediction only]	Back alignment and domain information

>PRK10252 entF enterobactin synthase subunit F; Provisional	Back alignment and domain information

>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A	Back alignment and domain information

>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins	Back alignment and domain information

>KOG2385 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism]	Back alignment and domain information

>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function	Back alignment and domain information

>COG0627 Predicted esterase [General function prediction only]	Back alignment and domain information

>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE)	Back alignment and domain information

>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular	Back alignment and domain information

>PTZ00472 serine carboxypeptidase (CBP1); Provisional	Back alignment and domain information

>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism]	Back alignment and domain information

>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism]	Back alignment and domain information

>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins	Back alignment and domain information

>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins	Back alignment and domain information

>KOG3101 consensus Esterase D [General function prediction only]	Back alignment and domain information

>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3	Back alignment and domain information

>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		272
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	3e-09
2x5x_A		342	PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE	7e-06
1tca_A		317	Lipase; hydrolase(carboxylic esterase); HET: NAG;	4e-05
3icv_A		316	Lipase B, CALB; circular permutation, cleavage on	4e-05
1ys1_X		320	Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h	1e-04
2hih_A		431	Lipase 46 kDa form; A1 phospholipase, phospholipid	5e-04
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	5e-04

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181	Back alignment and structure

 Score = 54.4 bits (131), Expect = 3e-09
 Identities = 18/89 (20%), Positives = 31/89 (34%), Gaps = 25/89 (28%)

Query: 46  VDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYRPPKIENGEESSADT 105
               G  L++ V +V++     +K+  VAHS+GG    Y I  L    K+          
Sbjct: 48  NYNNGPVLSRFVQKVLDE-TGAKKVDIVAHSMGGANTLYYIKNLDGGNKVA--------- 97

Query: 106 SSENSRGTMAGLEAINFITVATPHLGSRG 134
                          N +T+   +  + G
Sbjct: 98  ---------------NVVTLGGANRLTTG 111

PyMOL of 1isp

>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Length = 342	Back alignment and structure

>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317	Back alignment and structure

>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316	Back alignment and structure

>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Length = 320	Back alignment and structure

