Citrus Sinensis ID: 024256
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 270 | ||||||
| 118484915 | 541 | unknown [Populus trichocarpa] | 0.959 | 0.478 | 0.793 | 1e-118 | |
| 449440540 | 540 | PREDICTED: CBS domain-containing protein | 0.959 | 0.479 | 0.789 | 1e-117 | |
| 255540203 | 545 | conserved hypothetical protein [Ricinus | 0.959 | 0.475 | 0.793 | 1e-117 | |
| 359491097 | 541 | PREDICTED: CBS domain-containing protein | 0.955 | 0.476 | 0.762 | 1e-110 | |
| 225456355 | 546 | PREDICTED: CBS domain-containing protein | 0.955 | 0.472 | 0.762 | 1e-110 | |
| 125528914 | 497 | hypothetical protein OsI_04983 [Oryza sa | 0.925 | 0.503 | 0.738 | 1e-108 | |
| 224122050 | 535 | predicted protein [Populus trichocarpa] | 0.955 | 0.482 | 0.731 | 1e-108 | |
| 357126564 | 550 | PREDICTED: CBS domain-containing protein | 0.959 | 0.470 | 0.701 | 1e-106 | |
| 326509897 | 550 | predicted protein [Hordeum vulgare subsp | 0.925 | 0.454 | 0.718 | 1e-105 | |
| 356511510 | 542 | PREDICTED: CBS domain-containing protein | 0.925 | 0.461 | 0.743 | 1e-104 |
| >gi|118484915|gb|ABK94323.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 430 bits (1105), Expect = e-118, Method: Compositional matrix adjust.
Identities = 207/261 (79%), Positives = 229/261 (87%), Gaps = 2/261 (0%)
Query: 1 MERAAEKGKAIAAAVEGVEKHWGTSISGPNTFIETLRERMFRPSLSTIIPEKSKVVTISP 60
MERAAEKGKAIAAAVEGVEK+WGTSIS PNTFIETLRERMFRP+LSTIIPE SKVVT+SP
Sbjct: 175 MERAAEKGKAIAAAVEGVEKNWGTSISVPNTFIETLRERMFRPALSTIIPENSKVVTVSP 234
Query: 61 TDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLVEKVMTPNP 120
++TVL+ TKKMLE R AVVTV+ KPRGI TSKDILMRVI+QNLP DSTLVEKVMTPNP
Sbjct: 235 SETVLVVTKKMLESRSGCAVVTVDEKPRGIFTSKDILMRVIAQNLPPDSTLVEKVMTPNP 294
Query: 121 ECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAVATVGNTAGSNNEA 180
ECATIDTPIVDALH MHDGKFLHLPVVDRDG++V V+DVIHITHAAVATVGNT G+NNE
Sbjct: 295 ECATIDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVIDVIHITHAAVATVGNTTGANNET 354
Query: 181 ASTMMQKFWDSAMALSPNDDEEDNRSEGSLKFASEGADTARYLSYPSPSPGVPSAFAFKV 240
ASTMMQKFWDSAMA+SPNDDE++ RSEGSLK ASEG +TAR L Y PS G+P+ F+FK+
Sbjct: 355 ASTMMQKFWDSAMAMSPNDDEDETRSEGSLKIASEGTETARSLLY--PSSGLPNNFSFKI 412
Query: 241 QDNKGLMHRFTCGMLPFPNFI 261
+D KG MHRFTC + I
Sbjct: 413 EDKKGRMHRFTCETRSLTDLI 433
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449440540|ref|XP_004138042.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis sativus] gi|449520507|ref|XP_004167275.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255540203|ref|XP_002511166.1| conserved hypothetical protein [Ricinus communis] gi|223550281|gb|EEF51768.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359491097|ref|XP_003634219.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 2 [Vitis vinifera] gi|297734436|emb|CBI15683.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225456355|ref|XP_002283958.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|125528914|gb|EAY77028.1| hypothetical protein OsI_04983 [Oryza sativa Indica Group] gi|125573153|gb|EAZ14668.1| hypothetical protein OsJ_04591 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|224122050|ref|XP_002318739.1| predicted protein [Populus trichocarpa] gi|222859412|gb|EEE96959.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357126564|ref|XP_003564957.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|326509897|dbj|BAJ87164.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|356511510|ref|XP_003524468.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 270 | ||||||
| TAIR|locus:2167331 | 543 | AT5G63490 "AT5G63490" [Arabido | 0.896 | 0.445 | 0.58 | 2.1e-70 | |
| ASPGD|ASPL0000033419 | 666 | AN5716 [Emericella nidulans (t | 0.622 | 0.252 | 0.318 | 1.3e-16 | |
| CGD|CAL0003543 | 605 | orf19.5238 [Candida albicans ( | 0.766 | 0.342 | 0.288 | 1.4e-15 | |
| POMBASE|SPAC24C9.05c | 730 | mug70 "conserved protein Mug20 | 0.629 | 0.232 | 0.241 | 3.9e-08 | |
| UNIPROTKB|Q5LRC8 | 144 | SPO2201 "CBS domain protein" [ | 0.374 | 0.701 | 0.288 | 6.2e-05 | |
| TIGR_CMR|SPO_2201 | 144 | SPO_2201 "CBS domain protein" | 0.374 | 0.701 | 0.288 | 6.2e-05 | |
| UNIPROTKB|Q8EDA6 | 620 | SO_2856 "Putative nucleotidylt | 0.362 | 0.158 | 0.336 | 0.00033 | |
| TIGR_CMR|SO_2856 | 620 | SO_2856 "CBS domain protein" [ | 0.362 | 0.158 | 0.336 | 0.00033 | |
| TAIR|locus:2183740 | 206 | CBSX3 "AT5G10860" [Arabidopsis | 0.311 | 0.407 | 0.303 | 0.00033 |
| TAIR|locus:2167331 AT5G63490 "AT5G63490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 713 (256.0 bits), Expect = 2.1e-70, P = 2.1e-70
Identities = 145/250 (58%), Positives = 174/250 (69%)
Query: 1 MERXXXXXXXXXXXXXXXXXHWGTSISGPNTFIETLRERMFRPSLSTIIPEKSKVVTISP 60
MER WGT+ S PNTFIETLR+RMFRPSLSTIIP+ +KV+ +SP
Sbjct: 178 MERAAEKGKAIAAAVEGVEKSWGTNTSVPNTFIETLRDRMFRPSLSTIIPDDTKVLKVSP 237
Query: 61 TDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLVEKVMTPNP 120
TDTVL KKM+E + S AVV +E+K RGI TSKDILMRV+++NLP TLVE VMT NP
Sbjct: 238 TDTVLTVAKKMVEFQSSCAVVIIEDKLRGIFTSKDILMRVVAENLPPSETLVETVMTQNP 297
Query: 121 ECATIDTPIVDALHIMHDGKFLHLPXXXXXXXXXXXXXXIHITHAAVATVGNTAGSNNEA 180
E +DTPIV+ALHIMH+GKFLHLP IH+THAAVAT G TAG NEA
Sbjct: 298 ESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGNEA 357
Query: 181 ASTMMQKFWDSAMALSPNDDEEDNRSEGSLKFASEGADTARYLSYPSPSPGVPSAFAFKV 240
+TMMQKFWDSAMALSPN+D+ED+RSE S+K ASE A+T + S+P + F+FK+
Sbjct: 358 TNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASE-AETGK--SFP-----FANTFSFKI 409
Query: 241 QDNKGLMHRF 250
+D K HRF
Sbjct: 410 EDKKHRKHRF 419
|
|
| ASPGD|ASPL0000033419 AN5716 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003543 orf19.5238 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC24C9.05c mug70 "conserved protein Mug20" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LRC8 SPO2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2201 SPO_2201 "CBS domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8EDA6 SO_2856 "Putative nucleotidyltransferase DUF294" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2856 SO_2856 "CBS domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2183740 CBSX3 "AT5G10860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00017958001 | SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (541 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 270 | |||
| cd04587 | 113 | cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd | 8e-52 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 1e-23 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 3e-23 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 1e-22 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 3e-21 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 6e-17 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 2e-15 | |
| cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after | 4e-15 | |
| cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after | 5e-13 | |
| cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after | 8e-13 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 9e-13 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 1e-12 | |
| cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after h | 1e-12 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 3e-11 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 3e-11 | |
| cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain | 3e-11 | |
| cd04601 | 110 | cd04601, CBS_pair_IMPDH, This cd contains two tand | 2e-10 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 6e-10 | |
| cd04589 | 111 | cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd | 6e-10 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 1e-09 | |
| cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two | 1e-09 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-09 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 3e-09 | |
| cd04625 | 112 | cd04625, CBS_pair_12, The CBS domain, named after | 6e-09 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 7e-09 | |
| COG2524 | 294 | COG2524, COG2524, Predicted transcriptional regula | 7e-09 | |
| PTZ00314 | 495 | PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd | 8e-09 | |
| cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai | 1e-08 | |
| cd04620 | 115 | cd04620, CBS_pair_7, The CBS domain, named after h | 1e-08 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 2e-08 | |
| cd04635 | 122 | cd04635, CBS_pair_22, The CBS domain, named after | 3e-08 | |
| cd04630 | 114 | cd04630, CBS_pair_17, The CBS domain, named after | 3e-08 | |
| TIGR01302 | 450 | TIGR01302, IMP_dehydrog, inosine-5'-monophosphate | 5e-08 | |
| PRK05567 | 486 | PRK05567, PRK05567, inosine 5'-monophosphate dehyd | 6e-08 | |
| cd04610 | 107 | cd04610, CBS_pair_ParBc_assoc, This cd contains tw | 9e-08 | |
| COG3448 | 382 | COG3448, COG3448, CBS-domain-containing membrane p | 2e-07 | |
| cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains | 8e-07 | |
| cd04629 | 114 | cd04629, CBS_pair_16, The CBS domain, named after | 1e-06 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 1e-06 | |
| cd04641 | 120 | cd04641, CBS_pair_28, The CBS domain, named after | 1e-06 | |
| cd04609 | 110 | cd04609, CBS_pair_PALP_assoc2, This cd contains tw | 1e-06 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 3e-06 | |
| cd04596 | 108 | cd04596, CBS_pair_DRTGG_assoc, This cd contains tw | 4e-06 | |
| pfam00478 | 467 | pfam00478, IMPDH, IMP dehydrogenase / GMP reductas | 5e-06 | |
| TIGR00393 | 268 | TIGR00393, kpsF, KpsF/GutQ family protein | 8e-06 | |
| cd04602 | 114 | cd04602, CBS_pair_IMPDH_2, This cd contains two ta | 8e-06 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 1e-05 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 2e-05 | |
| cd04634 | 143 | cd04634, CBS_pair_21, The CBS domain, named after | 2e-05 | |
| cd04632 | 128 | cd04632, CBS_pair_19, The CBS domain, named after | 4e-05 | |
| cd04615 | 113 | cd04615, CBS_pair_2, The CBS domain, named after h | 7e-05 | |
| cd04613 | 114 | cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con | 1e-04 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 1e-04 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 1e-04 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 2e-04 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 3e-04 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 4e-04 | |
| cd04599 | 105 | cd04599, CBS_pair_GGDEF_assoc2, This cd contains t | 5e-04 | |
| cd04599 | 105 | cd04599, CBS_pair_GGDEF_assoc2, This cd contains t | 6e-04 | |
| cd04643 | 116 | cd04643, CBS_pair_30, The CBS domain, named after | 6e-04 | |
| COG2239 | 451 | COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains | 7e-04 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 8e-04 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 0.001 | |
| PRK07807 | 479 | PRK07807, PRK07807, inosine 5-monophosphate dehydr | 0.002 | |
| COG4109 | 432 | COG4109, COG4109, Predicted transcriptional regula | 0.002 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 0.003 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 0.003 | |
| PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent i | 0.004 |
| >gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
Score = 164 bits (418), Expect = 8e-52
Identities = 65/113 (57%), Positives = 82/113 (72%)
Query: 53 SKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLV 112
+K T+SPT TV A K M E R+S +V NK GI TSKDI +RV++Q L +STLV
Sbjct: 1 TKPATVSPTTTVQEAAKLMREKRVSCVLVMDGNKLVGIFTSKDIALRVVAQGLDPESTLV 60
Query: 113 EKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHA 165
E+VMTPNP CAT DTP+++ALH+M GKF HLPVVD+ G VV ++DV +THA
Sbjct: 61 ERVMTPNPVCATSDTPVLEALHLMVQGKFRHLPVVDKSGQVVGLLDVTKLTHA 113
|
Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Length = 113 |
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239962 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239997 cd04625, CBS_pair_12, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|240006 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain | Back alignment and domain information |
|---|
| >gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >gnl|CDD|239975 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240014 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225148 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226594 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.87 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.86 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.84 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.83 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.82 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.81 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.81 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.79 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.79 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.78 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.76 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.75 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.74 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.73 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.72 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.72 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.72 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.72 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.71 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.71 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.71 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.7 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.7 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.69 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.69 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.69 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.69 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.69 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.69 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.68 