Citrus Sinensis ID: 024268

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSFLSSLKLDRTLTLSF
ccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHccccccccccccEEEEccccccccccccccccEEEEcccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHcccccccccc
ccEEEEEEcccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHcHHHHHHcccccEEEEEccccccccccccccEEEEEcHHHHHHHHccccHcccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccHHccccEEHcHccccccccc
MDVKEVLFMnkgdgensyaqnspfTQRVIELSKPVLESAVQSLFGEEVIWNKVFNvadlgcasnastFSVMSSVIENVQKKCVelnapipefqlylndlpgndfnTLFKGLSSFadryndaslfmmgapgsfygrlfptnslqlVHSSYgvhwlskvpkltdeaglplinkgkifisktspvAVKEAYLRQFEEDFSLFLKSRsqemvpngrLVLVFngrpsadftrdycypipweSLSEAIAAMVSEVRSNFQSFLSSlkldrtltlsf
MDVKEVLFmnkgdgensyaqnsPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINkgkifisktspVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSflsslkldrtltlsf
MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSFLSSLKLDRTLTLSF
*************************QRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSFLS************
*D*KEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVE**APIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSFLSSLKLDRTLTLSF
MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSFLSSLKLDRTLTLSF
*DVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSFLSSLKLDRTLTLSF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSEVRSNFQSFLSSLKLDRTLTLSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query270 2.2.26 [Sep-21-2011]
Q68CM3365 Probable caffeine synthas N/A no 0.940 0.695 0.550 2e-75
Q9FZN8369 Caffeine synthase 1 OS=Ca N/A no 0.933 0.682 0.545 3e-73
Q9SPV4359 Salicylate O-methyltransf N/A no 0.874 0.657 0.442 1e-53
Q9SBK6 392 Jasmonate O-methyltransfe N/A no 0.9 0.619 0.433 4e-48
Q9FYZ9 364 Benzoate carboxyl methylt N/A no 0.785 0.582 0.441 3e-47
Q9AR07 389 Jasmonate O-methyltransfe no no 0.907 0.629 0.428 3e-47
A4GE70 384 3,7-dimethylxanthine N-me N/A no 0.796 0.559 0.427 2e-42
Q8H0D3 384 Caffeine synthase 1 OS=Co N/A no 0.796 0.559 0.431 3e-42
Q8H0D2 384 3,7-dimethylxanthine N-me N/A no 0.796 0.559 0.409 1e-40
Q9AVK0372 7-methylxanthosine syntha N/A no 0.792 0.575 0.417 1e-40
>sp|Q68CM3|TCS2_CAMSI Probable caffeine synthase 2 OS=Camellia sinensis GN=TCS2 PE=2 SV=1 Back     alignment and function desciption
 Score =  282 bits (721), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 187/265 (70%), Gaps = 11/265 (4%)

Query: 2   DVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGC 61
           +VKE LFMNKG+GE+SYAQNS FTQ V  ++ PVLE+AV++LF ++    +  N  DLGC
Sbjct: 3   EVKEALFMNKGEGESSYAQNSSFTQTVTSMTMPVLENAVETLFSKDFHLLQALNAVDLGC 62

Query: 62  ASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSS--FADRYN 119
           A+  +TF+V+S++   ++KKC ELN    E Q+YLNDLPGNDFNTLFKGL S    ++  
Sbjct: 63  AAGPTTFTVISTIKRMMEKKCRELNCQTLELQVYLNDLPGNDFNTLFKGLPSKVVGNKCE 122

Query: 120 DASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPK-LTDEAGLPLINKGKIFISK 178
           + S +++G PGSF+GRLFP NSL LVHS Y VHWL++ PK LT + GL L NKGKI+ISK
Sbjct: 123 EVSCYVVGVPGSFHGRLFPRNSLHLVHSCYSVHWLTQAPKGLTSKEGLAL-NKGKIYISK 181

Query: 179 TSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESL 238
           TSP  V+EAYL QF EDF++FL SRSQE+VPNG +VL+  GR S+D   D      WE L
Sbjct: 182 TSPPVVREAYLSQFHEDFTMFLNSRSQEVVPNGCMVLILRGRLSSD-PSDMGSCFTWELL 240