>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Length = 431	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		272
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	99.76
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	99.75
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	99.74
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	99.7
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	99.69
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	99.69
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	99.69
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	99.69
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	99.67
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	99.66
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	99.66
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	99.66
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	99.65
1iup_A		282	META-cleavage product hydrolase; aromatic compound	99.65
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	99.64
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	99.64
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	99.64
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	99.64
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	99.64
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	99.63
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	99.63
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	99.63
2wfl_A		264	Polyneuridine-aldehyde esterase; alkaloid metaboli	99.63
1xkl_A		273	SABP2, salicylic acid-binding protein 2; alpha-bet	99.62
3c6x_A		257	Hydroxynitrilase; atomic resolution, hydroxynitril	99.62
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	99.62
1pja_A		302	Palmitoyl-protein thioesterase 2 precursor; hydrol	99.61
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	99.61
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	99.6
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	99.59
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	99.59
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	99.59
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	99.58
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	99.57
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	99.57
4g9e_A		279	AHL-lactonase, alpha/beta hydrolase fold protein;	99.56
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	99.56
4dnp_A		269	DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu	99.56
3dqz_A		258	Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl	99.55
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	99.55
4fbl_A		281	LIPS lipolytic enzyme; thermostable, structural ge	99.54
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	99.54
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	99.54
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	99.53
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	99.53
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	99.53
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	99.53
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	99.53
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	99.52
3sty_A		267	Methylketone synthase 1; alpha/beta hydrolase, dec	99.52
2wj6_A		276	1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid	99.52
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	99.52
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	99.51
3i1i_A		377	Homoserine O-acetyltransferase; structural genomic	99.51
3hju_A		342	Monoglyceride lipase; alpha/beta hydrolase, hydrol	99.5
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	99.5
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	99.5
3pe6_A		303	Monoglyceride lipase; alpha-beta hydrolase fold, 2	99.5
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	99.49
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	99.48
3ibt_A		264	1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO,	99.47
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	99.47
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	99.46
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	99.46
1tht_A		305	Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.	99.45
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	99.45
2vat_A		444	Acetyl-COA--deacetylcephalosporin C acetyltransfer	99.44
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	99.44
2pl5_A		366	Homoserine O-acetyltransferase; alpha/beta hydrola	99.43
1r3d_A		264	Conserved hypothetical protein VC1974; structural	99.43
1wm1_A		317	Proline iminopeptidase; complex with inhibitor, hy	99.43
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	99.43
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	99.14
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	99.42
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	99.41
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	99.41
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	99.4
1azw_A		313	Proline iminopeptidase; aminopeptidase, serine pro	99.4
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	99.4
2b61_A		377	Homoserine O-acetyltransferase; acyl-enzyme, aspar	99.4
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	99.37
3llc_A		270	Putative hydrolase; structural genomics, joint cen	99.36
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	99.36
3fla_A		267	RIFR; alpha-beta hydrolase thioesterase, hydrolase	99.35
3pfb_A		270	Cinnamoyl esterase; alpha/beta hydrolase fold, hyd	99.34
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	99.34
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	99.31
3lp5_A		250	Putative cell surface hydrolase; structural genom	99.29
2rau_A		354	Putative esterase; NP_343859.1, putative lipase, s	99.28
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	99.27
2qs9_A		194	Retinoblastoma-binding protein 9; B5T overexpresse	99.25
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	99.24
1uxo_A		192	YDEN protein; hydrolase, A/B hydrolase, esterase,	99.24
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	99.23
3icv_A		316	Lipase B, CALB; circular permutation, cleavage on	99.23
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	99.22
3qmv_A		280	Thioesterase, REDJ; alpha/beta hydrolase fold, hyd	99.21
3h04_A		275	Uncharacterized protein; protein with unknown func	99.2
3fle_A		249	SE_1780 protein; structural genomics, APC61035.1,	99.17
3bdv_A		191	Uncharacterized protein DUF1234; DUF1234 family pr	99.16
3ds8_A		254	LIN2722 protein; unkonwn function, structural geno	99.16
1tca_A		317	Lipase; hydrolase(carboxylic esterase); HET: NAG;	99.16
1ei9_A		279	Palmitoyl protein thioesterase 1; alpha/beta hydro	99.13
2pbl_A		262	Putative esterase/lipase/thioesterase; alpha/beta-	99.1
4fle_A		202	Esterase; structural genomics, PSI-biology, northe	99.1
3ksr_A		290	Putative serine hydrolase; catalytic triad, struct	99.09
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	99.09
2k2q_B		242	Surfactin synthetase thioesterase subunit; A/B-hyd	99.07
4i19_A		388	Epoxide hydrolase; structural genomics, PSI-biolog	99.06
3trd_A		208	Alpha/beta hydrolase; cellular processes; 1.50A {C	99.06
2q0x_A		335	Protein DUF1749, uncharacterized protein; alpha/be	98.99
2qjw_A		176	Uncharacterized protein XCC1541; putative hydrolas	98.97
2i3d_A		249	AGR_C_3351P, hypothetical protein ATU1826; structu	98.93
3ils_A		265	PKS, aflatoxin biosynthesis polyketide synthase; A	98.93
1fj2_A		232	Protein (acyl protein thioesterase 1); alpha/beta	98.93
1jfr_A		262	Lipase; serine hydrolase; 1.90A {Streptomyces exfo	98.92
1kez_A		300	Erythronolide synthase; polyketide synthase, modul	98.89
2fuk_A		220	XC6422 protein; A/B hydrolase, structural genomics	98.89
2jbw_A		386	Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine	98.88
1ex9_A		285	Lactonizing lipase; alpha-beta hydrolase fold, pho	98.87
3g02_A		408	Epoxide hydrolase; alpha/beta hydrolase fold, enan	98.86
1vkh_A		273	Putative serine hydrolase; structural genomics, jo	98.86
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	98.82
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	98.81
1qlw_A		328	Esterase; anisotropic refinement, atomic resolutio	98.79
3vis_A		306	Esterase; alpha/beta-hydrolase fold, polyethylene	98.78
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	98.78
2fx5_A		258	Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse	98.78