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.68 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.68 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.68 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.67 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.67 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.67 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.67 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.67 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.67 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.67 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.67 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.66 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.66 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.66 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.66 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.66 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.66 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.66 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.66 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.66 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.66 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 99.65 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.65 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.65 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.65 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.65 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.65 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.64 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.64 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.64 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.64 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.64 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.64 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.64 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.63 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.63 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.63 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.63 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.62 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.62 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.62 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.62 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.62 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.6 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.6 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.59 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.59 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.58 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.58 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.58 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.58 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.57 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.56 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.55 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.55 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.53 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.49 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.48 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.47 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.43 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.43 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.41 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.37 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.34 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.3 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.25 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.24 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.21 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.19 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.18 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.18 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.16 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.12 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.11 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.04 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.01 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.01 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.01 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.01 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 98.98 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 98.96 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.94 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.92 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 98.92 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 98.91 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 98.9 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.9 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 98.9 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 98.89 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 98.88 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 98.88 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.87 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 98.87 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 98.87 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 98.85 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 98.85 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 98.85 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 98.85 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 98.85 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 98.83 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 98.82 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.82 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 98.82 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 98.82 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 98.81 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 98.81 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 98.81 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 98.79 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 98.79 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 98.78 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 98.78 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 98.76 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 98.76 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 98.76 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 98.76 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 98.76 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.76 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 98.75 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 98.74 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 98.74 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 