Query: 239 SEAIAAMVSEVRSNFQSFLSSLKLD 263
           + AIA +VS      Q  +   KLD
Sbjct: 241 AVAIAELVS------QGLIDEDKLD 259
May be involved in the biosynthesis of caffeine. Catalyzes the conversion of 7-methylxanthine (7mX) to theobromine and of theobromine to caffeine. Has 1-N-methylation activity.
Camellia sinensis (taxid: 4442)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 6EC: 0
>sp|Q9FZN8|TCS1_CAMSI Caffeine synthase 1 OS=Camellia sinensis GN=TCS1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPV4|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9SBK6|JMT_BRARP Jasmonate O-methyltransferase OS=Brassica rapa subsp. pekinensis GN=JMT PE=1 SV=1 Back     alignment and function description
>sp|Q9FYZ9|BAMT_ANTMA Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9AR07|JMT_ARATH Jasmonate O-methyltransferase OS=Arabidopsis thaliana GN=JMT PE=1 SV=3 Back     alignment and function description
>sp|A4GE70|DXMT1_COFCA 3,7-dimethylxanthine N-methyltransferase OS=Coffea canephora GN=DXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8H0D3|CCS1_COFAR Caffeine synthase 1 OS=Coffea arabica GN=CCS1 PE=1 SV=1 Back     alignment and function description
>sp|Q8H0D2|DXMT1_COFAR 3,7-dimethylxanthine N-methyltransferase OS=Coffea arabica GN=DXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9AVK0|XMT1_COFAR 7-methylxanthosine synthase 1 OS=Coffea arabica GN=XMT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
87887929363 caffeine synthase [Theobroma cacao] 0.911 0.677 0.616 2e-82
215272185366 theobromine synthase [Camellia granthami 0.944 0.696 0.554 1e-75
215272189366 theobromine synthase [Camellia lutchuens 0.940 0.693 0.555 3e-75
215272181365 theobromine synthase [Camellia japonica] 0.940 0.695 0.554 6e-75
215272183365 theobromine synthase [Camellia granthami 0.940 0.695 0.558 7e-75
215272187364 theobromine synthase [Camellia kissii] 0.940 0.697 0.550 2e-74
59611829365 caffeine synthase [Camellia sinensis] 0.940 0.695 0.554 4e-74
87887946365 theobromine synthase [Camellia ptilophyl 0.937 0.693 0.548 6e-74
87887936364 theobromine synthase [Camellia irrawadie 0.940 0.697 0.546 1e-73
75117021365 RecName: Full=Probable caffeine synthase 0.940 0.695 0.550 1e-73
>gi|87887929|dbj|BAE79730.1| caffeine synthase [Theobroma cacao] Back     alignment and taxonomy information
 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/250 (61%), Positives = 191/250 (76%), Gaps = 4/250 (1%)

Query: 1   MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLF-GEEVIWNKVFNVADL 59
           M+VKE+LFMNKGDGENSY + S +TQ+V  +++PV+  A QSLF G      +V NVADL
Sbjct: 1   MEVKEMLFMNKGDGENSYVKTSGYTQKVAAVTQPVVYRAAQSLFTGRNSCSYQVLNVADL 60

Query: 60  GCASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYN 119
           GC+S  +TF+VMS+VIE+ + KC ELN  +PE Q YLNDL GNDFNTLFKGLS   D+Y 
Sbjct: 61  GCSSGPNTFTVMSTVIESTRDKCSELNWQMPEIQFYLNDLVGNDFNTLFKGLSVIQDKYK 120

Query: 120 DASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKT 179
           + S F MGAPGSF+GRLFP NS+ L+HSSYGV WLSKVPK+T E GL   NKGKI+ISKT
Sbjct: 121 NVSCFAMGAPGSFHGRLFPQNSMHLIHSSYGVQWLSKVPKMTSEGGLSPPNKGKIYISKT 180

Query: 180 SPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSAD-FTRDYCYPIPWESL 238
           SP AV +AYL QF+EDF  FL+ RS E+VP+GR+VL+ +GR SAD  TR+ CY   WE L
Sbjct: 181 SPPAVWKAYLSQFQEDFLSFLRCRSPELVPDGRMVLIIHGRKSADPTTRESCY--TWEVL 238

Query: 239 SEAIAAMVSE 248
           ++AI+  VS+
Sbjct: 239 ADAISYQVSQ 248

Source: Theobroma cacao

Species: Theobroma cacao

Genus: Theobroma

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|215272185|dbj|BAG84614.1| theobromine synthase [Camellia granthamiana] Back     alignment and taxonomy information
>gi|215272189|dbj|BAG84616.1| theobromine synthase [Camellia lutchuensis] Back     alignment and taxonomy information
>gi|215272181|dbj|BAG84612.1| theobromine synthase [Camellia japonica] Back     alignment and taxonomy information
>gi|215272183|dbj|BAG84613.1| theobromine synthase [Camellia granthamiana] Back     alignment and taxonomy information
>gi|215272187|dbj|BAG84615.1| theobromine synthase [Camellia kissii] Back     alignment and taxonomy information
>gi|59611829|gb|AAW88351.1| caffeine synthase [Camellia sinensis] Back     alignment and taxonomy information
>gi|87887946|dbj|BAE79733.1| theobromine synthase [Camellia ptilophylla] Back     alignment and taxonomy information
>gi|87887936|dbj|BAE79731.1| theobromine synthase [Camellia irrawadiensis] Back     alignment and taxonomy information
>gi|75117021|sp|Q68CM3.1|TCS2_CAMSI RecName: Full=Probable caffeine synthase 2 gi|51968288|dbj|BAD42854.1| caffeine synthase [Camellia sinensis] gi|411012946|gb|AFV99129.1| caffeine synthase 2 [Camellia sinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
TAIR|locus:2179929415 NAMT1 [Arabidopsis thaliana (t 0.862 0.561 0.455 1.6e-47
TAIR|locus:2115400371 AT4G36470 [Arabidopsis thalian 0.896 0.652 0.430 3.8e-46
TAIR|locus:2080747379 BSMT1 [Arabidopsis thaliana (t 0.888 0.633 0.417 4.8e-46
TAIR|locus:2154845354 AT5G66430 [Arabidopsis thalian 0.855 0.652 0.440 1.3e-45
TAIR|locus:2179969385 AT5G04380 "AT5G04380" [Arabido 0.862 0.605 0.412 2.2e-43
TAIR|locus:2144466 368 AT5G38020 [Arabidopsis thalian 0.866 0.635 0.412 1.2e-42
TAIR|locus:2095572 368 AT3G21950 [Arabidopsis thalian 0.9 0.660 0.377 5.9e-41
TAIR|locus:2053458 359 AT2G14060 [Arabidopsis thalian 0.855 0.643 0.393 4.8e-39
TAIR|locus:2013149 389 JMT "jasmonic acid carboxyl me 0.903 0.627 0.393 1.5e-35
TAIR|locus:2200186363 AT1G68040 [Arabidopsis thalian 0.885 0.658 0.357 1.3e-34
TAIR|locus:2179929 NAMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 497 (180.0 bits), Expect = 1.6e-47, P = 1.6e-47
 Identities = 112/246 (45%), Positives = 148/246 (60%)