2r8b_A		251	AGR_C_4453P, uncharacterized protein ATU2452; APC6	98.77
3bjr_A		283	Putative carboxylesterase; structural genomics, jo	98.77
1auo_A		218	Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl	98.76
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	98.73
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	98.72
3k2i_A		422	Acyl-coenzyme A thioesterase 4; alpha/beta hydrola	98.71
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	98.71
3lcr_A		319	Tautomycetin biosynthetic PKS; alpha-beta hydrolas	98.69
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	98.68
3u0v_A		239	Lysophospholipase-like protein 1; alpha, beta hydr	98.68
3cn9_A		226	Carboxylesterase; alpha/beta hydrolase fold super-	98.67
3hxk_A		276	Sugar hydrolase; alpha-beta protein., structural g	98.66
3bxp_A		277	Putative lipase/esterase; putative carboxylesteras	98.66
2o7r_A		338	CXE carboxylesterase; alpha/beta hydrolase; 1.40A	98.64
3d7r_A		326	Esterase; alpha/beta fold, hydrolase; 2.01A {Staph	98.62
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	98.59
3fnb_A		405	Acylaminoacyl peptidase SMU_737; alpha-beta-alpha	98.59
2x5x_A		342	PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE	98.59
3hlk_A		446	Acyl-coenzyme A thioesterase 2, mitochondrial; alp	98.59
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	98.57
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	98.56
2zsh_A		351	Probable gibberellin receptor GID1L1; plant hormon	98.55
4e15_A		303	Kynurenine formamidase; alpha/beta hydrolase fold,	98.55
3b5e_A		223	MLL8374 protein; NP_108484.1, carboxylesterase, st	98.55
3e4d_A		278	Esterase D; S-formylglutathione hydrolase, hydrola	98.52
2dsn_A		387	Thermostable lipase; T1 lipase, hydrolase; 1.50A {	98.52
2h1i_A		226	Carboxylesterase; structural genomics, PSI-2, prot	98.52
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	98.5
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	98.47
1ys1_X		320	Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h	98.47
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	98.46
3mve_A		415	FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/	98.45
2c7b_A		311	Carboxylesterase, ESTE1; carboxyesterase, thermoph	98.44
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	98.44
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	98.41
3fcx_A		282	FGH, esterase D, S-formylglutathione hydrolase; re	98.4
2hfk_A		319	Pikromycin, type I polyketide synthase pikaiv; alp	98.37
2qru_A		274	Uncharacterized protein; alpha/beta-hydrolase, str	98.37
1jmk_C		230	SRFTE, surfactin synthetase; thioesterase, non-rib	98.36
4h0c_A		210	Phospholipase/carboxylesterase; PSI-biology, midwe	98.35
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	98.32
3ls2_A		280	S-formylglutathione hydrolase; psychrophilic organ	98.29
1jkm_A		361	Brefeldin A esterase; serine hydrolase, degradatio	98.29
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	98.22
3tej_A		329	Enterobactin synthase component F; nonribosomal pe	98.22
2hih_A		431	Lipase 46 kDa form; A1 phospholipase, phospholipid	98.16
1lns_A		763	X-prolyl dipeptidyl aminopetidase; alpha beta hydr	98.15
4fhz_A		285	Phospholipase/carboxylesterase; alpha/beta hydrola	98.14
2cb9_A		244	Fengycin synthetase; thioesterase, non-ribosomal p	98.14
3h2g_A		397	Esterase; xanthomonas oryzae PV. oryzae, cell WALL	98.13
2dst_A		131	Hypothetical protein TTHA1544; conserved hypotheti	98.11
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	98.1
1ycd_A		243	Hypothetical 27.3 kDa protein in AAP1-SMF2 interge	98.07
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	98.06
4b6g_A		283	Putative esterase; hydrolase, formaldehyde detoxif	98.04
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	98.04
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	98.02
4ao6_A		259	Esterase; hydrolase, thermo label; 1.60A {Unidenti	98.02
1jji_A		311	Carboxylesterase; alpha-beta hydrolase fold, hydro	98.01
1jjf_A		268	Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x	97.97
4f21_A		246	Carboxylesterase/phospholipase family protein; str	97.97
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	97.95
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	97.94
1lzl_A		323	Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod	97.94
2wir_A		313	Pesta, alpha/beta hydrolase fold-3 domain protein;	97.92
3ain_A		323	303AA long hypothetical esterase; carboxylesterase	97.92
3k6k_A		322	Esterase/lipase; alpha/beta hydrolase fold; 2.20A	97.85
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	97.84
3d0k_A		304	Putative poly(3-hydroxybutyrate) depolymerase LPQ;	97.81
3ga7_A		326	Acetyl esterase; phosphoserine, IDP00896, hydrolas	97.79
3qh4_A		317	Esterase LIPW; structural genomics, ssgcid, seattl	97.77
2zyr_A		484	Lipase, putative; fatty acid, hydrolase; HET: 1PE;	97.74
1gpl_A		432	RP2 lipase; serine esterase, hydrolase, lipid degr	97.72
3ebl_A		365	Gibberellin receptor GID1; alpha/beta hydrolase, l	97.68
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	97.67
3fak_A		322	Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc	97.67
4hvt_A		711	Ritya.17583.B, post-proline cleaving enzyme; ssgci	97.62
3d59_A		383	Platelet-activating factor acetylhydrolase; secret	97.61
2d81_A		318	PHB depolymerase; alpha/beta hydrolase fold, circu	97.61
1dqz_A		280	85C, protein (antigen 85-C); fibronectin, structur	97.52
1tib_A		269	Lipase; hydrolase(carboxylic esterase); 1.84A {The	97.52
1tgl_A		269	Triacyl-glycerol acylhydrolase; carboxylic esteras	97.41
1r88_A		280	MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP	97.39
3tjm_A		283	Fatty acid synthase; thioesterase domain, fatty ac	97.38
1lgy_A		269	Lipase, triacylglycerol lipase; hydrolase (carboxy	97.36
1tia_A		279	Lipase; hydrolase(carboxylic esterase); 2.10A {Pen	97.36
1w52_X		452	Pancreatic lipase related protein 2; detergent, cl	97.35
1hpl_A		449	Lipase; hydrolase(carboxylic esterase); 2.30A {Equ	97.32
1bu8_A		452	Protein (pancreatic lipase related protein 2); hyd	97.3
3i2k_A		587	Cocaine esterase; alpha/beta hydrolase, hydrolase;	97.28
1rp1_A		450	Pancreatic lipase related protein 1; hydrolase, li	97.25
1uwc_A		261	Feruloyl esterase A; hydrolase, serine esterase, x	97.16
1sfr_A		304	Antigen 85-A; alpha/beta hydrolase, structural gen	97.15
4ezi_A		377	Uncharacterized protein; alpha-beta hydrolases fol	97.09
3o0d_A		301	YALI0A20350P, triacylglycerol lipase; alpha/beta-h	96.94
3g7n_A		258	Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A	96.91
3ngm_A		319	Extracellular lipase; secret lipase, hydrolase; 2.	96.87
3uue_A		279	LIP1, secretory lipase (family 3); LID-domain, hyd	96.67
2qm0_A		275	BES; alpha-beta structure, structural genomics, PS	96.59
1gkl_A		297	Endo-1,4-beta-xylanase Y; hydrolase, esterase fami	96.4
2px6_A		316	Thioesterase domain; thioesaterse domain, orlistat	96.34
3c8d_A		403	Enterochelin esterase; alpha-beta-alpha sandwich,	95.84
2gzs_A		278	IROE protein; enterobactin, salmochelin, DFP, hydr	95.58
3g8y_A		391	SUSD/RAGB-associated esterase-like protein; struct	95.36
3gff_A		331	IROE-like serine hydrolase; NP_718593.1, structura	95.22
3iii_A		560	COCE/NOND family hydrolase; structural genomics, c	95.13
1mpx_A		615	Alpha-amino acid ester hydrolase; alpha/beta hydro	94.88
3nuz_A		398	Putative acetyl xylan esterase; structural genomic	94.56
3guu_A		462	Lipase A; protein structure, hydrolase; HET: 1PE;	94.52
2ory_A		346	Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph	94.38
4fol_A		299	FGH, S-formylglutathione hydrolase; D-type esteras	93.61
2yij_A		419	Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid	92.62
2b9v_A		652	Alpha-amino acid ester hydrolase; catalytic triad,	92.87
3qpa_A		197	Cutinase; alpha-beta hydrolase fold, esterase, hyd	92.5
1qoz_A		207	AXE, acetyl xylan esterase; hydrolase, xylan degra	91.05
3aja_A		302	Putative uncharacterized protein; alpha-beta hydro	90.9
3hc7_A		254	Gene 12 protein, GP12; alpha/beta sandwich, cell a	90.78
3dcn_A		201	Cutinase, cutin hydrolase; catalytic triad, secret	90.41
2czq_A		205	Cutinase-like protein; alpha/beta hydrolase fold,	88.9
1whs_B		153	Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T	88.32
1g66_A		207	Acetyl xylan esterase II; serine hydrolase, acetyl	87.35
3qpd_A		187	Cutinase 1; alpha-beta hydrolase fold, esterase, h	86.2
2qub_A		615	Extracellular lipase; beta roll, alpha/beta hydrol	86.04
2vsq_A		1304	Surfactin synthetase subunit 3; ligase, peptidyl c	84.62