98.72 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 98.72 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 98.72 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 98.71 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 98.71 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 98.7 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 98.7 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 98.69 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 98.68 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 98.68 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 98.68 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 98.68 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 98.68 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 98.67 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 98.67 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 98.67 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 98.66 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 98.66 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 98.66 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 98.65 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 98.64 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 98.64 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 98.63 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 98.61 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 98.6 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 98.58 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 98.58 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 98.56 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 98.54 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 98.53 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 98.52 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 98.52 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 98.49 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 98.49 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.49 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.48 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 98.44 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 98.44 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 98.36 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 98.36 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.31 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.3 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 98.24 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.24 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 98.22 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.19 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 98.09 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.83 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 97.33 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 97.23 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 97.08 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 97.03 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 96.85 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 96.77 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 95.96 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 95.32 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 94.9 | |
| cd06409 | 86 | PB1_MUG70 The MUG70 protein is a product of the me | 94.47 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 93.38 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 89.18 | |
| COG0516 | 170 | GuaB IMP dehydrogenase/GMP reductase [Nucleotide t | 84.6 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 80.39 |
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
Probab=99.87 E-value=1.6e-21 Score=178.45 Aligned_cols=151 Identities=24% Similarity=0.302 Sum_probs=139.2
Q ss_pred ChhhhhhhHHHHHHHhhhHHhhCCCCCChhHHHHHHHHhhCCCCccccccCCCceeEECCCCCHHHHHHHHHHCCCcEEE
Q 024256 1 MERAAEKGKAIAAAVEGVEKHWGTSISGPNTFIETLRERMFRPSLSTIIPEKSKVVTISPTDTVLMATKKMLELRLSSAV 80 (270)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~v~~im~~~~~~~~v~~~~tv~~a~~~m~~~~~~~i~ 80 (270)
||+++|.+||+++|+.| |++++|+|.-++...+.+.+.++.++|. ++++++.+++|+.+++++|.+++.+.+|
T Consensus 51 mdtvTe~~MAi~~A~~G-----GigvIh~n~~i~~qae~v~~VKv~eim~--~~pvtv~p~~tI~eA~~lm~~~~~~~~v 123 (475)
T TIGR01303 51 MTAVAGRRMAETVARRG-----GIVILPQDLPIPAVKQTVAFVKSRDLVL--DTPITLAPHDTVSDAMALIHKRAHGAAV 123 (475)
T ss_pred chhhHHHHHHHHHHHCC-----CEEEEeCCCCHHHHHHHHhhcchhhccc--cCCeEECCCCCHHHHHHHHHhcCCeEEE
Confidence 89999999999999999 9999999977888888888889999998 6889999999999999999999999999
Q ss_pred EEeCCEEEEEeeHHHHHHHHHhcCCCCCccchhhccCCCCeeecCCCCHHHHHHHhHhCCCCEEEEEeCCCcEEEEEeHH
Q 024256 81 VTVENKPRGILTSKDILMRVISQNLPADSTLVEKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVI 160 (270)
Q Consensus 81 Vv~~~~~~Givt~~dl~~~~~~~~~~~~~~~v~~im~~~~~~v~~~~~l~~a~~~~~~~~~~~lpVvd~~g~~~Givt~~ 160 (270)
|+++++++|+||.+|+. . ... ..++.++|+++++++++++++.+|+++|.+++.+.+||+|++|+++|+||.+
T Consensus 124 VvD~gklvGIVT~rDL~-~-----~~~-~~~V~dIMt~~litv~~~~sL~eAl~lM~~~~i~~LPVVD~~g~LvGIIT~~ 196 (475)
T TIGR01303 124 VILEDRPVGLVTDSDLL-G-----VDR-FTQVRDIMSTDLVTAPADTEPRKAFDLLEHAPRDVAPLVDADGTLAGILTRT 196 (475)
T ss_pred EEECCEEEEEEEHHHhh-c-----CCC-CCCHHHHccCCceEeCCCCcHHHHHHHHHHcCCCEEEEEcCCCeEEEEEEHH
Confidence 99988999999999984 2 222 3579999999999999999999999999999999999999889999999999
Q ss_pred HHHHH
Q 024256 161 HITHA 165 (270)
Q Consensus 161 dll~~ 165 (270)
||++.
T Consensus 197 DLl~~ 201 (475)
T TIGR01303 197 GALRA 201 (475)
T ss_pred HHHHH
Confidence 99986
|
This model represents a family of proteins, often annotated as a putative IMP dehydrogenase, related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria. All species in which a member is found so far (Corynebacterium glutamicum, Mycobacterium tuberculosis, Streptomyces coelicolor, etc.) also have IMP dehydrogenase as described by TIGRFAMs entry TIGR01302. |
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 270 | |||