Query:     7 LFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNAS 66
             L M  GDG NSY+ NS   +RV+  +KPVL    + L    + +     VADLGC+S  +
Sbjct:    58 LCMRGGDGYNSYSSNSLLQRRVLSKAKPVLVKNTKDLM-INLNFPTYIKVADLGCSSGQN 116

Query:    67 TFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSF--ADRYNDASLF 124
             TF  MS +I  +   C + N   PE    LNDLP NDFNT FK +  F   +  +  S F
Sbjct:   117 TFLAMSEIINTINVFCQQRNQNPPEIDCCLNDLPSNDFNTTFKFIQFFNGMNITSKESYF 176

Query:   125 MMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKTSPVAV 184
             + G PGSFY RLFP  SL  VHSSYG+HWLSKVP+     GL   NK  ++I+ +SP++ 
Sbjct:   177 VYGVPGSFYSRLFPRRSLHFVHSSYGLHWLSKVPE-----GLEK-NKMSVYITNSSPLST 230

Query:   185 KEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSAD--FTRDYCYPIPWESLSEAI 242
              +AYL QF+ DF+ FLK RS+EMV NGR+VL F GR + D    RD C+   W  LS+++
Sbjct:   231 YKAYLNQFQRDFATFLKLRSEEMVSNGRMVLTFIGRNTIDNPLHRDCCHF--WTLLSKSL 288

Query:   243 AAMVSE 248
               +V+E
Sbjct:   289 RDLVAE 294
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=IDA
TAIR|locus:2115400 AT4G36470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080747 BSMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154845 AT5G66430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179969 AT5G04380 "AT5G04380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144466 AT5G38020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095572 AT3G21950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053458 AT2G14060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013149 JMT "jasmonic acid carboxyl methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200186 AT1G68040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
pfam03492331 pfam03492, Methyltransf_7, SAM dependent carboxyl 1e-85
PLN02668386 PLN02668, PLN02668, indole-3-acetate carboxyl meth 1e-45
>gnl|CDD|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase Back     alignment and domain information 
 Score =  258 bits (661), Expect = 1e-85
 Identities = 106/215 (49%), Positives = 139/215 (64%), Gaps = 7/215 (3%)

Query: 36  LESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQKKCVELN-APIPEFQL 94
           LE A+  L    +       +ADLGC+S  +TF  +S++I+ V+KK  + N    PEFQ+
Sbjct: 1   LEEAISELLLRNLF-PNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEPPEFQV 59

Query: 95  YLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWL 154
           + NDLP NDFNTLFK L  F  +    S F+ G PGSFYGRLFP NSL  VHSSY +HWL
Sbjct: 60  FFNDLPSNDFNTLFKLLPPFQKK--KRSYFVSGVPGSFYGRLFPRNSLHFVHSSYSLHWL 117

Query: 155 SKVPK-LTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRL 213
           S+VPK L D+   P  NKG I+IS  SP  V +AYL QF++DFSLFL++R++E+V  G +
Sbjct: 118 SQVPKGLEDKES-PAWNKGNIYISGASPEEVYKAYLDQFKKDFSLFLRARAEELVSGGLM 176

Query: 214 VLVFNGRPSADFTRDYCYPIPWESLSEAIAAMVSE 248
           VL F GRPS D +   C    W+ L +A+  +VSE
Sbjct: 177 VLTFLGRPSVDPSETECGIF-WDLLGDALNDLVSE 210