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0	Back alignment and structure

Probab=99.76  E-value=3.9e-19  Score=155.68  Aligned_cols=203  Identities=16%  Similarity=0.176  Sum_probs=118.7

Q ss_pred             hhhhhhhhhhccCCcceEEEEccCCCCCCCCCCcHHHHHHHHHHHHHHHHHHhcCCCeEEEEEechhHHHHHHHHHhhcC
Q 024115           12 HVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYR   91 (272)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~s~~n~~~~t~~g~~~~~~~lA~~v~~ll~~~~~~~~i~lVGHSmGG~VaR~al~~l~~   91 (272)
                      .+.+++|+++++|.+   +|+.|.     .+..++. . +.+++++.++++ +++++++++|||||||.++-.+++..+|
T Consensus        49 ~l~~~g~~vi~~D~~---G~G~S~-----~~~~~~~-~-~~~a~dl~~ll~-~l~~~~~~lvGhS~GG~i~~~~~a~~~p  117 (281)
T 3fob_A           49 ALVEAGYRVITYDRR---GFGKSS-----QPWEGYE-Y-DTFTSDLHQLLE-QLELQNVTLVGFSMGGGEVARYISTYGT  117 (281)
T ss_dssp             HHHHTTEEEEEECCT---TSTTSC-----CCSSCCS-H-HHHHHHHHHHHH-HTTCCSEEEEEETTHHHHHHHHHHHHCS
T ss_pred             HHHhCCCEEEEeCCC---CCCCCC-----CCccccC-H-HHHHHHHHHHHH-HcCCCcEEEEEECccHHHHHHHHHHccc
Confidence            455678999999966   677776     3333433 3 778999999999 7999999999999999855244445456


Q ss_pred             CCCcCCCCCCccccccccccccccccccceeEEecC--CCCCCCCCCCcccchhhhHHHHHHHHHHH---HHHhhcccch
Q 024115           92 PPKIENGEESSADTSSENSRGTMAGLEAINFITVAT--PHLGSRGNKQVPFLFGVTAFEKAANFVIH---LIFRRTGRHL  166 (272)
Q Consensus        92 ~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~v~~at--P~~G~~~~~~~p~~~g~~~~~~~~~~~~~---~~~~~s~~~l  166 (272)
                      +++                         ..++.+++  |.............. ...+..+...+..   .++.......
T Consensus       118 ~~v-------------------------~~lvl~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~  171 (281)
T 3fob_A          118 DRI-------------------------EKVVFAGAVPPYLYKSEDHPEGALD-DATIETFKSGVINDRLAFLDEFTKGF  171 (281)
T ss_dssp             TTE-------------------------EEEEEESCCCSCCBCCSSSTTCSBC-HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cce-------------------------eEEEEecCCCcchhccccccccccc-hhHHHHHHHHhhhhHHHHHHHHHHHh
Confidence            654                         24555543  222111000000000 0001111100000   0000000000


Q ss_pred             hccC--CCC----------------Cchh---hHhhhccCCcchHHHHHhccCCccEEEEecCCCeeecceeccccccCC
Q 024115          167 FLND--NDE----------------GRPP---LLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHIVGWRTSSIRRNSE  225 (272)
Q Consensus       167 ~l~d--~~~----------------~~~~---~L~~l~~~~~~~d~~~~L~~f~~p~L~~~g~~D~iVP~~sa~l~~~~~  225 (272)
                      +-..  ...                ....   .+..+.    ..++.+.|+++++|+|+++|++|.++|++.+....++.
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~d~~~~l~~i~~P~Lii~G~~D~~~p~~~~~~~~~~~  247 (281)
T 3fob_A          172 FAAGDRTDLVSESFRLYNWDIAAGASPKGTLDCITAFS----KTDFRKDLEKFNIPTLIIHGDSDATVPFEYSGKLTHEA  247 (281)
T ss_dssp             TCBTTBCCSSCHHHHHHHHHHHHTSCHHHHHHHHHHHH----HCCCHHHHTTCCSCEEEEEETTCSSSCGGGTHHHHHHH
T ss_pred             cccccccccchHHHHHHhhhhhcccChHHHHHHHHHcc----ccchhhhhhhcCCCEEEEecCCCCCcCHHHHHHHHHHh
Confidence            0000  000                0000   111111    12466789999999999999999999998662222235


Q ss_pred             CCCCcccccCCCCCcccccCCccCCchhhc
Q 024115          226 LPKWEDSLDEKYPHIVHHEHCKACDAEQLD  255 (272)
Q Consensus       226 ip~a~l~i~~~~~H~~~~e~p~~v~~~~~~  255 (272)
                      +|++++++++++||.+++|+|+++++..++
T Consensus       248 ~p~~~~~~i~~~gH~~~~e~p~~~~~~i~~  277 (281)
T 3fob_A          248 IPNSKVALIKGGPHGLNATHAKEFNEALLL  277 (281)
T ss_dssp             STTCEEEEETTCCTTHHHHTHHHHHHHHHH
T ss_pred             CCCceEEEeCCCCCchhhhhHHHHHHHHHH
Confidence            899999999999999999999999887654

PyMOL of 3fob

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11}	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans}	Back alignment and structure

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus}	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A*	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli}	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica}	Back alignment and structure

>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A*	Back alignment and structure

>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A*	Back alignment and structure

>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ...	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A*	Back alignment and structure

>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus}	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L}	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A*	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis}	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A	Back alignment and structure

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10	Back alignment and structure

>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A	Back alignment and structure

>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A	Back alignment and structure

>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10	Back alignment and structure

>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified}	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis}	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica}	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni}	Back alignment and structure

>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A*	Back alignment and structure

>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A*	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus}	Back alignment and structure

>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str}	Back alignment and structure

>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens}	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A*	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A*	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis}	Back alignment and structure

>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida}	Back alignment and structure

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A*	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A	Back alignment and structure

>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A*	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti}	Back alignment and structure

>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35	Back alignment and structure

>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A*	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum}	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A	Back alignment and structure

>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A*	Back alignment and structure

>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A*	Back alignment and structure

>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis}	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A	Back alignment and structure

>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A*	Back alignment and structure

>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A*	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP}	Back alignment and structure

>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2}	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P	Back alignment and structure

>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens}	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31	Back alignment and structure

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A	Back alignment and structure

>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A*	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23	Back alignment and structure

>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A*	Back alignment and structure

>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp}	Back alignment and structure

>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis}	Back alignment and structure

>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua}	Back alignment and structure

>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A*	Back alignment and structure

>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A	Back alignment and structure

>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2	Back alignment and structure

>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp}	Back alignment and structure

>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV}	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27	Back alignment and structure

>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A	Back alignment and structure

>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp}	Back alignment and structure

>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii}	Back alignment and structure

>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei}	Back alignment and structure

>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}	Back alignment and structure

>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36	Back alignment and structure

>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus}	Back alignment and structure

>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14	Back alignment and structure

>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16	Back alignment and structure

>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A	Back alignment and structure

>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36	Back alignment and structure

>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41	Back alignment and structure

>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18	Back alignment and structure

>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A*	Back alignment and structure

>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP}	Back alignment and structure

>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*	Back alignment and structure

>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina}	Back alignment and structure

>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14	Back alignment and structure

>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A*	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis}	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A*	Back alignment and structure

>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens}	Back alignment and structure

>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A*	Back alignment and structure

>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp}	Back alignment and structure

>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A*	Back alignment and structure

>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A	Back alignment and structure

>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans}	Back alignment and structure

>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A	Back alignment and structure

>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa}	Back alignment and structure

>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A*	Back alignment and structure

>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A	Back alignment and structure

>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14	Back alignment and structure

>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0	Back alignment and structure

>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A	Back alignment and structure

>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14	Back alignment and structure

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A*	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0	Back alignment and structure

>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B*	Back alignment and structure

>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A	Back alignment and structure

>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon}	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0	Back alignment and structure

>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A	Back alignment and structure

>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis}	Back alignment and structure

>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22	Back alignment and structure

>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0	Back alignment and structure

>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A	Back alignment and structure

>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus}	Back alignment and structure

>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21	Back alignment and structure

>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A*	Back alignment and structure

>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A*	Back alignment and structure

>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A	Back alignment and structure

>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A	Back alignment and structure

>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2	Back alignment and structure

>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A*	Back alignment and structure

>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp}	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A	Back alignment and structure

>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A	Back alignment and structure

>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822}	Back alignment and structure

>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium}	Back alignment and structure

>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum}	Back alignment and structure

>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A*	Back alignment and structure

>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A	Back alignment and structure

>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A*	Back alignment and structure

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens}	Back alignment and structure

>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A	Back alignment and structure

>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi}	Back alignment and structure

>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A*	Back alignment and structure

>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A*	Back alignment and structure

>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A*	Back alignment and structure

>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A*	Back alignment and structure

>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A	Back alignment and structure

>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A	Back alignment and structure

>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A	Back alignment and structure

>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17	Back alignment and structure

>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus}	Back alignment and structure

>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19	Back alignment and structure

>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A*	Back alignment and structure

>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A	Back alignment and structure

>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A	Back alignment and structure

>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A*	Back alignment and structure

>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp}	Back alignment and structure

>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0	Back alignment and structure

>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum}	Back alignment and structure

>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae}	Back alignment and structure

>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A*	Back alignment and structure

>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579}	Back alignment and structure

>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A*	Back alignment and structure

>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens}	Back alignment and structure

>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A*	Back alignment and structure

>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A*	Back alignment and structure

>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis}	Back alignment and structure

>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A*	Back alignment and structure

>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21	Back alignment and structure

>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis}	Back alignment and structure

>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A*	Back alignment and structure

>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP}	Back alignment and structure

>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A*	Back alignment and structure

>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A	Back alignment and structure

>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ...	Back alignment and structure

>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30	Back alignment and structure

>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis}	Back alignment and structure

>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29}	Back alignment and structure

>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A*	Back alignment and structure

>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP}	Back alignment and structure

>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B*	Back alignment and structure

>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A*	Back alignment and structure

>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A	Back alignment and structure

>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A	Back alignment and structure

>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		272
d1ei9a_		279	c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {C	1e-08
d1tcaa_		317	c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand	5e-04
d1ku0a_		388	c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophi	5e-04
d1ex9a_		285	c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax	0.003

>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 279	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Thioesterases
domain: Palmitoyl protein thioesterase 1
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 52.2 bits (125), Expect = 1e-08
 Identities = 13/105 (12%), Positives = 30/105 (28%), Gaps = 26/105 (24%)

Query: 28  WIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLR-KISFVAHSVGGLVARYAI 86
            +  +   + + +   +   +        V +++ +   L+   + +  S GG   R   
Sbjct: 39  HVLSLEIGKTLREDVENSFFLNVNSQVTTVCQILAKDPKLQQGYNAMGFSQGGQFLRAVA 98

Query: 87  GKLYRPPKIENGEESSADTSSENSRGTMAGLEAINFITVATPHLG 131
            +   PP                          +N I+V   H G
Sbjct: 99  QRCPSPP-------------------------MVNLISVGGQHQG 118

PyMOL of d1ei9a_

>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317	Back information, alignment and structure

>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Length = 388	Back information, alignment and structure

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		272
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	99.67
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	99.67
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	99.66
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	99.66
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	99.64
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	99.62
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	99.62
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	99.62
d1a88a_		275	Chloroperoxidase L {Streptomyces lividans [TaxId:	99.62
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	99.62
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	99.62
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	99.61
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	99.6
d1m33a_		256	Biotin biosynthesis protein BioH {Escherichia coli	99.56
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	99.55
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	99.55
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	99.55
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	99.54
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	99.52
d1pjaa_		268	Palmitoyl protein thioesterase 2 {Human (Homo sapi	99.51
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	99.49
d1ispa_		179	Lipase A {Bacillus subtilis [TaxId: 1423]}	99.49
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	99.42
d1ei9a_		279	Palmitoyl protein thioesterase 1 {Cow (Bos taurus)	99.41
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	99.4
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	99.38
d1ex9a_		285	Lipase {Pseudomonas aeruginosa [TaxId: 287]}	99.37
d1tcaa_		317	Triacylglycerol lipase {Yeast (Candida antarctica)	99.35
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	99.33
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	99.32
d1wm1a_		313	Proline aminopeptidase {Serratia marcescens [TaxId	99.26
d1thta_		302	Myristoyl-ACP-specific thioesterase {Vibrio harvey	99.15
d1uxoa_		186	Hypothetical protein YdeN {Bacillus subtilis [TaxI	99.03
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	98.99
d1jmkc_		230	Surfactin synthetase, SrfA {Bacillus subtilis [Tax	98.98
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	98.84
d2vata1		376	Acetyl-CoA:deacetylcephalosporin C acetyltransfera	98.8
d2jbwa1		360	2,6-dihydropseudooxynicotine hydrolase {Arthrobact	98.75
d1qo7a_		394	Bacterial epoxide hydrolase {Aspergillus niger [Ta	98.74
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	98.7
d1ku0a_		388	Lipase L1 {Bacillus stearothermophilus [TaxId: 142	98.68
d1ufoa_		238	Hypothetical protein TT1662 {Thermus thermophilus	98.41
d2dsta1		122	Hypothetical protein TTHA1544 {Thermus thermophilu	98.3
d1fj2a_		229	Acyl protein thioesterase 1 {Human (Homo sapiens)	98.28
d1xkta_		286	Fatty acid synthase {Human (Homo sapiens) [TaxId:	98.27
d1l7aa_		318	Cephalosporin C deacetylase {Bacillus subtilis [Ta	98.21
d2pl5a1		362	Homoserine O-acetyltransferase {Leptospira interro	98.2
d2hu7a2		260	Acylamino-acid-releasing enzyme, C-terminal donain	98.2
d2b61a1		357	Homoserine O-acetyltransferase {Haemophilus influe	98.16
d1vlqa_		322	Acetyl xylan esterase TM0077 {Thermotoga maritima	98.02
d1mo2a_		255	Erythromycin polyketide synthase {Saccharopolyspor	98.0
d1jfra_		260	Lipase {Streptomyces exfoliatus [TaxId: 1905]}	97.98
d1vkha_		263	Putative serine hydrolase Ydr428c {Baker's yeast (	97.96
d1xfda2		258	Dipeptidyl aminopeptidase-like protein 6, DPP6, C-	97.84
d2r8ba1		203	Uncharacterized protein Atu2452 {Agrobacterium tum	97.79
d3b5ea1		209	Uncharacterized protein Mll8374 {Mesorhizobium lot	97.79
d1dina_		233	Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI	97.7
d2h1ia1		202	Carboxylesterase {Bacillus cereus [TaxId: 1396]}	97.66
d2bgra2		258	Dipeptidyl peptidase IV/CD26, C-terminal domain {P	97.54
d1auoa_		218	Carboxylesterase {Pseudomonas fluorescens [TaxId:	97.47
d2i3da1		218	Hypothetical protein Atu1826 {Agrobacterium tumefa	97.4
d1tiba_		269	Triacylglycerol lipase {Thermomyces lanuginosus, f	97.17
d1tiaa_		271	Triacylglycerol lipase {Penicillium camembertii [T	97.06
d1lgya_		265	Triacylglycerol lipase {Rhizopus niveus [TaxId: 48	97.06
d3tgla_		265	Triacylglycerol lipase {Rhizomucor miehei [TaxId:	97.03
d1uwca_		261	Feruloyl esterase A {Aspergillus niger [TaxId: 506	97.0
d2d81a1		318	Polyhydroxybutyrate depolymerase {Penicillium funi	96.99
d2pbla1		261	Uncharacterized protein TM1040_2492 {Silicibacter	96.46
d1dqza_		280	Antigen 85c {Mycobacterium tuberculosis [TaxId: 17	96.17
d1r88a_		267	Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta	96.06
d1jjfa_		255	Feruloyl esterase domain of the cellulosomal xylan	95.76
d1rp1a2		337	Pancreatic lipase, N-terminal domain {Dog (Canis f	95.71
d1sfra_		288	Antigen 85a {Mycobacterium tuberculosis [TaxId: 17	95.64
d1bu8a2		338	Pancreatic lipase, N-terminal domain {Rat (Rattus	95.43
d3c8da2		246	Enterochelin esterase, catalytic domain {Shigella	95.19
d1lnsa3		405	X-Prolyl dipeptidyl aminopeptidase PepX, middle do	94.49
d1pv1a_		299	Hypothetical esterase YJL068C {Baker's yeast (Sacc	93.92
d1qlwa_		318	A novel bacterial esterase {Alcaligenes sp. [TaxId	93.84
d1wb4a1		273	Feruloyl esterase domain of the cellulosomal xylan	92.9
d1cexa_		197	Cutinase {Fungus (Fusarium solani), subsp. pisi [T	90.91
d1qfma2		280	Prolyl oligopeptidase, C-terminal domain {Pig (Sus	90.32
d2gzsa1		265	Enterobactin and salmochelin hydrolase IroE {Esche	88.88
d1mpxa2		381	Alpha-amino acid ester hydrolase {Xanthomonas citr	87.13
d1qoza_		207	Acetylxylan esterase {Trichoderma reesei [TaxId: 5	83.81
d1ju3a2		347	Bacterial cocaine esterase N-terminal domain {Rhod	83.32
d1g66a_		207	Acetylxylan esterase {Penicillium purpurogenum [Ta	83.18

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Aclacinomycin methylesterase RdmC
domain: Aclacinomycin methylesterase RdmC
species: Streptomyces purpurascens [TaxId: 1924]

Probab=99.67  E-value=1.3e-17  Score=143.10  Aligned_cols=207  Identities=11%  Similarity=-0.012  Sum_probs=121.4

Q ss_pred             hhhhhhhhhhccCCcceEEEEccCCCCCCCCCCcHHHHHHHHHHHHHHHHHHhcCCCeEEEEEechhHHHHHHHHHhhcC
Q 024115           12 HVKLVQYWCLSFHNICWIHFVGSERNMSKLTLDGVDVMGERLAQEVLEVIERKRNLRKISFVAHSVGGLVARYAIGKLYR   91 (272)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~s~~n~~~~t~~g~~~~~~~lA~~v~~ll~~~~~~~~i~lVGHSmGG~VaR~al~~l~~   91 (272)
                      ++.+++|+++++|.+   +++.|.....  +..++. . +.+++++.++++ +++++++++|||||||.++ +.++..+|
T Consensus        45 ~l~~~g~~vi~~D~~---G~G~S~~~~~--~~~~~~-~-~~~~~d~~~ll~-~l~~~~~~lvGhS~Gg~~a-~~~a~~~P  115 (297)
T d1q0ra_          45 RLADGGLHVIRYDHR---DTGRSTTRDF--AAHPYG-F-GELAADAVAVLD-GWGVDRAHVVGLSMGATIT-QVIALDHH  115 (297)
T ss_dssp             HHHTTTCEEEEECCT---TSTTSCCCCT--TTSCCC-H-HHHHHHHHHHHH-HTTCSSEEEEEETHHHHHH-HHHHHHCG
T ss_pred             HHHhCCCEEEEEeCC---CCcccccccc--cccccc-c-chhhhhhccccc-cccccceeeccccccchhh-hhhhcccc
Confidence            455678999999976   6888753322  112222 2 677899999999 7999999999999999999 76777788


Q ss_pred             CCCcCCCCCCccccccccccccccccccceeEEecCCCCCCCCCC-------------CcccchhhhHHHHH--------
Q 024115           92 PPKIENGEESSADTSSENSRGTMAGLEAINFITVATPHLGSRGNK-------------QVPFLFGVTAFEKA--------  150 (272)
Q Consensus        92 ~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~v~~atP~~G~~~~~-------------~~p~~~g~~~~~~~--------  150 (272)
                      +++.                         .++.++++........             ..+. .....+..+        
T Consensus       116 ~~v~-------------------------~lvli~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~  169 (297)
T d1q0ra_         116 DRLS-------------------------SLTMLLGGGLDIDFDANIERVMRGEPTLDGLPG-PQQPFLDALALMNQPAE  169 (297)
T ss_dssp             GGEE-------------------------EEEEESCCCTTCCHHHHHHHHHHTCCCSSCSCC-CCHHHHHHHHHHHSCCC
T ss_pred             ccee-------------------------eeEEEccccccccchhhhHHHhhhhhhhhhhhh-hhHHHHHHHHHhccccc
Confidence            7643                         4455544432211000             0000 000000110        


Q ss_pred             ------HHHHHHH-HHhhcccch-----------hccCCCCCchhhHhhhccCCcchHHHHHhccCCccEEEEecCCCee
Q 024115          151 ------ANFVIHL-IFRRTGRHL-----------FLNDNDEGRPPLLRRMVEDEDENYFMSALCAFKRRVAYSNACYDHI  212 (272)
Q Consensus       151 ------~~~~~~~-~~~~s~~~l-----------~l~d~~~~~~~~L~~l~~~~~~~d~~~~L~~f~~p~L~~~g~~D~i  212 (272)
                            ...+..+ .+.......           .......................+....|+++++|+|+++|.+|.+
T Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~Pvlvi~G~~D~~  249 (297)
T d1q0ra_         170 GRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPI  249 (297)
T ss_dssp             SHHHHHHHHHHHHHHHHCSSSCCCHHHHHHHHHHHHHHTTTCCSCCCGGGGCCCCCGGGGGGGGGCCSCEEEEEETTCSS
T ss_pred             hhhHHHHHHHHHHhhhccccccchHHHHHHHHHHhhhhccccchhhhhhhhhhhccccchhhhhccCCceEEEEeCCCCC
Confidence                  0000000 000000000           0000000000000000000012356667899999999999999999


Q ss_pred             ecceec-cccccCCCCCCcccccCCCCCcccccCCccCCchhhc
Q 024115          213 VGWRTS-SIRRNSELPKWEDSLDEKYPHIVHHEHCKACDAEQLD  255 (272)
Q Consensus       213 VP~~sa-~l~~~~~ip~a~l~i~~~~~H~~~~e~p~~v~~~~~~  255 (272)
                      +|++.+ .+..  .+|++++++++++||.++.|+|++++...+.
T Consensus       250 ~~~~~~~~~~~--~~p~~~~~~i~~~gH~~~~e~p~~~~~~i~~  291 (297)
T d1q0ra_         250 APAPHGKHLAG--LIPTARLAEIPGMGHALPSSVHGPLAEVILA  291 (297)
T ss_dssp             SCTTHHHHHHH--TSTTEEEEEETTCCSSCCGGGHHHHHHHHHH
T ss_pred             CCHHHHHHHHH--hCCCCEEEEECCCCCcchhhCHHHHHHHHHH
Confidence            999887 4443  6899999999999999999999999776554

PyMOL of d1q0ra_

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}	Back information, alignment and structure

>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]}	Back information, alignment and structure

>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}	Back information, alignment and structure

>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]}	Back information, alignment and structure

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]}	Back information, alignment and structure

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}	Back information, alignment and structure

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]}	Back information, alignment and structure

>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}	Back information, alignment and structure

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]}	Back information, alignment and structure

>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}	Back information, alignment and structure

>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}	Back information, alignment and structure

>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}	Back information, alignment and structure

>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]}	Back information, alignment and structure

>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}	Back information, alignment and structure

>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]}	Back information, alignment and structure

>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}	Back information, alignment and structure

>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]}	Back information, alignment and structure