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 4e-30 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 7e-04 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 6e-30 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 1e-04 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 1e-28 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 1e-05 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 2e-28 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 4e-05 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 5e-27 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 3e-05 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 8e-27 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-06 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 2e-04 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 7e-26 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 2e-06 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 1e-04 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 3e-24 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 1e-05 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 6e-05 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 6e-23 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 3e-04 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 1e-22 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 4e-22 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 7e-22 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 1e-21 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 2e-21 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 5e-21 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 1e-07 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 8e-04 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 9e-21 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 6e-05 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 4e-20 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 6e-20 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 3e-17 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 4e-08 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-04 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 4e-19 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 8e-09 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-18 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 7e-18 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-17 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-04 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-04 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 2e-18 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 2e-07 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 7e-18 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 6e-08 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 6e-04 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 7e-18 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 3e-04 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 9e-18 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 8e-15 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 5e-08 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 3e-06 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 1e-17 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 8e-08 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 4e-17 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 2e-06 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 8e-17 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 2e-07 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 5e-16 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 5e-15 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 5e-14 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 7e-12 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 8e-04 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 6e-14 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 1e-12 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 4e-11 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 6e-12 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 2e-10 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 2e-09 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 1e-10 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 1e-09 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 3e-09 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 1e-08 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 3e-08 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 8e-08 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 2e-07 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 2e-07 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 4e-07 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 4e-07 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 5e-07 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 6e-07 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 6e-07 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 9e-07 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 2e-06 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 2e-06 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 2e-04 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 9e-04 |
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
Score = 110 bits (276), Expect = 4e-30
Identities = 31/148 (20%), Positives = 64/148 (43%), Gaps = 7/148 (4%)
Query: 27 SGPNTFIETLRERMFRPSLSTIIPE-----KSKVVTISPTDTVLMATKKMLELRLSSAVV 81
S + + RE ++ ++T + + VVT+ P ++ A + ++ + VV
Sbjct: 4 SHHHHHHSSGRENLYFQGMATFVKDLLDRKGRDVVTVGPDVSIGEAAGTLHAHKIGAVVV 63
Query: 82 T-VENKPRGILTSKDILMRVISQNLPADSTLVEKVMTPNPECATIDTPIVDALHIMHDGK 140
T + GI T +D++ V Q + V MT N ++ + IM G+
Sbjct: 64 TDADGVVLGIFTERDLVKAVAGQGAASLQQSVSVAMTKNVVRCQHNSTTDQLMEIMTGGR 123
Query: 141 FLHLPVVDRDGDVVDVVDVIHITHAAVA 168
F H+PV + +G + ++ + + A +
Sbjct: 124 FRHVPVEE-NGRLAGIISIGDVVKARIG 150
|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Length = 473 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Length = 286 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Length = 278 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Length = 205 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.91 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.91 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.91 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.9 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.89 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.88 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.88 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.88 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.88 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.88 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.87 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.87 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.87 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.86 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.86 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.86 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.86 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.86 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.86 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.86 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.86 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.86 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.86 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.85 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.85 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.85 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.84 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.84 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.84 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.84 