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331
>gnl|CDD|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 270
PLN02668386 indole-3-acetate carboxyl methyltransferase 100.0
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 100.0
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.1
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.68
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 97.66
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.61
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.23
TIGR00740239 methyltransferase, putative. A simple BLAST search 97.21
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.14
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.07
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.06
PLN02244340 tocopherol O-methyltransferase 96.97
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 96.83
PRK12335287 tellurite resistance protein TehB; Provisional 96.65
PLN02233261 ubiquinone biosynthesis methyltransferase 96.59
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.57
PRK06922677 hypothetical protein; Provisional 96.54
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 96.5
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 96.45
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.41
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 96.27
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 96.25
PRK11207197 tellurite resistance protein TehB; Provisional 96.22
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.16
PRK08317241 hypothetical protein; Provisional 96.12
TIGR03438301 probable methyltransferase. This model represents 96.05
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 95.85
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 95.6
PLN02336 475 phosphoethanolamine N-methyltransferase 95.57
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 95.49
PLN02336475 phosphoethanolamine N-methyltransferase 95.44
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 95.38
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 95.28
PRK06202232 hypothetical protein; Provisional 95.28
KOG2940 325 consensus Predicted methyltransferase [General fun 95.26
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 95.19
COG4106257 Tam Trans-aconitate methyltransferase [General fun 95.14
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 95.11
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 94.95
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 94.8
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 94.79
PLN02490340 MPBQ/MSBQ methyltransferase 94.66
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 94.38
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 94.28
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 94.23
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 94.21
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 94.18
TIGR00452314 methyltransferase, putative. Known examples to dat 93.86
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 93.69
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 93.47
PTZ00146293 fibrillarin; Provisional 93.4
PRK05785226 hypothetical protein; Provisional 93.18
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 92.94
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 92.7
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 92.45
COG4123248 Predicted O-methyltransferase [General function pr 92.41
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 92.38
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 91.89
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 91.59
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 91.28
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 90.92
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 90.49
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 90.43
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 90.36
PRK14968188 putative methyltransferase; Provisional 90.32
KOG1270282 consensus Methyltransferases [Coenzyme transport a 90.04
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 90.03
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 89.89
KOG3010261 consensus Methyltransferase [General function pred 89.48
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 87.97
PRK10901427 16S rRNA methyltransferase B; Provisional 87.94
KOG3045325 consensus Predicted RNA methylase involved in rRNA 87.65
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 87.1
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 86.43
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 86.38
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 85.86
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 85.63
PRK14903431 16S rRNA methyltransferase B; Provisional 84.64
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 84.09
PLN02232160 ubiquinone biosynthesis methyltransferase 83.3
KOG2904328 consensus Predicted methyltransferase [General fun 83.07
PRK14902444 16S rRNA methyltransferase B; Provisional 82.57
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 82.08
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 82.05
PRK14904445 16S rRNA methyltransferase B; Provisional 80.29
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information 
Probab=100.00  E-value=1.6e-85  Score=626.47  Aligned_cols=256  Identities=35%  Similarity=0.588  Sum_probs=235.1

Q ss_pred             CCccceeeccCCCCCchHHhhCHHHHHHHHHhHHHHHHHHHHhhcccccCC-ceeEEeeecCCCCccchHHHHHHHHHHH
Q 024268            1 MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWN-KVFNVADLGCASNASTFSVMSSVIENVQ   79 (270)
Q Consensus         1 m~~~~~l~M~gG~G~~sY~~NS~~Q~~~i~~~~p~le~ai~~~~~~~~~~~-~~~~IADlGCS~G~NSl~~v~~ii~~i~   79 (270)
                      |+++++|||+||+|++||++||..|++++..++|+|++||++++...  .+ ++++|||||||+|+||+.+|++||++|+
T Consensus        13 m~~~~~l~M~gG~g~~SYa~nS~~Q~~~~~~~k~~leeai~~~~~~~--~p~~~~~iaDlGcs~G~ntl~~vs~iI~~i~   90 (386)
T PLN02668         13 MKLEKLLCMKGGKGEGSYANNSQAQALHARSMLHLLEETLDNVHLNS--SPEVPFTAVDLGCSSGSNTIHIIDVIVKHMS   90 (386)
T ss_pred             ceeccccccCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHhcccc--CCCcceeEEEecCCCCccHHHHHHHHHHHHH
Confidence            78999999999999999999999999999999999999999987543  35 7999999999999999999999999999


Q ss_pred             HHHhhcCCCCCceEEEecCCCCCchHHHHhcchhhhhcc---------C-CCceeeeccCCccccCCcCCCceeEEEccc
Q 024268           80 KKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRY---------N-DASLFMMGAPGSFYGRLFPTNSLQLVHSSY  149 (270)
Q Consensus        80 ~~~~~~~~~~peiqv~~nDLP~NDFntLF~~L~~~~~~~---------~-~~~~f~~~vpgSFY~rLfP~~Svh~~~Ss~  149 (270)
                      ++|.+.++++|||||||||||+||||+||++||.+++.+         . .++||++|||||||+||||++||||+||+|
T Consensus        91 ~~~~~~~~~~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~Slh~~~Ss~  170 (386)
T PLN02668         91 KRYESAGLDPPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARSIDVFHSAF  170 (386)
T ss_pred             HHhhhcCCCCCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCceEEEEeec
Confidence            999887778899999999999999999999999876632         1 146999999999999999999999999999