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.84 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.83 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.83 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.83 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.83 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.83 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.83 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.83 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.82 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.82 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.82 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.82 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.82 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.81 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.81 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.81 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.8 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.79 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.79 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.78 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.78 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.78 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.78 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.77 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.75 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.75 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.75 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.73 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.73 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.72 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.71 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.7 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.7 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.69 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.68 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.66 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.63 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.58 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.58 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.56 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.56 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 99.53 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.53 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.48 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.47 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.47 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.46 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.46 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.46 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.45 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.45 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.43 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.43 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.41 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.41 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.4 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.39 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.39 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.39 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.39 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.37 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.37 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.37 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.37 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.36 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.36 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.35 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.35 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.34 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.34 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.34 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.33 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.33 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.31 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.3 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.28 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.27 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.27 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.26 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.26 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.24 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.21 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 99.21 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.21 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.2 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.15 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 98.98 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 98.97 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 98.9 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 98.88 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.85 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 98.82 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 98.82 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.81 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.66 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.59 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 98.58 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 98.44 |
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
Probab=99.91 E-value=6.8e-25 Score=189.72 Aligned_cols=219 Identities=16% Similarity=0.169 Sum_probs=169.7
Q ss_pred CCCCccccccCCCceeEECCCCCHHHHHHHHHHCCCcEEEEEeCCEEEEEeeHHHHHHHHHhcCCC----------CCcc
Q 024256 41 FRPSLSTIIPEKSKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLP----------ADST 110 (270)
Q Consensus 41 ~~~~v~~im~~~~~~~~v~~~~tv~~a~~~m~~~~~~~i~Vv~~~~~~Givt~~dl~~~~~~~~~~----------~~~~ 110 (270)
..++|+++|+ ++++++++++|+.+|++.|.+++++++||++ |+++|++|..|++ +.+..+.. ....
T Consensus 18 ~~~~V~dim~--~~~~~v~~~~~v~~a~~~m~~~~~~~~~V~d-~~l~GivT~~Di~-~~~~~~~~~~~~~~~~~~~~~~ 93 (296)
T 3ddj_A 18 QGMNIETLMI--KNPPILSKEDRLGSAFKKINEGGIGRIIVAN-EKIEGLLTTRDLL-STVESYCKDSCSQGDLYHISTT 93 (296)
T ss_dssp CCSSGGGTCE--ESCCEECTTSBHHHHHHHTTGGGCCEEEEES-SSEEEEEEHHHHH-GGGTTCC---CCHHHHHHHHTS
T ss_pred cccCHHHhcc--CCCcEECCCccHHHHHHHHHHCCCceEEEEC-CeEEEEEeHHHHH-HHhcccccccccchhhHHHhcc
Confidence 5789999999 6899999999999999999999999999999 9999999999998 55532211 1146
Q ss_pred chhhccCCCCeeecCCCCHHHHHHHhHhCCCCEEEEEeCCCcEEEEEeHHHHHHHHH--------HHhC-------CCCC
Q 024256 111 LVEKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAV--------ATVG-------NTAG 175 (270)
Q Consensus 111 ~v~~im~~~~~~v~~~~~l~~a~~~~~~~~~~~lpVvd~~g~~~Givt~~dll~~~~--------~~~~-------~~~~ 175 (270)
+++++|+++++++++++++.+|++.|.+++++++||+|++|+++|++|.+|+++.+. ..+. ....