Q ss_pred             ccccccCCCC-CcCCCCcCCCcCcceEEcCCCcHHHHHHHHHHHHHHHHHHHhccccccccCceEEEEeecCCCCCCCC-
Q 024268          150 GVHWLSKVPK-LTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTR-  227 (270)
Q Consensus       150 alHWLS~~P~-v~~~~~l~~~nkg~i~i~~ss~~~v~~ay~~Q~~~Dl~~FL~~Ra~EL~~GG~lvl~~~gr~~~~~~~-  227 (270)
                      |||||||+|+ +.|+.++.| |||+|||+.++ ++|.+||++||++||..||++||+||+|||+||++++||++.+++. 
T Consensus       171 slHWLS~vP~~l~d~~s~~~-Nkg~iyi~~~s-~~v~~aY~~Qf~~D~~~FL~~Ra~ELvpGG~mvl~~~Gr~~~~~~~~  248 (386)
T PLN02668        171 SLHWLSQVPESVTDKRSAAY-NKGRVFIHGAS-ESTANAYKRQFQADLAGFLRARAQEMKRGGAMFLVCLGRTSVDPTDQ  248 (386)
T ss_pred             cceecccCchhhccCCcccc-cCCceEecCCC-HHHHHHHHHHHHHHHHHHHHHHHHHhccCcEEEEEEecCCCCCcccC
Confidence            9999999999 888888888 99999999877 7899999999999999999999999999999999999999877776 


Q ss_pred             C-CCCcchHHH-HHHHHHHHHHccCCCchhhccccccc
Q 024268          228 D-YCYPIPWES-LSEAIAAMVSEVRSNFQSFLSSLKLD  263 (270)
Q Consensus       228 ~-~~~~~~~~~-l~~~l~dmv~eGli~~ee~~~~~~~~  263 (270)
                      + .+.  +|+. ++++|+|||.||+|++||+ +++|+|
T Consensus       249 ~~~~~--~~~~~l~~al~dlv~eGlI~eek~-dsFniP  283 (386)
T PLN02668        249 GGAGL--LFGTHFQDAWDDLVQEGLVTSEKR-DSFNIP  283 (386)
T ss_pred             CchhH--HHHHHHHHHHHHHHHcCCCCHHHH-hcccCc
Confidence            3 344  7887 9999999999999999999 667765

>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
1m6e_X359 Crystal Structure Of Salicylic Acid Carboxyl Methyl 7e-55
2efj_A 384 The Structure Of 1,7 Dimethylxanthine Methyltransfe 2e-43
2eg5_A372 The Structure Of Xanthosine Methyltransferase Lengt 1e-41
3b5i_A374 Crystal Structure Of Indole-3-Acetic Acid Methyltra 2e-32
>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359 Back     alignment and structure 
Iteration: 1

 Score =  210 bits (534), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 160/251 (63%), Gaps = 15/251 (5%)
Query: 1   MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLG 60
           MDV++VL M  G GENSYA NS   ++VI ++KP+ E+A+ +L+  + +  ++  +ADLG
Sbjct: 1   MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRL-AIADLG 59
Query: 61  CASNASTFSVMSSVI---ENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADR 117
           C+S  +    ++ +I   E ++KK    N+P  E+Q++LNDLPGNDFN +F+ L    D 
Sbjct: 60  CSSGPNALFAVTELIKTVEELRKKMGRENSP--EYQIFLNDLPGNDFNAIFRSLPIENDV 117
Query: 118 YNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFIS 177
             D   F+ G PGSFYGRLFP N+L  +HSSY + WLS+VP   +       NKG I+++
Sbjct: 118 --DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIES------NKGNIYMA 169
Query: 178 KTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWES 237
            T P +V  AY +QF+ED +LFL+ R+QE+VP GR+VL   GR S D     C  I W+ 
Sbjct: 170 NTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLI-WQL 228
Query: 238 LSEAIAAMVSE 248
           L+ A+  MVSE
Sbjct: 229 LAMALNQMVSE 239
>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384 Back     alignment and structure
>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372 Back     alignment and structure
>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 5e-75
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 2e-71
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 2e-69
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374 Back     alignment and structure
 Score =  232 bits (592), Expect = 5e-75
 Identities = 79/258 (30%), Positives = 125/258 (48%), Gaps = 11/258 (4%)

Query: 1   MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLG 60
           M ++ +L M  G G++SYA NS            +LE  ++++          F   DLG
Sbjct: 1   MKLERLLSMKGGKGQDSYANNSLAQAMHARSMLHLLEETLENVHLNSSASPPPFTAVDLG 60

Query: 61  CASNASTFSVMSSVIENVQKKCVELNAPIPEFQLYLNDLPGNDFNTLFKGLSSFADRYND 120
           C+S A+T  ++  +++++ K+        PEF  + +DLP NDFNTLF+ L         
Sbjct: 61  CSSGANTVHIIDFIVKHISKRFDAAGIDPPEFTAFFSDLPSNDFNTLFQLLPPLVSNTCM 120

Query: 121 A---------SLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINK 171
                     S F+ G PGSFY RLFP  ++   HS++ +HWLS+VP+   +      N+
Sbjct: 121 EECLAADGNRSYFVAGVPGSFYRRLFPARTIDFFHSAFSLHWLSQVPESVTDRRSAAYNR 180

Query: 172 GKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSAD-FTRDYC 230
           G++FI          AY RQF+ D + FL++R+ E+   G + LV  GR S D   +   
Sbjct: 181 GRVFIHGAGE-KTTTAYKRQFQADLAEFLRARAAEVKRGGAMFLVCLGRTSVDPTDQGGA 239

Query: 231 YPIPWESLSEAIAAMVSE 248
             +      +A   +V E
Sbjct: 240 GLLFGTHFQDAWDDLVRE 257
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 100.0
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 100.0
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 100.0
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.89
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.61
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.59
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 97.53
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 97.42
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 97.42
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.38
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.35
4hg2_A257 Methyltransferase type 11; structural genomics, PS 97.26
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.25
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.23
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 97.23
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 97.11
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 97.1
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.1
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.08
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.05
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.04
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.03
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.03
2p7i_A250 Hypothetical protein; putative methyltransferase, 97.02
3dh0_A219 SAM dependent methyltransferase; cystal structure, 96.99
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 96.98
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 96.97
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.94
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 96.9
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 96.89
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.89
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.87
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.83
3lcc_A235 Putative methyl chloride transferase; halide methy 96.82
3i9f_A170 Putative type 11 methyltransferase; structural gen 96.77
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 96.74
1xxl_A239 YCGJ protein; structural genomics, protein structu 96.73
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 96.73
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 96.72
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 96.72
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.69
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 96.66
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 96.65
3m70_A286 Tellurite resistance protein TEHB homolog; structu 96.65
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 96.63
1vlm_A219 SAM-dependent methyltransferase; possible histamin 96.62
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 96.61
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 96.61
3f4k_A257 Putative methyltransferase; structural genomics, P 96.61
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 96.56
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.55
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 96.53
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 96.52
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.51
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 96.51
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.51
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 96.5
2i62_A265 Nicotinamide N-methyltransferase; structural genom 96.47
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.44
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.43
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 96.43
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 96.43
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 96.42
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 96.4
3ege_A261 Putative methyltransferase from antibiotic biosyn 96.38
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.33
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 96.31
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 96.3
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 96.28
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.26
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 96.24
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 96.22
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 96.21
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 96.19
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.16
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 96.12
3hnr_A220 Probable methyltransferase BT9727_4108; structural 96.09
3ocj_A305 Putative exported protein; structural genomics, PS 96.07
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 96.05
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 96.02
1wzn_A252 SAM-dependent methyltransferase; structural genomi 96.01
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 95.93
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 95.91
2r3s_A335 Uncharacterized protein; methyltransferase domain, 95.9
2kw5_A202 SLR1183 protein; structural genomics, northeast st 95.88
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 95.87
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 95.81
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 95.81
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.8
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 95.68
3gu3_A284 Methyltransferase; alpha-beta protein, structural 95.67
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 95.67
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 95.62
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 95.62
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 95.62
3dp7_A363 SAM-dependent methyltransferase; structural genomi 95.56
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 95.51
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 95.42
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 95.42
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 95.27
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 95.2
3cc8_A230 Putative methyltransferase; structural genomics, j 95.01
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 94.98
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 94.91
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 94.86
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 94.83
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 94.73
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 94.57
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 94.44
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 94.43
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 94.38
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 94.2
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.13
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 94.1
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 94.08
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 94.07
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 94.06
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 94.05
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 94.01
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 93.84
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 93.79
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 93.69
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 93.54
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 93.5
2b3t_A276 Protein methyltransferase HEMK; translation termin 93.17
3giw_A277 Protein of unknown function DUF574; rossmann-fold 93.14
3lpm_A259 Putative methyltransferase; structural genomics, p 92.67
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 92.46
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 92.15
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 91.89
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 91.36
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 90.94
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 90.86
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 88.31
3sso_A419 Methyltransferase; macrolide, natural product, ros 87.69
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 87.66
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 87.45
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 86.09
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 85.64
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 85.36
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 85.22
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 85.03
1jsx_A207 Glucose-inhibited division protein B; methyltransf 84.53
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 83.9
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 83.55
1ws6_A171 Methyltransferase; structural genomics, riken stru 82.54
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 82.24
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 81.28
2h00_A254 Methyltransferase 10 domain containing protein; st 81.07
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 80.92
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
Probab=100.00  E-value=5.4e-84  Score=611.85  Aligned_cols=251  Identities=43%  Similarity=0.788  Sum_probs=233.2

Q ss_pred             CCccceeeccCCCCCchHHhhCHHHHHHHHHhHHHHHHHHHHhhcccccCCceeEEeeecCCCCccchHHHHHHHHHHHH
Q 024268            1 MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQK   80 (270)
Q Consensus         1 m~~~~~l~M~gG~G~~sY~~NS~~Q~~~i~~~~p~le~ai~~~~~~~~~~~~~~~IADlGCS~G~NSl~~v~~ii~~i~~   80 (270)
                      |+++++|||+||+|++||++||..|++++..++|++++||++++.... .+++++|||||||+|+||+.+++.||++|++
T Consensus         1 m~~~~~~~m~gg~G~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~~-~~~~~~IaDlGCs~G~Nt~~~v~~ii~~i~~   79 (359)
T 1m6e_X            1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDT-VTTRLAIADLGCSSGPNALFAVTELIKTVEE   79 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSS-SSSEECCEEESCCSSTTTTTGGGTTHHHHHH
T ss_pred             CCcccccccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhhccC-CCCceEEEecCCCCCcchHHHHHHHHHHHHH
Confidence            899999999999999999999999999999999999999999987641 4789999999999999999999999999999