T Consensus 94 ~v~~im~~~~~~v~~~~~~~~a~~~m~~~~~~~lpVvd~~~~lvGivt~~dl~~~~~~~~~~~~v~~~m~~~~~~v~~~~ 173 (296)
T 3ddj_A 94 PIIDYMTPNPVTVYNTSDEFTAINIMVTRNFGSLPVVDINDKPVGIVTEREFLLLYKDLDEIFPVKVFMSTKVQTIYKEV 173 (296)
T ss_dssp BGGGTSEESCCCEETTSCHHHHHHHHHHHTCSEEEEECTTSCEEEEEEHHHHGGGGGGSCCCCBHHHHSBCSCCCEETTS
T ss_pred cHHHhccCCCEEEcCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEeHHHHHHhhhcccccccHHHhhcCCCeEECCCC
Confidence 899999999999999999999999999999999999998899999999999987421 1111 1234
Q ss_pred ChHHHHHHHHHHHHHHhhccCCCCC--CCccccccccccccC----------CCCccccccCCCCCCCCCCce-------
Q 024256 176 SNNEAASTMMQKFWDSAMALSPNDD--EEDNRSEGSLKFASE----------GADTARYLSYPSPSPGVPSAF------- 236 (270)
Q Consensus 176 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~t~~di~~~~~~~----------~~~~~~~~~~p~~~~~~~~~~------- 236 (270)
++.++...|.......++++.+.+. +.+|..|+.+.+... .......|..+..+.....+.
T Consensus 174 ~l~~~~~~m~~~~~~~~~Vvd~~~~~~Givt~~dl~~~~~~~~~~~~~~~~~~~~v~~~m~~~~~~v~~~~~l~~a~~~m 253 (296)
T 3ddj_A 174 RLDQAVKLMLRRGFRRLPVIDDDNKVVGIVTVVNAIKQLAKAVDKLDPDYFYGKVVKDVMVTNLVTIDELASVNRAAAEM 253 (296)
T ss_dssp BHHHHHHHHHHHTCSEEEEECTTSCEEEEEEHHHHHHHHHHHHHHTCTHHHHTCBHHHHSBCCCCBCCTTSBHHHHHHHH
T ss_pred CHHHHHHHHHHcCCCEEEEEcCCCEEEEEEEHHHHHHHHHHHHhhcChhhhcCcCHHHHhCCCCeEECCCCcHHHHHHHH
Confidence 4566777777776777777764443 339999998877521 111244555555542233222
Q ss_pred ------eEEeecCCCCeeEeecCCCChHHHHHhhhhh
Q 024256 237 ------AFKVQDNKGLMHRFTCGMLPFPNFIEVTNYE 267 (270)
Q Consensus 237 ------~~~VvD~~g~l~~~~vGivs~~Dil~~i~~~ 267 (270)
.++|+|++|++ +|+||++||++.+..+
T Consensus 254 ~~~~~~~l~Vvd~~g~~----~Giit~~Dil~~l~~~ 286 (296)
T 3ddj_A 254 IVKRIGSLLILNKDNTI----RGIITERDLLIALHHI 286 (296)
T ss_dssp HHHTCSEEEEECTTSCE----EEEEEHHHHHHHHHHH
T ss_pred HHcCCCEEEEECCCCeE----EEEEcHHHHHHHHHHH
Confidence 46699999999 9999999999998654
|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 270 | ||||
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 2e-15 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 3e-12 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 2e-11 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 2e-10 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 0.002 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 5e-10 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 7e-08 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 6e-10 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 2e-09 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 0.002 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 4e-09 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 0.001 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 6e-09 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 6e-04 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 9e-09 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 1e-08 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 0.003 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 2e-08 | |
| d2yvxa2 | 144 | d.37.1.1 (A:132-275) Magnesium transporter MgtE {T | 2e-08 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 3e-08 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 3e-08 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 5e-08 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 1e-07 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 6e-04 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 2e-07 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 3e-04 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 4e-07 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 6e-07 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 2e-06 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 3e-06 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 0.002 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 5e-06 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 0.004 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 2e-05 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 2e-05 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 0.002 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 0.003 |
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Uncharacterized protein NE2398 species: Nitrosomonas europaea [TaxId: 915]
Score = 69.4 bits (169), Expect = 2e-15
Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 1/116 (0%)
Query: 53 SKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLV 112
VV I P D+V A +KM + + +V + K GILT +D + + P T V
Sbjct: 13 HTVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLVGILTERDFSRKSYLLDKPVKDTQV 72
Query: 113 EKVMTPNPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAVA 168
+++MT ++ D + ++ + + HLPV+D DG V+ ++ + + A++
Sbjct: 73 KEIMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLD-DGKVIGLLSIGDLVKDAIS 127