Q ss_pred             HHhhcCC-CCCceEEEecCCCCCchHHHHhcchhhhhccCCCceeeeccCCccccCCcCCCceeEEEcccccccccCCCC
Q 024268           81 KCVELNA-PIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPK  159 (270)
Q Consensus        81 ~~~~~~~-~~peiqv~~nDLP~NDFntLF~~L~~~~~~~~~~~~f~~~vpgSFY~rLfP~~Svh~~~Ss~alHWLS~~P~  159 (270)
                      +|.+.++ ++|||||||||||+||||+||++||.++.  .+++||++|||||||+||||++|+||+||++||||||++| 
T Consensus        80 ~~~~~~~~~~pe~~v~~nDLp~NDFntlF~~L~~~~~--~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aLHWls~~p-  156 (359)
T 1m6e_X           80 LRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIEND--VDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVP-  156 (359)
T ss_dssp             HHHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSCS--CTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCC-
T ss_pred             HHHhcCCCCCCceEEEecCCCchHHHHHHHhcchhcc--cCCCEEEEecchhhhhccCCCCceEEEEehhhhhhcccCc-
Confidence            9987776 78999999999999999999999998762  1268999999999999999999999999999999999999 


Q ss_pred             CcCCCCcCCCcCcceEEcCCCcHHHHHHHHHHHHHHHHHHHhccccccccCceEEEEeecCCCCCCCC-CCCCcchHHHH
Q 024268          160 LTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTR-DYCYPIPWESL  238 (270)
Q Consensus       160 v~~~~~l~~~nkg~i~i~~ss~~~v~~ay~~Q~~~Dl~~FL~~Ra~EL~~GG~lvl~~~gr~~~~~~~-~~~~~~~~~~l  238 (270)
                          +.+.+ |||+|||+.++|++|.+||++||++||+.||++|++||||||+||++++||++.++++ +.+.  +|+.|
T Consensus       157 ----~~l~~-nkg~i~~~~~~p~~v~~ay~~Qf~~D~~~FL~~Ra~EL~pGG~mvl~~~gr~~~~~~~~~~~~--~~~~l  229 (359)
T 1m6e_X          157 ----IGIES-NKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCL--IWQLL  229 (359)
T ss_dssp             ----SCCCC-CTTTTSSCSSSCCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTTTST--TTHHH
T ss_pred             ----hhhhc-cCCceEecCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCceEEEEEecCCCCCccccchHH--HHHHH
Confidence                77777 9999999999999999999999999999999999999999999999999999988887 5665  89999


Q ss_pred             HHHHHHHHHccCCCchhhccccccc
Q 024268          239 SEAIAAMVSEVRSNFQSFLSSLKLD  263 (270)
Q Consensus       239 ~~~l~dmv~eGli~~ee~~~~~~~~  263 (270)
                      +++|+|||.||+|++||++ ++|+|
T Consensus       230 ~~al~~mv~eGli~~ek~d-~f~~P  253 (359)
T 1m6e_X          230 AMALNQMVSEGLIEEEKMD-KFNIP  253 (359)
T ss_dssp             HHHHHHHHHTTCSCCSTTG-GGCCC
T ss_pred             HHHHHHHHHccccchhhhh-ccCCC
Confidence            9999999999999999985 44443
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 270
d1m6ex_359 c.66.1.35 (X:) Salicylic acid carboxyl methyltrans 8e-84
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score =  253 bits (647), Expect = 8e-84
 Identities = 107/249 (42%), Positives = 157/249 (63%), Gaps = 11/249 (4%)

Query: 1   MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLG 60
           MDV++VL M  G GENSYA NS   ++VI ++KP+ E+A+ +L+  + +      +ADLG
Sbjct: 1   MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTV-TTRLAIADLG 59

Query: 61  CASNASTFSVMSSVIENVQKKCVELN-APIPEFQLYLNDLPGNDFNTLFKGLSSFADRYN 119
           C+S  +    ++ +I+ V++   ++     PE+Q++LNDLPGNDFN +F+ L    D   
Sbjct: 60  CSSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDV-- 117

Query: 120 DASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPKLTDEAGLPLINKGKIFISKT 179
           D   F+ G PGSFYGRLFP N+L  +HSSY + WLS+VP   +       NKG I+++ T
Sbjct: 118 DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIE------SNKGNIYMANT 171

Query: 180 SPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTRDYCYPIPWESLS 239
            P +V  AY +QF+ED +LFL+ R+QE+VP GR+VL   GR S D     C  + W+ L+
Sbjct: 172 CPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECC-LIWQLLA 230

Query: 240 EAIAAMVSE 248
            A+  MVSE
Sbjct: 231 MALNQMVSE 239

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.17
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.14
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.12
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.73
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.71
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.68
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.68
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.52
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.48
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.42
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.4
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.39
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.26
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.05
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 97.03
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.94
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.93
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.83
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.81
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 96.69
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 96.58
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 96.54
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 96.49
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 96.48
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 96.45
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 96.32
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 96.05
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 96.02
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 95.95
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 95.89
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 95.69
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 95.4
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 95.38
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 95.19
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.1
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 94.66
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 94.65
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 94.59
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 94.45
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 94.22
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 93.5
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 92.85
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 92.53
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 91.1
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 90.51
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 86.45
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=2.5e-91  Score=659.33  Aligned_cols=251  Identities=43%  Similarity=0.794  Sum_probs=234.7