|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.9 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.9 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.9 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.9 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.89 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.89 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.88 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.88 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.87 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.87 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.86 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.86 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.85 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.83 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.83 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.83 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.82 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.82 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.82 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.82 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.81 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.81 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.81 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.8 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.79 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.78 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.6 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.57 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.56 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.56 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.53 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.53 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.51 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.51 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.5 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.5 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.5 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.49 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.49 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.49 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.48 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.48 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.47 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.44 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.42 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.4 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.32 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.32 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.32 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.31 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.25 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.24 | |
| d1lkvx_ | 213 | FliG {Thermotoga maritima [TaxId: 2336]} | 84.75 |
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Uncharacterized protein ST2348 species: Sulfolobus tokodaii [TaxId: 111955]
Probab=99.90 E-value=2e-23 Score=156.90 Aligned_cols=123 Identities=28% Similarity=0.416 Sum_probs=113.3
Q ss_pred CCCCccccccCCCceeEECCCCCHHHHHHHHHHCCCcEEEEEeCCEEEEEeeHHHHHHHHHhcCCCCCccchhhccCCCC
Q 024256 41 FRPSLSTIIPEKSKVVTISPTDTVLMATKKMLELRLSSAVVTVENKPRGILTSKDILMRVISQNLPADSTLVEKVMTPNP 120 (270)
Q Consensus 41 ~~~~v~~im~~~~~~~~v~~~~tv~~a~~~m~~~~~~~i~Vv~~~~~~Givt~~dl~~~~~~~~~~~~~~~v~~im~~~~ 120 (270)
....|+++|+ ++++++++++|+.+|+++|.+++++++||+++|+++|+++.+|++ +.+.++... ..++.++|.+++
T Consensus 2 ~~~~V~d~m~--~~~v~v~~~~tl~~a~~~m~~~~~~~~pV~d~~~~~Givt~~dl~-~~~~~~~~~-~~~v~~~~~~~~ 77 (127)
T d2ef7a1 2 EEEIVKEYMK--TQVISVTKDAKLNDIAKVMTEKNIGSVIVVDGNKPVGIITERDIV-KAIGKGKSL-ETKAEEFMTASL 77 (127)
T ss_dssp CCCBGGGTSB--CSCCEEETTCBHHHHHHHHHHHTCSEEEEEETTEEEEEEEHHHHH-HHHHTTCCT-TCBGGGTSEECC
T ss_pred CccCHHHhCC--CCCeEECCcCcHHHHHHHHHHcCCceEEeecccchhhhcchhHHH-HHHHhhccc-cchhhhhhhhhc
Confidence 4568999999 789999999999999999999999999999999999999999998 666665554 478999999999
Q ss_pred eeecCCCCHHHHHHHhHhCCCCEEEEEeCCCcEEEEEeHHHHHHHHH
Q 024256 121 ECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAV 167 (270)
Q Consensus 121 ~~v~~~~~l~~a~~~~~~~~~~~lpVvd~~g~~~Givt~~dll~~~~ 167 (270)
+++++++++.++++.|.+++.+++||+|++|+++|+||..||++++.
T Consensus 78 ~~v~~~~~l~~~~~~m~~~~~~~l~Vvd~~~~lvGiit~~Dll~~i~ 124 (127)
T d2ef7a1 78 ITIREDSPITGALALMRQFNIRHLPVVDDKGNLKGIISIRDITRAID 124 (127)
T ss_dssp CCEETTSBHHHHHHHHHHHTCSEEEEECTTSCEEEEEEHHHHHHHHH
T ss_pred cccccccchhHHHHHHHHcCceEEEEEeCCCeEEEEEEHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999754
|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|