Q ss_pred             CCccceeeccCCCCCchHHhhCHHHHHHHHHhHHHHHHHHHHhhcccccCCceeEEeeecCCCCccchHHHHHHHHHHHH
Q 024268            1 MDVKEVLFMNKGDGENSYAQNSPFTQRVIELSKPVLESAVQSLFGEEVIWNKVFNVADLGCASNASTFSVMSSVIENVQK   80 (270)
Q Consensus         1 m~~~~~l~M~gG~G~~sY~~NS~~Q~~~i~~~~p~le~ai~~~~~~~~~~~~~~~IADlGCS~G~NSl~~v~~ii~~i~~   80 (270)
                      |+++++|||+||+|++||++||..|+++|..++|+|++||+++++... .+++++|||||||+||||+.+|+.||++|++
T Consensus         1 m~~~~~l~M~gG~G~~SYa~NS~~Q~~~i~~~kp~leeai~~~~~~~~-~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~~   79 (359)
T d1m6ex_           1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDT-VTTRLAIADLGCSSGPNALFAVTELIKTVEE   79 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSS-SSSEECCEEESCCSSTTTTTGGGTTHHHHHH
T ss_pred             CCccEeeccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhcccCCC-CCCceEEEEeCCCCCccHHHHHHHHHHHHHH
Confidence            899999999999999999999999999999999999999999986542 5789999999999999999999999999999


Q ss_pred             HHhhcCC-CCCceEEEecCCCCCchHHHHhcchhhhhccCCCceeeeccCCccccCCcCCCceeEEEcccccccccCCCC
Q 024268           81 KCVELNA-PIPEFQLYLNDLPGNDFNTLFKGLSSFADRYNDASLFMMGAPGSFYGRLFPTNSLQLVHSSYGVHWLSKVPK  159 (270)
Q Consensus        81 ~~~~~~~-~~peiqv~~nDLP~NDFntLF~~L~~~~~~~~~~~~f~~~vpgSFY~rLfP~~Svh~~~Ss~alHWLS~~P~  159 (270)
                      +|++.+. ++|||||||||||+||||+||++||...+.  .++||++|||||||+||||++||||+||+||||||||+| 
T Consensus        80 ~~~~~~~~~~pe~qvf~nDLP~NDFNtLF~~L~~~~~~--~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWLS~vP-  156 (359)
T d1m6ex_          80 LRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDV--DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVP-  156 (359)
T ss_dssp             HHHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSCSC--TTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCC-
T ss_pred             HHHhcCCCCCCeEEEEeCCCCcchHHHHHHhccccccC--CCCeEEEecCCchhhhcCCCCceEEeeehhhhhhhhcCC-
Confidence            9987764 578999999999999999999999874432  478999999999999999999999999999999999999 


Q ss_pred             CcCCCCcCCCcCcceEEcCCCcHHHHHHHHHHHHHHHHHHHhccccccccCceEEEEeecCCCCCCCC-CCCCcchHHHH
Q 024268          160 LTDEAGLPLINKGKIFISKTSPVAVKEAYLRQFEEDFSLFLKSRSQEMVPNGRLVLVFNGRPSADFTR-DYCYPIPWESL  238 (270)
Q Consensus       160 v~~~~~l~~~nkg~i~i~~ss~~~v~~ay~~Q~~~Dl~~FL~~Ra~EL~~GG~lvl~~~gr~~~~~~~-~~~~~~~~~~l  238 (270)
                          +++.+ |||+||+..+++++|.+||++||++||.+||++||+||+|||+|||+++||++.++.+ +.+.  +|++|
T Consensus       157 ----~~l~~-n~~~i~~~~~~~~~v~~ay~~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~~~~~~~~~~~--~~~~l  229 (359)
T d1m6ex_         157 ----IGIES-NKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCL--IWQLL  229 (359)
T ss_dssp             ----SCCCC-CTTTTSSCSSSCCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTTTST--TTHHH
T ss_pred             ----ccccC-CCCcEEEcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEEEEEeccCCCCCCCCccch--HHHHH
Confidence                78888 9999999999999999999999999999999999999999999999999999988876 5555  99999


Q ss_pred             HHHHHHHHHccCCCchhhccccccc
Q 024268          239 SEAIAAMVSEVRSNFQSFLSSLKLD  263 (270)
Q Consensus       239 ~~~l~dmv~eGli~~ee~~~~~~~~  263 (270)
                      +++|+|||.||+|++||+ +++|+|
T Consensus       230 ~~al~dmv~eGlI~eek~-dsfn~P  253 (359)
T d1m6ex_         230 AMALNQMVSEGLIEEEKM-DKFNIP  253 (359)
T ss_dssp             HHHHHHHHHTTCSCCSTT-GGGCCC
T ss_pred             HHHHHHHHHcCCCCHHHH-HhccCc
Confidence            999999999999999999 677776
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure