Citrus Sinensis ID: 024295


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MTNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI
ccccccccccccccccccccccEEEccEEEEEEEEcccccccEEEEccEEEEcccccccccEEEEccccccccccEEEccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccHHHHHHccccEEccccccccccHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccccEEEEEEEccccccccccccHHHccccEEEEEEcccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccEEEEEEc
ccccccccccccccccccccccEEEccEEEEccccccccEcEEEEEHHHEEEccccccHHHHHHHHcHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccEEEcHHHccHHHHHEEEEEccccccccEEEEccccHHHHHHHHHHccccccEEEEcccccccccEEEccHHHHcccEEEEccHHHccHHHHHHHHHHHHHccccccHHHEEEEEEHHHHHHHHHHHHcccccEEEEEc
mtnlclkypialnglmldstsrmsvrgqKLYHIFScstwseymvidanyvvkvdpsidpsdasflscgfttgyGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIigidknpwkkekgkafgmtdfinpddepnkSISELVKGIThgmgvdycfectgvpslLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACggrtlkgttfggiktksdlptlldkcknkeFKLHQLLTHHVKLEEIDKAIQLlkqpdcvkvliti
MTNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAkiigidknpwkkEKGKAFGMtdfinpddepnKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACGgrtlkgttfggiktksdlpTLLDKCKNKEFKLHQLLTHHVKLEEIDKaiqllkqpdCVKVLITI
MTNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKgssvavlglgtvglgavdgaRMHGAAKIIGIDKNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTkvgkgkvivigvgvDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI
***LCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFI*********ISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLI**
MTNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI
MTNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI
**NLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q9FH04390 Alcohol dehydrogenase-lik yes no 0.985 0.679 0.425 1e-57
Q0V7W6389 Alcohol dehydrogenase-lik no no 0.981 0.678 0.451 2e-56
Q9SK87386 Alcohol dehydrogenase-lik no no 0.981 0.683 0.440 3e-56
Q9SK86388 Alcohol dehydrogenase-lik no no 0.981 0.680 0.437 2e-54
Q8LEB2381 Alcohol dehydrogenase-lik no no 0.973 0.687 0.416 1e-52
Q96533379 Alcohol dehydrogenase cla no no 0.966 0.686 0.419 1e-51
A1L4Y2394 Alcohol dehydrogenase-lik no no 0.985 0.672 0.407 4e-51
P80572378 Alcohol dehydrogenase cla N/A no 0.973 0.693 0.408 4e-50
Q0DWH1381 Alcohol dehydrogenase cla no no 0.966 0.682 0.408 6e-50
A2XAZ3381 Alcohol dehydrogenase cla N/A no 0.966 0.682 0.408 6e-50
>sp|Q9FH04|ADHL7_ARATH Alcohol dehydrogenase-like 7 OS=Arabidopsis thaliana GN=At5g42250 PE=2 SV=1 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 115/270 (42%), Positives = 174/270 (64%), Gaps = 5/270 (1%)

Query: 2   TNLCLKYPIALNGLM--LDSTSRMS-VRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSID 58
           +NLC K+P  ++  M   D++SR + + G+ L+H  + S++SEY V+D   VVK+D SI 
Sbjct: 119 SNLCSKFPFKVSPWMPRYDNSSRFTDLNGETLFHFLNVSSFSEYTVLDVANVVKIDSSIP 178

Query: 59  PSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKN 118
           PS A  LSCG +TG GAAW+ AKVEKGS+V + GLG++GL   +GAR+ GA++IIG+D N
Sbjct: 179 PSRACLLSCGVSTGVGAAWETAKVEKGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDIN 238

Query: 119 PWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTK 178
           P K + G+ FG+T+F+N        +SE++  +T G G DYCFEC G  SL+ EA    +
Sbjct: 239 PTKFQVGQKFGVTEFVNSMTCEKNRVSEVINEMTDG-GADYCFECVGSSSLVQEAYACCR 297

Query: 179 VGKGKVIVIGVGVD-AMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKL 237
            G GK I +GV    + + L+   +   G+ L G+ FGG+K K+ +P LL +  + E +L
Sbjct: 298 QGWGKTITLGVDKPGSQICLDSFDVLHHGKILMGSLFGGLKAKTHIPILLKRYLSNELEL 357

Query: 238 HQLLTHHVKLEEIDKAIQLLKQPDCVKVLI 267
            + +TH +K EEI+ A QLL +  C++ ++
Sbjct: 358 DKFVTHEMKFEEINDAFQLLLEGKCIRCVL 387





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|Q0V7W6|ADHL5_ARATH Alcohol dehydrogenase-like 5 OS=Arabidopsis thaliana GN=At4g22110 PE=2 SV=1 Back     alignment and function description
>sp|Q9SK87|ADHL2_ARATH Alcohol dehydrogenase-like 2 OS=Arabidopsis thaliana GN=At1g22440 PE=2 SV=1 Back     alignment and function description
>sp|Q9SK86|ADHL1_ARATH Alcohol dehydrogenase-like 1 OS=Arabidopsis thaliana GN=At1g22430 PE=2 SV=1 Back     alignment and function description
>sp|Q8LEB2|ADHL6_ARATH Alcohol dehydrogenase-like 6 OS=Arabidopsis thaliana GN=At5g24760 PE=2 SV=2 Back     alignment and function description
>sp|Q96533|ADHX_ARATH Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2 Back     alignment and function description
>sp|A1L4Y2|ADHL3_ARATH Alcohol dehydrogenase-like 3 OS=Arabidopsis thaliana GN=At1g32780 PE=2 SV=1 Back     alignment and function description
>sp|P80572|ADHX_PEA Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1 Back     alignment and function description
>sp|Q0DWH1|ADHX_ORYSJ Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1 Back     alignment and function description
>sp|A2XAZ3|ADHX_ORYSI Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
224142703 377 predicted protein [Populus trichocarpa] 0.992 0.708 0.716 1e-107
225435026 392 PREDICTED: alcohol dehydrogenase-like 1- 0.988 0.678 0.671 1e-102
224144870336 predicted protein [Populus trichocarpa] 0.988 0.791 0.675 1e-101
297746116 527 unnamed protein product [Vitis vinifera] 0.988 0.504 0.661 1e-100
224144873 378 predicted protein [Populus trichocarpa] 0.988 0.703 0.671 1e-100
147843919 402 hypothetical protein VITISV_023790 [Viti 0.970 0.649 0.659 1e-98
359478643 410 PREDICTED: LOW QUALITY PROTEIN: alcohol 0.988 0.648 0.667 2e-98
388507902 374 unknown [Lotus japonicus] 0.981 0.705 0.650 2e-97
359478647 411 PREDICTED: LOW QUALITY PROTEIN: alcohol 0.988 0.647 0.661 2e-97
367460047 375 alcohol dehydrogenase-like [Glycine max] 0.988 0.709 0.649 2e-97
>gi|224142703|ref|XP_002324694.1| predicted protein [Populus trichocarpa] gi|222866128|gb|EEF03259.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/268 (71%), Positives = 223/268 (83%), Gaps = 1/268 (0%)

Query: 2   TNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSD 61
           TNLCLKYP+ LNGLM D TSRMS+ GQKLYH+ +CSTWSEYMVID NYVVK+DPSID   
Sbjct: 111 TNLCLKYPLILNGLMPDGTSRMSINGQKLYHLITCSTWSEYMVIDTNYVVKIDPSIDLPH 170

Query: 62  ASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWK 121
           ASFLSCGF+TG+G+AW+EA VEKGSSVAV+GLG VGLGA++GARM GAAKIIGIDKN  K
Sbjct: 171 ASFLSCGFSTGFGSAWREANVEKGSSVAVIGLGAVGLGAIEGARMQGAAKIIGIDKNEKK 230

Query: 122 KEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGK 181
           +EKG+AFGMTDFINPD+  NK ISEL+K IT G+GVDYCFECTGV  L++EAL  TK GK
Sbjct: 231 REKGQAFGMTDFINPDEYFNKPISELIKDITGGLGVDYCFECTGVGPLINEALLATKPGK 290

Query: 182 GKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLL 241
           G+  V+G G D  V +N + L CGG TLKG+ FGG+K KS LP LLDKCKNKEF L +LL
Sbjct: 291 GETFVVGAGTDLTVSINFLPLLCGG-TLKGSLFGGLKIKSHLPILLDKCKNKEFNLDELL 349

Query: 242 THHVKLEEIDKAIQLLKQPDCVKVLITI 269
           TH V L++I+KA QLL+QPDCVKVLI +
Sbjct: 350 THQVMLDDINKAFQLLEQPDCVKVLIKM 377




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225435026|ref|XP_002281265.1| PREDICTED: alcohol dehydrogenase-like 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224144870|ref|XP_002325445.1| predicted protein [Populus trichocarpa] gi|222862320|gb|EEE99826.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297746116|emb|CBI16172.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224144873|ref|XP_002325446.1| predicted protein [Populus trichocarpa] gi|222862321|gb|EEE99827.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147843919|emb|CAN83716.1| hypothetical protein VITISV_023790 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478643|ref|XP_002281275.2| PREDICTED: LOW QUALITY PROTEIN: alcohol dehydrogenase-like 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|388507902|gb|AFK42017.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|359478647|ref|XP_003632151.1| PREDICTED: LOW QUALITY PROTEIN: alcohol dehydrogenase-like 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|367460047|ref|NP_001238395.2| alcohol dehydrogenase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
TAIR|locus:2157627390 AT5G42250 [Arabidopsis thalian 0.985 0.679 0.366 1.3e-43
TAIR|locus:2009512386 AT1G22440 [Arabidopsis thalian 0.981 0.683 0.381 3.5e-43
TAIR|locus:2120663389 AT4G22110 [Arabidopsis thalian 0.981 0.678 0.385 9.3e-43
TAIR|locus:2009522388 AT1G22430 [Arabidopsis thalian 0.981 0.680 0.381 8.4e-42
TAIR|locus:2184575381 AT5G24760 [Arabidopsis thalian 0.981 0.692 0.348 7.5e-41
TAIR|locus:2035619394 AT1G32780 [Arabidopsis thalian 0.985 0.672 0.353 3.4e-38
UNIPROTKB|J9P795379 ADH4 "Uncharacterized protein" 0.981 0.696 0.335 2.1e-36
UNIPROTKB|F1S0Z0391 ADH7 "Uncharacterized protein" 0.981 0.675 0.338 1.2e-35
UNIPROTKB|I3LFH9374 ADH7 "Uncharacterized protein" 0.981 0.705 0.338 1.2e-35
MGI|MGI:1349472377 Adh4 "alcohol dehydrogenase 4 0.977 0.697 0.332 2.4e-35
TAIR|locus:2157627 AT5G42250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 460 (167.0 bits), Expect = 1.3e-43, P = 1.3e-43
 Identities = 99/270 (36%), Positives = 151/270 (55%)

Query:     2 TNLCLKYPIALNGLM--LDSTSRMS-VRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSID 58
             +NLC K+P  ++  M   D++SR + + G+ L+H  + S++SEY V+D   VVK+D SI 
Sbjct:   119 SNLCSKFPFKVSPWMPRYDNSSRFTDLNGETLFHFLNVSSFSEYTVLDVANVVKIDSSIP 178

Query:    59 PSDASFLSCGFTTGYGAAWKEAKVEKXXXXXXXXXXXXXXXXXXXXRMHGAAKIIGIDKN 118
             PS A  LSCG +TG GAAW+ AKVEK                    R+ GA++IIG+D N
Sbjct:   179 PSRACLLSCGVSTGVGAAWETAKVEKGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDIN 238

Query:   119 PWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTX 178
             P K + G+ FG+T+F+N        +SE++  +T G G DYCFEC G  SL+ EA     
Sbjct:   239 PTKFQVGQKFGVTEFVNSMTCEKNRVSEVINEMTDG-GADYCFECVGSSSLVQEAYACCR 297

Query:   179 XXXXXXXXXXXXXD-AMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKL 237
                            + + L+   +   G+ L G+ FGG+K K+ +P LL +  + E +L
Sbjct:   298 QGWGKTITLGVDKPGSQICLDSFDVLHHGKILMGSLFGGLKAKTHIPILLKRYLSNELEL 357

Query:   238 HQLLTHHVKLEEIDKAIQLLKQPDCVKVLI 267
              + +TH +K EEI+ A QLL +  C++ ++
Sbjct:   358 DKFVTHEMKFEEINDAFQLLLEGKCIRCVL 387




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2009512 AT1G22440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120663 AT4G22110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009522 AT1G22430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184575 AT5G24760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035619 AT1G32780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9P795 ADH4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0Z0 ADH7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFH9 ADH7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1349472 Adh4 "alcohol dehydrogenase 4 (class II), pi polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 1e-123
cd08301369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 4e-98
cd08300368 cd08300, alcohol_DH_class_III, class III alcohol d 2e-83
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 6e-79
PLN02740381 PLN02740, PLN02740, Alcohol dehydrogenase-like 7e-76
PLN02827378 PLN02827, PLN02827, Alcohol dehydrogenase-like 8e-73
cd08299373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 9e-73
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 3e-72
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 4e-71
TIGR02818368 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat 3e-66
TIGR03989369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 3e-48
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 3e-47
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 5e-47
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 2e-43
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 1e-39
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 2e-35
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 1e-33
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 3e-33
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 3e-32
TIGR03451358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 2e-31
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 2e-31
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 2e-29
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 7e-29
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 8e-29
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 1e-28
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 6e-28
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 8e-28
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 2e-27
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 7e-26
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 4e-25
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 4e-25
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 1e-24
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 1e-22
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 1e-20
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 2e-20
cd05281341 cd05281, TDH, Threonine dehydrogenase 2e-20
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 2e-19
cd08287345 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase 4e-19
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 5e-18
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 6e-18
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 8e-18
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 9e-18
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 7e-17
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 7e-16
TIGR03366280 TIGR03366, HpnZ_proposed, putative phosphonate cat 6e-15
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 7e-15
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 8e-15
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 1e-14
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 4e-14
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 9e-14
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 1e-13
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 2e-13
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 2e-13
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 4e-13
cd08282375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 6e-13
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 1e-12
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 4e-12
TIGR03201349 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 8e-12
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 2e-11
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 6e-11
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 6e-11
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 3e-10
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 3e-10
PRK10309347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 4e-09
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 9e-09
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 2e-08
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 6e-08
cd08296333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases 1e-07
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 7e-07
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 9e-07
TIGR02819393 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas 1e-06
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 2e-06
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 2e-06
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 8e-06
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 6e-05
PLN02514357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 9e-05
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 1e-04
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 1e-04
cd08230355 cd08230, glucose_DH, Glucose dehydrogenase 3e-04
PLN02586360 PLN02586, PLN02586, probable cinnamyl alcohol dehy 4e-04
smart00829287 smart00829, PKS_ER, Enoylreductase 5e-04
PRK10083339 PRK10083, PRK10083, putative oxidoreductase; Provi 8e-04
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/red 0.001
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 0.002
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 0.002
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 0.003
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 0.004
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
 Score =  356 bits (915), Expect = e-123
 Identities = 136/267 (50%), Positives = 182/267 (68%), Gaps = 3/267 (1%)

Query: 2   TNLCLKYPIALNGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSD 61
           TNLC KY    +GLM D TSR + +G+K+YH    ST+S+Y V+D NYV K+DP+     
Sbjct: 102 TNLCQKYRANESGLMPDGTSRFTCKGKKIYHFLGTSTFSQYTVVDENYVAKIDPAAPLEH 161

Query: 62  ASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWK 121
              L CGF+TGYGAAW  AKVE GS+VAV GLG VGL A+ GA++ GA++IIG+D N  K
Sbjct: 162 VCLLGCGFSTGYGAAWNTAKVEPGSTVAVFGLGAVGLSAIMGAKIAGASRIIGVDINEDK 221

Query: 122 KEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGK 181
            EK K FG TDFINP D   K +SE+++ +T G GVDY FECTG   L++EALE+TK+G 
Sbjct: 222 FEKAKEFGATDFINPKDSD-KPVSEVIREMT-GGGVDYSFECTGNADLMNEALESTKLGW 279

Query: 182 GKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLL 241
           G  +V+GV   A + +    L   GRT KG+ FGG K++SD+P L+ K  NK+F L +L+
Sbjct: 280 GVSVVVGVPPGAELSIRPFQLIL-GRTWKGSFFGGFKSRSDVPKLVSKYMNKKFDLDELI 338

Query: 242 THHVKLEEIDKAIQLLKQPDCVKVLIT 268
           TH +  EEI+K   L+K  +C++ +IT
Sbjct: 339 THVLPFEEINKGFDLMKSGECIRTVIT 365


NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the substrate binding pocket and therefore in substrate specificity. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48) , then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 365

>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 100.0
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 100.0
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 100.0
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 100.0
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 100.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 100.0
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 100.0
PLN02740381 Alcohol dehydrogenase-like 100.0
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 100.0
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 100.0
PLN02827378 Alcohol dehydrogenase-like 100.0
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 100.0
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 100.0
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 100.0
PRK09880343 L-idonate 5-dehydrogenase; Provisional 100.0
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 100.0
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 100.0
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 100.0
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 100.0
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 100.0
PLN02586360 probable cinnamyl alcohol dehydrogenase 100.0
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 100.0
PLN02178375 cinnamyl-alcohol dehydrogenase 100.0
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 100.0
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 100.0
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 100.0
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 100.0
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 100.0
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 100.0
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 100.0
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 100.0
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.98
PLN02514357 cinnamyl-alcohol dehydrogenase 99.98
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.98
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.98
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.97
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.97
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.97
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.97
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 99.97
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.97
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.97
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.97
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.97
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.97
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.97
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.97
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.97
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.97
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.97
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.97
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.97
PRK10083339 putative oxidoreductase; Provisional 99.97
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.97
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.97
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.97
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.97
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.97
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.97
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.96
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.96
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.96
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.96
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.96
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.96
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.96
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.96
PTZ00354334 alcohol dehydrogenase; Provisional 99.96
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.96
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 99.96
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.96
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.96
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.96
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.96
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.96
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.96
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.96
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.96
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.96
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.96
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.95
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.95
PLN02702364 L-idonate 5-dehydrogenase 99.95
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.95
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.95
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.95
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.95
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.95
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.95
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.95
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.95
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.95
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.95
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 99.95
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.95
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.94
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.94
PRK13771334 putative alcohol dehydrogenase; Provisional 99.94
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.94
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.94
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.94
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.94
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.94
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.94
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.94
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.94
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.94
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.94
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.94
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.93
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 99.93
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.93
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.93
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.93
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 99.93
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.93
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.93
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.92
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.92
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.92
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.92
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.91
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.91
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.91
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.83
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.59
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 99.51
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 99.41
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.82
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.72
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.53
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.44
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.41
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.41
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.38
PLN02494477 adenosylhomocysteinase 98.3
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.27
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.13
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 98.04
PTZ00075476 Adenosylhomocysteinase; Provisional 98.02
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 98.0
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.95
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.95
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.94
PRK08324681 short chain dehydrogenase; Validated 97.92
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.85
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.84
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.83
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.79
COG4122219 Predicted O-methyltransferase [General function pr 97.77
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.72
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.71
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.71
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.7
TIGR00438188 rrmJ cell division protein FtsJ. 97.66
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.65
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 97.63
COG0300265 DltE Short-chain dehydrogenases of various substra 97.62
PRK04148134 hypothetical protein; Provisional 97.58
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 97.58
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.58
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.57
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.53
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 97.52
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.49
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.47
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.45
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.43
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.42
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.41
PF11017314 DUF2855: Protein of unknown function (DUF2855); In 97.41
PRK07402196 precorrin-6B methylase; Provisional 97.39
PRK14967223 putative methyltransferase; Provisional 97.37
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.37
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.36
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.33
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.29
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.26
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.26
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.22
PRK05993277 short chain dehydrogenase; Provisional 97.21
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.19
PRK11207197 tellurite resistance protein TehB; Provisional 97.19
PRK08177225 short chain dehydrogenase; Provisional 97.17
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.17
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.16
PRK13940414 glutamyl-tRNA reductase; Provisional 97.14
PRK05693274 short chain dehydrogenase; Provisional 97.14
PLN02589247 caffeoyl-CoA O-methyltransferase 97.11
PLN02476278 O-methyltransferase 97.08
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.06
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.06
PRK12742237 oxidoreductase; Provisional 97.05
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.03
PRK06182273 short chain dehydrogenase; Validated 97.02
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.0
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.99
PRK07060245 short chain dehydrogenase; Provisional 96.96
PRK08017256 oxidoreductase; Provisional 96.94
PRK00811283 spermidine synthase; Provisional 96.93
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 96.93
PLN03209 576 translocon at the inner envelope of chloroplast su 96.92
PRK06139 330 short chain dehydrogenase; Provisional 96.92
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.89
COG4106257 Tam Trans-aconitate methyltransferase [General fun 96.88
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 96.87
PRK07326237 short chain dehydrogenase; Provisional 96.87
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.86
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 96.84
PRK04266226 fibrillarin; Provisional 96.83
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.82
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 96.82
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 96.81
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.79
PLN03075296 nicotianamine synthase; Provisional 96.79
PRK04457262 spermidine synthase; Provisional 96.79
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.78
PRK06057255 short chain dehydrogenase; Provisional 96.78
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.77
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.75
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.73
PRK08265261 short chain dehydrogenase; Provisional 96.73
PRK07806248 short chain dehydrogenase; Provisional 96.72
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 96.72
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.72
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.71
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 96.7
PRK07109 334 short chain dehydrogenase; Provisional 96.69
PRK06949258 short chain dehydrogenase; Provisional 96.69
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.68
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.68
PLN02366308 spermidine synthase 96.67
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.67
PRK00536262 speE spermidine synthase; Provisional 96.66
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.66
PRK07825273 short chain dehydrogenase; Provisional 96.66
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.66
PLN02244340 tocopherol O-methyltransferase 96.65
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.64
PRK06841255 short chain dehydrogenase; Provisional 96.64
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.63
PRK08618325 ornithine cyclodeaminase; Validated 96.62
PRK06953222 short chain dehydrogenase; Provisional 96.6
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.6
PRK08339263 short chain dehydrogenase; Provisional 96.6
PRK07831262 short chain dehydrogenase; Provisional 96.57
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 96.57
PLN02780320 ketoreductase/ oxidoreductase 96.56
PRK08317241 hypothetical protein; Provisional 96.56
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.54
PRK07340304 ornithine cyclodeaminase; Validated 96.54
PRK05872296 short chain dehydrogenase; Provisional 96.54
PRK06196 315 oxidoreductase; Provisional 96.54
PRK12829264 short chain dehydrogenase; Provisional 96.53
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.53
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 96.53
PRK07574385 formate dehydrogenase; Provisional 96.53
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.53
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.52
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 96.51
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.51
PRK15116268 sulfur acceptor protein CsdL; Provisional 96.49
PLN00203519 glutamyl-tRNA reductase 96.49
PRK06500249 short chain dehydrogenase; Provisional 96.49
PRK07904253 short chain dehydrogenase; Provisional 96.49
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.48
COG0421282 SpeE Spermidine synthase [Amino acid transport and 96.48
PRK05866293 short chain dehydrogenase; Provisional 96.47
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 96.46
PRK07814263 short chain dehydrogenase; Provisional 96.45
PRK12828239 short chain dehydrogenase; Provisional 96.45
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.42
PRK09072263 short chain dehydrogenase; Provisional 96.42
COG2910211 Putative NADH-flavin reductase [General function p 96.41
PRK06180277 short chain dehydrogenase; Provisional 96.41
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 96.4
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.37
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 96.37
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.36
PRK05867253 short chain dehydrogenase; Provisional 96.36
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 96.34
PLN02233261 ubiquinone biosynthesis methyltransferase 96.33
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 96.32
PRK09291257 short chain dehydrogenase; Provisional 96.31
CHL00194 317 ycf39 Ycf39; Provisional 96.3
PRK01581374 speE spermidine synthase; Validated 96.29
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 96.29
PRK07677252 short chain dehydrogenase; Provisional 96.29
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.28
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.28
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.28
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.28
PRK08300 302 acetaldehyde dehydrogenase; Validated 96.28
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.27
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 96.27
PRK06849 389 hypothetical protein; Provisional 96.27
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.26
PRK08267260 short chain dehydrogenase; Provisional 96.26
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.25
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.25
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 96.25
PRK07478254 short chain dehydrogenase; Provisional 96.24
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 96.24
PLN03139386 formate dehydrogenase; Provisional 96.23
PRK12939250 short chain dehydrogenase; Provisional 96.22
cd01483143 E1_enzyme_family Superfamily of activating enzymes 96.21
PRK05884223 short chain dehydrogenase; Provisional 96.21
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.21
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.21
PRK07024257 short chain dehydrogenase; Provisional 96.2
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.2
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.18
PRK13243333 glyoxylate reductase; Reviewed 96.18
PRK06128300 oxidoreductase; Provisional 96.18
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.18
PRK08328231 hypothetical protein; Provisional 96.17
PRK08862227 short chain dehydrogenase; Provisional 96.16
PRK06198260 short chain dehydrogenase; Provisional 96.16
PRK07062265 short chain dehydrogenase; Provisional 96.15
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.15
PRK10258251 biotin biosynthesis protein BioC; Provisional 96.14
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 96.14
PRK08264238 short chain dehydrogenase; Validated 96.12
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.11
PRK08703239 short chain dehydrogenase; Provisional 96.1
PTZ00146293 fibrillarin; Provisional 96.1
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.09
PRK07576264 short chain dehydrogenase; Provisional 96.09
PLN02823336 spermine synthase 96.09
PRK08340259 glucose-1-dehydrogenase; Provisional 96.08
TIGR00452314 methyltransferase, putative. Known examples to dat 96.07
PRK06125259 short chain dehydrogenase; Provisional 96.07
PLN02490340 MPBQ/MSBQ methyltransferase 96.06
PRK07454241 short chain dehydrogenase; Provisional 96.06
PRK06483236 dihydromonapterin reductase; Provisional 96.06
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.06
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.05
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 96.04
PRK07774250 short chain dehydrogenase; Provisional 96.03
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.02
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.02
PRK07063260 short chain dehydrogenase; Provisional 96.0
PRK05717255 oxidoreductase; Validated 95.99
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 95.98
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 95.98
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 95.98
PRK06181263 short chain dehydrogenase; Provisional 95.97
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.97
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 95.96
PRK06194287 hypothetical protein; Provisional 95.96
PRK05875276 short chain dehydrogenase; Provisional 95.96
PRK06172253 short chain dehydrogenase; Provisional 95.96
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.96
PRK06138252 short chain dehydrogenase; Provisional 95.96
PRK12367245 short chain dehydrogenase; Provisional 95.95
PRK07577234 short chain dehydrogenase; Provisional 95.95
PRK07035252 short chain dehydrogenase; Provisional 95.95
PRK05854 313 short chain dehydrogenase; Provisional 95.94
PRK06101240 short chain dehydrogenase; Provisional 95.92
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 95.92
PRK14903431 16S rRNA methyltransferase B; Provisional 95.91
PRK08643256 acetoin reductase; Validated 95.91
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 95.91
PRK06179270 short chain dehydrogenase; Provisional 95.9
PRK07890258 short chain dehydrogenase; Provisional 95.89
PRK08277278 D-mannonate oxidoreductase; Provisional 95.89
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 95.89
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 95.89
PRK08219227 short chain dehydrogenase; Provisional 95.89
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.88
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.88
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 95.87
PRK06719157 precorrin-2 dehydrogenase; Validated 95.85
PRK06484520 short chain dehydrogenase; Validated 95.84
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 95.83
PRK08628258 short chain dehydrogenase; Provisional 95.83
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.82
PRK07417 279 arogenate dehydrogenase; Reviewed 95.81
PRK11579 346 putative oxidoreductase; Provisional 95.8
PRK06914280 short chain dehydrogenase; Provisional 95.79
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 95.78
PRK12335287 tellurite resistance protein TehB; Provisional 95.78
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.78
PRK07067257 sorbitol dehydrogenase; Provisional 95.77
PRK06484 520 short chain dehydrogenase; Validated 95.76
PRK06197306 short chain dehydrogenase; Provisional 95.76
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 95.75
PRK05876275 short chain dehydrogenase; Provisional 95.75
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 95.75
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 95.75
PRK06398258 aldose dehydrogenase; Validated 95.75
PRK06114254 short chain dehydrogenase; Provisional 95.74
PRK09242257 tropinone reductase; Provisional 95.74
PRK06482276 short chain dehydrogenase; Provisional 95.73
PRK10538248 malonic semialdehyde reductase; Provisional 95.73
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.72
PRK14901434 16S rRNA methyltransferase B; Provisional 95.71
PLN02336475 phosphoethanolamine N-methyltransferase 95.71
PRK14904445 16S rRNA methyltransferase B; Provisional 95.71
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.71
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.7
PRK08263275 short chain dehydrogenase; Provisional 95.69
PLN02928347 oxidoreductase family protein 95.69
PRK08085254 gluconate 5-dehydrogenase; Provisional 95.68
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 95.68
PRK07453 322 protochlorophyllide oxidoreductase; Validated 95.67
PRK09186256 flagellin modification protein A; Provisional 95.67
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 95.66
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.65
PRK08589272 short chain dehydrogenase; Validated 95.65
PRK08251248 short chain dehydrogenase; Provisional 95.64
PRK13255218 thiopurine S-methyltransferase; Reviewed 95.64
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.64
PRK07832272 short chain dehydrogenase; Provisional 95.64
PRK14902444 16S rRNA methyltransferase B; Provisional 95.63
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 95.63
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.63
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 95.62
PRK06940275 short chain dehydrogenase; Provisional 95.62
KOG2017 427 consensus Molybdopterin synthase sulfurylase [Coen 95.62
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 95.62
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 95.61
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 95.61
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.61
PRK06124256 gluconate 5-dehydrogenase; Provisional 95.6
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 95.6
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 95.59
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.57
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 95.56
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.56
PRK10901427 16S rRNA methyltransferase B; Provisional 95.55
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.54
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 95.54
PRK13403 335 ketol-acid reductoisomerase; Provisional 95.53
PRK08278273 short chain dehydrogenase; Provisional 95.53
PRK07856252 short chain dehydrogenase; Provisional 95.53
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 95.52
PRK06141314 ornithine cyclodeaminase; Validated 95.51
PLN02253280 xanthoxin dehydrogenase 95.51
PRK07074257 short chain dehydrogenase; Provisional 95.51
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.49
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 95.48
PRK10669558 putative cation:proton antiport protein; Provision 95.47
PRK03612521 spermidine synthase; Provisional 95.47
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.47
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.45
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 95.44
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.44
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.44
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 95.42
PRK03562621 glutathione-regulated potassium-efflux system prot 95.41
PRK14968188 putative methyltransferase; Provisional 95.41
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 95.4
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 95.39
PRK06720169 hypothetical protein; Provisional 95.39
PRK07102243 short chain dehydrogenase; Provisional 95.39
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 95.39
PRK08226263 short chain dehydrogenase; Provisional 95.37
COG0673 342 MviM Predicted dehydrogenases and related proteins 95.36
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 95.36
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.36
PRK12480330 D-lactate dehydrogenase; Provisional 95.35
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 95.33
PRK07411 390 hypothetical protein; Validated 95.33
PRK08223287 hypothetical protein; Validated 95.33
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 95.31
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 95.31
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.31
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 95.29
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 95.29
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.28
PRK06436303 glycerate dehydrogenase; Provisional 95.27
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.27
PRK03659601 glutathione-regulated potassium-efflux system prot 95.27
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.27
PLN00016 378 RNA-binding protein; Provisional 95.26
PRK07985294 oxidoreductase; Provisional 95.25
PRK12747252 short chain dehydrogenase; Provisional 95.25
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.24
PRK07097265 gluconate 5-dehydrogenase; Provisional 95.24
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.23
KOG1252362 consensus Cystathionine beta-synthase and related 95.22
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 95.22
PRK07791286 short chain dehydrogenase; Provisional 95.22
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 95.21
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.21
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 95.19
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.19
PRK05650270 short chain dehydrogenase; Provisional 95.17
PRK10206 344 putative oxidoreductase; Provisional 95.16
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 95.16
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 95.16
KOG3010261 consensus Methyltransferase [General function pred 95.15
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.14
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 95.13
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 95.13
COG0031300 CysK Cysteine synthase [Amino acid transport and m 95.12
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 95.12
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=4.4e-41  Score=271.46  Aligned_cols=263  Identities=40%  Similarity=0.713  Sum_probs=242.8

Q ss_pred             CCCCCCCCcccc-cccccCCceeeeecCeEEeeeeccCcccceEeeccCceEEcCCCCCcccccccccchhhhHHHHHHh
Q 024295            1 MTNLCLKYPIAL-NGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKE   79 (269)
Q Consensus         1 ~~~~c~~~~~~~-~~~vg~~~~~~~~~Gd~v~~~~~~g~~a~~~~v~~~~~~~vp~~~~~~~aa~~~~~~~~a~~~l~~~   79 (269)
                      ++++|....-+- .|..-+|..++.-+|..++.+...++|+||.++++..+++++++.+++.++++.|...|.+.+..+.
T Consensus       101 k~nlC~~~~~~~~kG~m~dGttrls~~~~~~~h~lG~stFa~y~vv~~~s~vki~~~~p~~~a~llGCgV~TG~Gav~nt  180 (366)
T COG1062         101 KPNLCEAIRATQGKGTMPDGTTRLSGNGVPVYHYLGCSTFAEYTVVHEISLVKIDPDAPLEKACLLGCGVTTGIGAVVNT  180 (366)
T ss_pred             CcccccchhhhcccccccCCceeeecCCcceeeeeccccchhheeecccceEECCCCCCccceEEEeeeeccChHHhhhc
Confidence            367787666555 6777788888876688888888888999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCeEEEEcCChhHHHHHHHHHHcCCCeEEEEcCCcchHHHHHhCCCceeeCCCCCCCc-cHHHHHHhhhCCCCcc
Q 024295           80 AKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFINPDDEPNK-SISELVKGITHGMGVD  158 (269)
Q Consensus        80 ~~~~~~~~vlI~G~g~~G~~a~~la~~~g~~~v~~~~~~~~~~~~~~~~g~~~v~~~~~~~~~-~~~~~i~~~~~~~~~d  158 (269)
                      +++++|++|.|.|.|++|++++|-|+..|+++++++|.+++|+++++++|+++++|.++   . +..+.+++++++ ++|
T Consensus       181 a~v~~G~tvaV~GlGgVGlaaI~gA~~agA~~IiAvD~~~~Kl~~A~~fGAT~~vn~~~---~~~vv~~i~~~T~g-G~d  256 (366)
T COG1062         181 AKVEPGDTVAVFGLGGVGLAAIQGAKAAGAGRIIAVDINPEKLELAKKFGATHFVNPKE---VDDVVEAIVELTDG-GAD  256 (366)
T ss_pred             ccCCCCCeEEEEeccHhHHHHHHHHHHcCCceEEEEeCCHHHHHHHHhcCCceeecchh---hhhHHHHHHHhcCC-CCC
Confidence            99999999999999999999999999999999999999999999999999999999987   5 699999999998 999


Q ss_pred             EEEEccCChhHHHHHHHHcccCCcEEEEEccCCC-ccccchhHhhhhCCceEEeeeccCCCCCCcHHHHHHHHHCCCCCC
Q 024295          159 YCFECTGVPSLLSEALETTKVGKGKVIVIGVGVD-AMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKL  237 (269)
Q Consensus       159 ~v~d~~g~~~~~~~~~~~l~~~~G~~v~~g~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~  237 (269)
                      ++|||+|+...++.++.++.++ |+.+.+|.... ...++++..+. .+++++|++++....+.+++.+++++.+|++.+
T Consensus       257 ~~~e~~G~~~~~~~al~~~~~~-G~~v~iGv~~~~~~i~~~~~~lv-~gr~~~Gs~~G~~~p~~diP~lv~~y~~Gkl~~  334 (366)
T COG1062         257 YAFECVGNVEVMRQALEATHRG-GTSVIIGVAGAGQEISTRPFQLV-TGRVWKGSAFGGARPRSDIPRLVDLYMAGKLPL  334 (366)
T ss_pred             EEEEccCCHHHHHHHHHHHhcC-CeEEEEecCCCCceeecChHHee-ccceEEEEeecCCccccchhHHHHHHHcCCCch
Confidence            9999999999999999999995 99999998875 56667777777 559999999999988999999999999999999


Q ss_pred             CcceeEEeehhhHHHHHHHhcCCCeeeEEeeC
Q 024295          238 HQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI  269 (269)
Q Consensus       238 ~~~~~~~~~~~~~~~a~~~~~~~~~~k~vl~~  269 (269)
                      ++++++.++|++++|||+.|.+++.+|.||+|
T Consensus       335 d~lvt~~~~Le~INeaf~~m~~G~~IR~Vi~~  366 (366)
T COG1062         335 DRLVTHTIPLEDINEAFDLMHEGKSIRSVIRF  366 (366)
T ss_pred             hHHhhccccHHHHHHHHHHHhCCceeeEEecC
Confidence            99999999999999999999999999999875



>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3uko_A378 Crystal Structure Of S-Nitrosoglutathione Reductase 3e-39
4dl9_A396 Crystal Structure Of S-nitrosoglutathione Reductase 3e-39
1e3e_A376 Mouse Class Ii Alcohol Dehydrogenase Complex With N 4e-36
1e3l_A376 P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase 4e-36
1cdo_A374 Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co 2e-35
3cos_A381 Crystal Structure Of Human Class Ii Alcohol Dehydro 5e-35
1d1t_A373 Mutant Of Human Sigma Alcohol Dehydrogenase With Le 7e-35
1agn_A373 X-Ray Structure Of Human Sigma Alcohol Dehydrogenas 7e-35
1mc5_A374 Ternary Complex Of Human Glutathione-Dependent Form 1e-34
1teh_A373 Structure Of Human Liver Chichi Alcohol Dehydrogena 1e-34
2fzw_A373 Structure Of The Binary Complex Of The E67l Mutant 1e-34
3qj5_A374 S-Nitrosoglutathione Reductase (Gsnor) In Complex W 1e-34
1qlh_A374 Horse Liver Alcohol Dehydrogenase Complexed To Nad 1e-33
1ee2_A373 The Structure Of Steroid-Active Alcohol Dehydrogena 2e-33
6adh_A374 Structure Of Triclinic Ternary Complex Of Horse Liv 2e-33
1ju9_A374 Horse Liver Alcohol Dehydrogenase Val292ser Mutant 2e-33
1a71_A374 Ternary Complex Of An Active Site Double Mutant Of 2e-33
1ee2_B373 The Structure Of Steroid-Active Alcohol Dehydrogena 2e-33
1n8k_A374 Horse Liver Alcohol Dehydrogenase Val292thr Mutant 2e-33
1axg_A374 Crystal Structure Of The Val203->ala Mutant Of Live 2e-33
1mgo_A374 Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L 2e-33
1axe_A374 Crystal Structure Of The Active-Site Mutant Phe93-> 2e-33
3oq6_A374 Horse Liver Alcohol Dehydrogenase A317c Mutant Comp 2e-33
1qv6_A374 Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG 3e-33
1hdz_A374 Three-Dimensional Structures Of Three Human Alcohol 2e-31
1hdy_A374 Three-Dimensional Structures Of Three Human Alcohol 2e-31
1hdx_A374 Three-Dimensional Structures Of Three Human Alcohol 3e-31
1ht0_A374 Human Gamma-2 Alcohol Dehydrogense Length = 374 1e-30
1htb_A374 Crystallization Of Human Beta3 Alcohol Dehydrogenas 1e-30
1hso_A374 Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 8e-30
1p0c_A373 Crystal Structure Of The Nadp(H)-Dependent Vertebra 1e-27
1f8f_A371 Crystal Structure Of Benzyl Alcohol Dehydrogenase F 2e-11
3fpl_A351 Chimera Of Alcohol Dehydrogenase By Exchange Of The 8e-07
1vj0_A380 Crystal Structure Of Alcohol Dehydrogenase (Tm0436) 2e-06
1jqb_A351 Alcohol Dehydrogenase From Clostridium Beijerinckii 2e-06
2b83_A351 A Single Amino Acid Substitution In The Clostridium 3e-06
1ped_A351 Bacterial Secondary Alcohol Dehydrogenase (Apo-Form 3e-06
1ykf_A352 Nadp-Dependent Alcohol Dehydrogenase From Thermoana 2e-05
3ftn_A352 Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDRO 5e-05
3fsr_A352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 5e-05
2nvb_A352 Contribution Of Pro275 To The Thermostability Of Th 2e-04
>pdb|3UKO|A Chain A, Crystal Structure Of S-Nitrosoglutathione Reductase From Arabidopsis Thaliana, Complex With Nadh Length = 378 Back     alignment and structure

Iteration: 1

Score = 158 bits (400), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 97/272 (35%), Positives = 139/272 (51%), Gaps = 12/272 (4%) Query: 2 TNLCLKYPIALN-GLML-DSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDP 59 TNLC K A G+M+ D SR SV G+ +YH ST+S+Y V+ V K+DP+ Sbjct: 109 TNLCGKVRSATGVGIMMNDRKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKIDPTAPL 168 Query: 60 SDASFLSCGFTTGYGAAWKEAKVEKXXXXXXXXXXXXXXXXXXXXRMHGAAKIIGIDKNP 119 L CG TG GA W AKVE + GA++IIGID + Sbjct: 169 DKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDS 228 Query: 120 WKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTXX 179 K E K FG+ +F+NP D +K I E++ +T G GVDY FEC G S++ ALE Sbjct: 229 KKYETAKKFGVNEFVNPKDH-DKPIQEVIVDLTDG-GVDYSFECIGNVSVMRAALECCHK 286 Query: 180 XXXXXXXXXXXXD----AMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEF 235 + P ++ GR KGT FGG K+++ +P L++K NKE Sbjct: 287 GWGTSVIVGVAASGQEISTRPFQLVT----GRVWKGTAFGGFKSRTQVPWLVEKYMNKEI 342 Query: 236 KLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLI 267 K+ + +TH++ L EI+KA LL + C++ ++ Sbjct: 343 KVDEYITHNLTLGEINKAFDLLHEGTCLRCVL 374
>pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396 Back     alignment and structure
>pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1E3L|A Chain A, P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed With Nicotinamide Adenine Dinucleotide (Nad), And Zinc Length = 374 Back     alignment and structure
>pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 Back     alignment and structure
>pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 Back     alignment and structure
>pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 Back     alignment and structure
>pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 Back     alignment and structure
>pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 Back     alignment and structure
>pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 Back     alignment and structure
>pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 Back     alignment and structure
>pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 Back     alignment and structure
>pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 Back     alignment and structure
>pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 Back     alignment and structure
>pdb|1A71|A Chain A, Ternary Complex Of An Active Site Double Mutant Of Horse Liver Alcohol Dehydrogenase, Phe93>trp, Val203>ala With Nad And Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 Back     alignment and structure
>pdb|1AXG|A Chain A, Crystal Structure Of The Val203->ala Mutant Of Liver Alcohol Dehydrogenase Complexed With Cofactor Nad And Inhibitor Trifluoroethanol Solved To 2.5 Angstrom Resolution Length = 374 Back     alignment and structure
>pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 Back     alignment and structure
>pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 Back     alignment and structure
>pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 Back     alignment and structure
>pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 Back     alignment and structure
>pdb|1P0C|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Vertebrate Alcohol Dehydrogenase (Adh8) Length = 373 Back     alignment and structure
>pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 Back     alignment and structure
>pdb|3FPL|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of C. Beijerinckii Adh By T. Brockii Adh Length = 351 Back     alignment and structure
>pdb|1VJ0|A Chain A, Crystal Structure Of Alcohol Dehydrogenase (Tm0436) From Thermotoga Maritima At 2.00 A Resolution Length = 380 Back     alignment and structure
>pdb|1JQB|A Chain A, Alcohol Dehydrogenase From Clostridium Beijerinckii: Crystal Structure Of Mutant With Enhanced Thermal Stability Length = 351 Back     alignment and structure
>pdb|2B83|A Chain A, A Single Amino Acid Substitution In The Clostridium Beijerinckii Alcohol Dehydrogenase Is Critical For Thermostabilization Length = 351 Back     alignment and structure
>pdb|1PED|A Chain A, Bacterial Secondary Alcohol Dehydrogenase (Apo-Form) Length = 351 Back     alignment and structure
>pdb|1YKF|A Chain A, Nadp-Dependent Alcohol Dehydrogenase From Thermoanaerobium Brockii Length = 352 Back     alignment and structure
>pdb|3FTN|A Chain A, Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDROGENASE BY EXCHANGE Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|3FSR|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|2NVB|A Chain A, Contribution Of Pro275 To The Thermostability Of The Alcohol Dehydrogenases (Adhs) Length = 352 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 1e-112
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 1e-112
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 1e-112
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 1e-110
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 1e-109
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 2e-91
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 5e-78
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 2e-44
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 3e-42
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 3e-42
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 5e-42
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 1e-39
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 2e-39
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 2e-39
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 2e-38
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 1e-37
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 9e-36
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 8e-35
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 3e-33
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 6e-33
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 2e-31
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 2e-30
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 1e-29
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 1e-29
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 9e-24
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 2e-22
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 9e-22
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 1e-20
3krt_A456 Crotonyl COA reductase; structural genomics, prote 6e-18
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 6e-18
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 1e-17
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 7e-17
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 6e-14
3gms_A340 Putative NADPH:quinone reductase; structural genom 7e-14
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 9e-14
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 2e-13
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 1e-12
4eye_A342 Probable oxidoreductase; structural genomics, niai 2e-12
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 3e-12
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 5e-12
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 1e-10
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-10
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 2e-10
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 1e-09
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 3e-09
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 7e-09
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 1e-08
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 6e-08
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 4e-07
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 8e-07
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 2e-05
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 2e-05
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 1e-04
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
 Score =  327 bits (840), Expect = e-112
 Identities = 101/270 (37%), Positives = 153/270 (56%), Gaps = 5/270 (1%)

Query: 1   MTNLCLKYPIAL-NGLMLDSTSRMSVRGQKLYHIFSCSTWSEYMVIDANYVVKVDPSIDP 59
             N CLK  +++  G M D TSR + RG+ ++H    ST+S+Y V+D   V K+D +   
Sbjct: 107 EGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPL 166

Query: 60  SDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNP 119
                + CGF+TGYG+A K AKV +GS+ AV GLG VGL  + G +  GAA+IIG+D N 
Sbjct: 167 EKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINK 226

Query: 120 WKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKV 179
            K  K K  G T+ +NP D   K I E++  +++G GVD+ FE  G    +  AL   + 
Sbjct: 227 DKFAKAKEVGATECVNPQDY-KKPIQEVLTEMSNG-GVDFSFEVIGRLDTMVTALSCCQE 284

Query: 180 GKGKVIVIGV-GVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLH 238
             G  +++GV      + +N + L   GRT KG  FGG K+K  +P L+     K+F L 
Sbjct: 285 AYGVSVIVGVPPDSQNLSMNPMLLLS-GRTWKGAIFGGFKSKDSVPKLVADFMAKKFALD 343

Query: 239 QLLTHHVKLEEIDKAIQLLKQPDCVKVLIT 268
            L+TH +  E+I++   LL+  + ++ ++T
Sbjct: 344 PLITHVLPFEKINEGFDLLRSGESIRTILT 373


>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 100.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 100.0
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 100.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 100.0
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 100.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
3krt_A456 Crotonyl COA reductase; structural genomics, prote 100.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 100.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 100.0
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 100.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 100.0
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 100.0
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 100.0
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 100.0
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 100.0
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 100.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 100.0
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 100.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 100.0
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 100.0
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 100.0
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.96
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.92
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 99.05
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.98
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.87
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.82
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.78
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.74
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.65
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.51
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.4
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.36
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.32
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.3
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.26
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.19
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.11
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.0
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.99
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.95
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.9
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.87
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.87
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.8
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.76
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.75
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.74
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.74
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.71
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.7
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.69
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.65
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.64
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.62
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.61
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.6
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.58
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.58
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.58
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.54
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.5
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.49
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.49
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.48
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.43
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.43
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.41
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.39
2avd_A229 Catechol-O-methyltransferase; structural genomics, 97.38
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.37
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.37
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.35
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.32
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.31
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.29
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.27
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 97.26
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.26
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.26
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.25
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.25
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.24
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.24
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.23
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.22
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.21
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 97.21
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.19
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.19
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 97.18
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 97.18
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.18
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.18
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.17
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 97.17
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.17
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.17
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.17
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.16
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.16
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.15
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.15
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.14
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.14
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.14
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 97.13
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.13
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.12
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.12
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.12
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.11
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 97.1
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.09
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 97.09
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.09
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 97.08
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 97.08
2b25_A336 Hypothetical protein; structural genomics, methyl 97.08
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.06
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.06
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.06
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.06
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.05
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.05
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.05
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.05
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 97.04
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.03
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.03
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.02
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.02
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.01
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 97.01
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.01
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 97.01
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.0
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.0
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 96.99
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.99
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.98
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.98
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.98
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.97
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 96.97
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.97
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 96.97
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.96
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.96
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 96.96
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.95
4had_A 350 Probable oxidoreductase protein; structural genomi 96.94
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.93
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.93
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.92
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.92
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.92
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 96.91
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.91
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.91
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.91
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.91
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 96.91
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 96.9
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.9
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 96.9
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 96.9
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 96.9
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.89
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 96.89
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 96.88
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.88
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 96.88
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.88
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.87
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.86
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.86
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 96.86
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 96.85
3gem_A260 Short chain dehydrogenase; structural genomics, AP 96.85
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 96.85
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.85
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 96.85
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 96.84
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.84
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.83
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.83
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 96.82
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.82
1ooe_A236 Dihydropteridine reductase; structural genomics, P 96.81
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.81
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.81
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.8
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.8
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.8
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 96.79
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 96.79
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 96.79
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.79
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.78
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.78
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.78
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 96.78
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.78
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 96.78
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 96.77
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.77
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.77
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.77
3tox_A280 Short chain dehydrogenase; structural genomics, PS 96.77
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 96.77
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 96.76
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 96.76
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 96.76
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.76
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 96.76
3tjr_A301 Short chain dehydrogenase; structural genomics, se 96.75
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.74
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.74
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 96.74
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 96.74
3rih_A293 Short chain dehydrogenase or reductase; structural 96.74
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.74
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.74
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.74
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 96.73
3m33_A226 Uncharacterized protein; structural genomics, PSI- 96.73
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.73
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.73
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 96.73
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.72
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 96.72
3f4k_A257 Putative methyltransferase; structural genomics, P 96.71
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.71
3imf_A257 Short chain dehydrogenase; structural genomics, in 96.71
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.7
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.7
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 96.7
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 96.7
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.7
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.7
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.7
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 96.69
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.69
1xq6_A253 Unknown protein; structural genomics, protein stru 96.69
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 96.69
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.69
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 96.69
1vl5_A260 Unknown conserved protein BH2331; putative methylt 96.68
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.68
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 96.68
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.67
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.67
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.67
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.66
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.66
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.66
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 96.66
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.66
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.66
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.66
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.65
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.65
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.65
3edm_A259 Short chain dehydrogenase; structural genomics, ox 96.65
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 96.65
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 96.65
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.64
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.64
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.64
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.64
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.64
1nff_A260 Putative oxidoreductase RV2002; directed evolution 96.63
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.63
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 96.63
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.62
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.62
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.62
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.61
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 96.61
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.61
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 96.6
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.6
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.6
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 96.59
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.59
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.58
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.58
3e03_A274 Short chain dehydrogenase; structural genomics, PS 96.57
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 96.57
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 96.57
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 96.57
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.57
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 96.57
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.56
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.56
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 96.56
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.56
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.55
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.55
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.55
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.55
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 96.55
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.55
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.54
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.54
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 96.54
3hnr_A220 Probable methyltransferase BT9727_4108; structural 96.54
2esr_A177 Methyltransferase; structural genomics, hypothetic 96.54
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.53
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 96.53
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.53
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 96.53
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.53
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 96.52
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.51
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 96.51
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.51
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.51
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.5
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.5
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.49
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 96.49
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.49
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.49
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.49
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 96.48
3cxt_A291 Dehydrogenase with different specificities; rossma 96.48
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.47
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.47
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.46
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.46
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.45
2i7c_A283 Spermidine synthase; transferase, structural genom 96.45
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 96.45
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.45
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.45
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.45
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.45
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 96.45
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.44
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.44
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 96.44
1xkq_A280 Short-chain reductase family member (5D234); parra 96.43
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.43
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 96.43
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 96.42
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 96.42
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.42
2o07_A304 Spermidine synthase; structural genomics, structur 96.42
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.42
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.42
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.41
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.41
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.41
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 96.41
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 96.41
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 96.41
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.4
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.4
2pt6_A321 Spermidine synthase; transferase, structural genom 96.4
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 96.4
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 96.39
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.39
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 96.38
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.38
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 96.38
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 96.37
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.37
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.37
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 96.37
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.36
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.36
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.36
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 96.36
3lpm_A259 Putative methyltransferase; structural genomics, p 96.35
1xhl_A297 Short-chain dehydrogenase/reductase family member 96.35
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.35
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.35
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 96.35
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.34
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.33
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.33
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.32
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.32
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 96.32
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 96.32
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.31
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.31
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.31
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 96.3
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.3
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 96.3
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 96.3
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 96.29
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 96.29
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 96.29
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 96.29
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 96.28
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 96.28
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 96.27
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.26
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.26
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.25
4hg2_A257 Methyltransferase type 11; structural genomics, PS 96.25
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 96.25
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 96.24
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.24
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 96.23
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 96.23
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 96.23
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.23
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 96.23
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.23
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.22
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.22
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.22
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 96.21
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 96.21
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 96.21
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 96.2
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 96.2
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.19
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 96.19
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.18
1spx_A278 Short-chain reductase family member (5L265); paral 96.18
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.17
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 96.17
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.16
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 96.16
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 96.16
3tsc_A277 Putative oxidoreductase; structural genomics, seat 96.14
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.14
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.14
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.14
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 96.14
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.13
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.13
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.12
3ege_A261 Putative methyltransferase from antibiotic biosyn 96.12
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 96.12
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.12
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 96.11
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 96.11
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 96.11
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 96.1
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 96.1
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 96.1
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.09
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.09
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.09
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.09
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=5e-41  Score=289.19  Aligned_cols=230  Identities=43%  Similarity=0.783  Sum_probs=207.0

Q ss_pred             CcccceEeeccCceEEcCCCCCcccccccccchhhhHHHHHHhcCCCCCCeEEEEcCChhHHHHHHHHHHcCCCeEEEEc
Q 024295           37 STWSEYMVIDANYVVKVDPSIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGID  116 (269)
Q Consensus        37 g~~a~~~~v~~~~~~~vp~~~~~~~aa~~~~~~~~a~~~l~~~~~~~~~~~vlI~G~g~~G~~a~~la~~~g~~~v~~~~  116 (269)
                      |+||||++++++.++++|+++++++|+++++++.|||+++.+.++++++++|||+|+|++|++++|+|+..|+++|++++
T Consensus       146 G~~aey~~v~~~~~~~iP~~~~~~~aa~l~~~~~ta~~al~~~~~~~~g~~VlV~GaG~vG~~a~q~a~~~Ga~~Vi~~~  225 (378)
T 3uko_A          146 STFSQYTVVHDVSVAKIDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGID  225 (378)
T ss_dssp             CCSBSEEEEEGGGEEECCTTSCHHHHGGGGTHHHHHHHHHHTTTCCCTTCCEEEECCSHHHHHHHHHHHHHTCSCEEEEC
T ss_pred             cceEeEEEechhheEECCCCCCHHHhhhhhhhHHHHHHHHHhhcCCCCCCEEEEECCCHHHHHHHHHHHHcCCCeEEEEc
Confidence            69999999999999999999999999999999999999998899999999999999999999999999999998899999


Q ss_pred             CCcchHHHHHhCCCceeeCCCCCCCccHHHHHHhhhCCCCccEEEEccCChhHHHHHHHHcccCCcEEEEEccCCC-ccc
Q 024295          117 KNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVD-AMV  195 (269)
Q Consensus       117 ~~~~~~~~~~~~g~~~v~~~~~~~~~~~~~~i~~~~~~~~~d~v~d~~g~~~~~~~~~~~l~~~~G~~v~~g~~~~-~~~  195 (269)
                      +++++++.++++|+++++++.+ .+.++.+.+++.+++ ++|++||++|.+..++.+++++++++|+++.+|.... ...
T Consensus       226 ~~~~~~~~a~~lGa~~vi~~~~-~~~~~~~~i~~~~~g-g~D~vid~~g~~~~~~~~~~~l~~g~G~iv~~G~~~~~~~~  303 (378)
T 3uko_A          226 IDSKKYETAKKFGVNEFVNPKD-HDKPIQEVIVDLTDG-GVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEI  303 (378)
T ss_dssp             SCTTHHHHHHTTTCCEEECGGG-CSSCHHHHHHHHTTS-CBSEEEECSCCHHHHHHHHHTBCTTTCEEEECSCCCTTCCE
T ss_pred             CCHHHHHHHHHcCCcEEEcccc-CchhHHHHHHHhcCC-CCCEEEECCCCHHHHHHHHHHhhccCCEEEEEcccCCCCcc
Confidence            9999999999999999999872 127899999999988 9999999999987899999999992299999997653 455


Q ss_pred             cchhHhhhhCCceEEeeeccCCCCCCcHHHHHHHHHCCCCCCCcceeEEeehhhHHHHHHHhcCCCeeeEEeeC
Q 024295          196 PLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNKEFKLHQLLTHHVKLEEIDKAIQLLKQPDCVKVLITI  269 (269)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~k~vl~~  269 (269)
                      +++...++ +++++.|+.++.+..++++.++++++.+|+++++++++++||++++++||+.+.+++..|+||++
T Consensus       304 ~~~~~~~~-~~~~i~g~~~~~~~~~~~~~~~~~l~~~g~l~~~~~i~~~~~l~~~~~A~~~~~~g~~~Kvvi~~  376 (378)
T 3uko_A          304 STRPFQLV-TGRVWKGTAFGGFKSRTQVPWLVEKYMNKEIKVDEYITHNLTLGEINKAFDLLHEGTCLRCVLDT  376 (378)
T ss_dssp             EECTHHHH-TTCEEEECSGGGCCHHHHHHHHHHHHHTTSSCCGGGEEEEEEGGGHHHHHHHTTCTTCSEEEEET
T ss_pred             ccCHHHHh-cCcEEEEEEecCCCchHHHHHHHHHHHcCCCChhHheeeEeeHHHHHHHHHHHHCCCceEEEEec
Confidence            66666666 58999998876655557899999999999999999999999999999999999988878999975



>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1d1ta2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 3e-34
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 3e-34
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 3e-31
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 3e-30
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 3e-29
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 2e-26
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 3e-24
d1jqba2174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 9e-21
d1kola2195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 5e-18
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 9e-16
d1h2ba2172 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeo 8e-15
d1uufa2168 c.2.1.1 (A:145-312) Hypothetical protein YahK {Esc 2e-13
d1pl8a2171 c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh 2e-13
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 3e-13
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 9e-11
d1llua2166 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom 1e-10
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 3e-10
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 4e-10
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 8e-10
d1rjwa2168 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu 1e-08
d1pqwa_183 c.2.1.1 (A:) Putative enoyl reductase domain of po 9e-08
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 9e-08
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 2e-07
d1jvba2170 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo 3e-07
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 8e-07
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 4e-05
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 3e-04
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 6e-04
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 0.002
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Alcohol dehydrogenase
species: Human (Homo sapiens), different isozymes [TaxId: 9606]
 Score =  119 bits (300), Expect = 3e-34
 Identities = 68/178 (38%), Positives = 92/178 (51%), Gaps = 2/178 (1%)

Query: 56  SIDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGI 115
           +  P     + CGF+TGYGAA K  KV+ GS+  V GLG VGL  + G +  GA++IIGI
Sbjct: 1   AAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGI 60

Query: 116 DKNPWKKEKGKAFGMTDFINPDDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALE 175
           D N  K EK  A G T+ I+P D         V     G  V Y FE  G    + +AL 
Sbjct: 61  DLNKDKFEKAMAVGATECISPKDSTK--PISEVLSEMTGNNVGYTFEVIGHLETMIDALA 118

Query: 176 TTKVGKGKVIVIGVGVDAMVPLNVIALACGGRTLKGTTFGGIKTKSDLPTLLDKCKNK 233
           +  +  G  +V+GV   A +      L   GRT KG  FGG+K++ D+P L+ +   K
Sbjct: 119 SCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK 176


>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 172 Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 168 Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 100.0
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.97
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.97
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.97
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.96
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.96
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.96
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.96
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.96
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.96
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.96
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.96
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.96
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.96
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.96
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.96
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.95
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.95
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.95
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.95
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.95
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.94
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.94
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.94
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.93
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.92
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.9
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.9
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.53
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.32
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.3
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.25
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.24
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.14
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.13
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.08
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 98.95
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.9
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 98.89
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 98.88
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 98.86
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.79
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 98.72
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.63
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 98.62
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 98.58
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.57
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.38
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.35
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.31
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 98.29
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 98.27
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 98.23
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.21
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 98.17
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 98.14
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.09
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.07
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.05
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.99
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.95
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.93
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.91
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.89
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.87
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.84
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.74
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 97.72
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.7
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.68
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.68
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.66
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.65
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.64
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.63
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 97.62
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.57
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.55
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.55
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.55
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.53
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.51
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.5
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.49
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.49
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.47
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.46
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 97.44
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.44
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.39
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.38
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.37
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.37
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.36
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.36
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.35
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.33
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.32
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.31
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.3
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.29
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.27
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.26
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.25
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.24
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.24
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 97.23
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.23
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 97.22
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.22
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.21
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.19
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.19
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.19
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 97.18
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.15
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.14
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.12
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.11
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.11
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 97.1
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.08
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.08
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 97.08
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.06
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 97.02
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.01
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 96.99
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.98
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.98
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.96
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.96
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.96
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.92
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.91
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 96.91
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.9
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.89
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.88
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.88
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.85
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.82
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.81
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 96.8
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 96.78
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.77
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.77
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.77
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 96.77
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.76
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.74
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.74
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.74
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.71
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 96.7
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 96.67
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.62
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.61
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.6
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 96.58
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.52
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 96.51
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 96.51
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 96.5
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.43
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.42
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 96.36
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 96.35
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.33
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 96.33
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 96.32
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 96.31
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.27
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.26
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.25
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.24
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.22
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.22
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 96.21
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.21
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.19
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.16
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 96.16
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 96.15
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.14
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.12
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.1
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.05
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.03
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 95.94
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.88
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.87
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.87
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.87
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 95.83
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.83
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.81
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.79
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.74
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.74
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 95.72
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 95.71
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.71
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.7
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 95.68
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 95.66
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.6
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.58
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.55
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.52
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 95.48
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.45
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 95.45
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 95.44
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.44
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 95.43
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.4
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 95.39
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.39
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.39
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.37
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.36
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 95.35
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.31
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.29
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 95.29
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 95.28
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 95.25
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 95.23
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.22
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.22
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.22
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 95.22
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.01
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.97
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 94.96
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.95
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 94.95
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.92
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 94.85
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.82
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 94.81
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 94.81
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.8
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 94.74
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.68
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 94.65
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.62
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.56
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 94.52
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.51
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 94.49
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.49
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.49
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 94.47
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 94.45
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 94.44
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 94.41
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.38
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.34
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 94.32
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.31
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 94.31
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 94.29
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 94.27
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 94.27
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.23
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.21
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.16
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.15
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 94.14
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.07
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 94.06
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.05
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 94.02
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 93.96
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 93.95
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.93
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.91
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 93.9
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 93.9
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 93.81
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.79
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.74
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.73
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.7
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 93.67
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.57
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 93.52
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 93.49
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 93.49
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 93.45
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.41
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 93.4
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 93.38
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 93.37
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.32
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 93.21
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 93.18
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.16
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 92.96
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.94
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 92.91
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 92.9
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 92.89
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.78
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.77
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.74
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 92.64
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 92.59
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.59
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.52
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.52
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 92.51
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 92.5
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.5
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 92.49
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 92.47
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 92.29
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 92.27
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 92.17
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.04
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.96
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 91.86
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.85
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.82
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 91.72
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.63
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 91.63
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.63
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 91.58
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 91.52
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 91.43
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 91.37
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 91.37
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.33
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 91.33
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 91.2
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 91.18
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.16
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 91.15
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 91.1
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.09
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 90.95
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.89
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 90.82
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 90.76
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.6
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.56
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 90.47
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 90.37
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.34
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 90.26
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 90.22
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 90.19
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.12
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 90.1
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 90.06
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 89.95
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 89.91
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.85
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 89.84
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 89.83
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 89.83
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 89.81
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 89.76
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.76
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 89.73
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 89.57
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.55
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 89.55
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 89.45
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 89.24
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 89.23
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 89.12
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 88.99
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 88.64
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 88.2
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 88.1
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 87.89
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 87.81
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 87.75
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 87.75
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 87.71
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 87.5
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 87.4
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 87.36
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 87.26
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 87.26
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 87.17
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 86.98
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 86.96
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 86.92
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 86.84
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 86.78
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 86.72
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 86.59
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 86.57
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 86.56
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 86.52
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 86.11
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 86.04
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 85.93
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.87
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 85.79
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 85.78
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 85.73
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 85.31
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 85.22
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 85.13
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 85.09
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.06
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 84.77
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 84.72
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 84.43
d1id1a_153 Rck domain from putative potassium channel Kch {Es 84.3
d2ax3a2211 Hypothetical protein TM0922, N-terminal domain {Th 84.3
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 83.99
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 83.89
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 83.63
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 83.34
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.22
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 83.2
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 82.76
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 82.2
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 82.0
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 81.97
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 81.25
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 80.76
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 80.69
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 80.63
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 80.51
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Benzyl alcohol dehydrogenase
species: Acinetobacter calcoaceticus [TaxId: 471]
Probab=100.00  E-value=4.4e-32  Score=206.63  Aligned_cols=173  Identities=31%  Similarity=0.469  Sum_probs=159.2

Q ss_pred             CCcccccccccchhhhHHHHHHhcCCCCCCeEEEEcCChhHHHHHHHHHHcCCCeEEEEcCCcchHHHHHhCCCceeeCC
Q 024295           57 IDPSDASFLSCGFTTGYGAAWKEAKVEKGSSVAVLGLGTVGLGAVDGARMHGAAKIIGIDKNPWKKEKGKAFGMTDFINP  136 (269)
Q Consensus        57 ~~~~~aa~~~~~~~~a~~~l~~~~~~~~~~~vlI~G~g~~G~~a~~la~~~g~~~v~~~~~~~~~~~~~~~~g~~~v~~~  136 (269)
                      ++++.+++++|.+.|||+++.+.++++++++|+|+|+|++|++++|+++..|+++|++++++++|++.++++|+++++|+
T Consensus         1 vP~e~aapl~ca~~Ta~~a~~~~~~~~~g~~VlI~G~G~iG~~~~~~ak~~g~~~v~~~~~~~~k~~~a~~~Ga~~~i~~   80 (174)
T d1f8fa2           1 VPIELLGPLGCGIQTGAGACINALKVTPASSFVTWGAGAVGLSALLAAKVCGASIIIAVDIVESRLELAKQLGATHVINS   80 (174)
T ss_dssp             SCGGGTGGGGTHHHHHHHHHHTTTCCCTTCEEEEESCSHHHHHHHHHHHHHTCSEEEEEESCHHHHHHHHHHTCSEEEET
T ss_pred             CCHHHHHHHhhHHHHHHHHHHHhhCCCCCCEEEEeCCCHHHhhhhhcccccccceeeeeccHHHHHHHHHHcCCeEEEeC
Confidence            35678999999999999999999999999999999999999999999999999888899999999999999999999999


Q ss_pred             CCCCCccHHHHHHhhhCCCCccEEEEccCChhHHHHHHHHcccCCcEEEEEccCCC-ccccchhHhhhhCCceEEeeecc
Q 024295          137 DDEPNKSISELVKGITHGMGVDYCFECTGVPSLLSEALETTKVGKGKVIVIGVGVD-AMVPLNVIALACGGRTLKGTTFG  215 (269)
Q Consensus       137 ~~~~~~~~~~~i~~~~~~~~~d~v~d~~g~~~~~~~~~~~l~~~~G~~v~~g~~~~-~~~~~~~~~~~~~~~~~~~~~~~  215 (269)
                      ++   +++.+++++.+++ ++|++|||+|++..++.++++++++ |+++.+|.+.. ...+++...++++++++.|++++
T Consensus        81 ~~---~~~~~~i~~~t~g-g~D~vid~~G~~~~~~~~~~~~~~~-G~i~~~G~~~~~~~~~~~~~~~~~k~~~i~Gs~~g  155 (174)
T d1f8fa2          81 KT---QDPVAAIKEITDG-GVNFALESTGSPEILKQGVDALGIL-GKIAVVGAPQLGTTAQFDVNDLLLGGKTILGVVEG  155 (174)
T ss_dssp             TT---SCHHHHHHHHTTS-CEEEEEECSCCHHHHHHHHHTEEEE-EEEEECCCCSTTCCCCCCHHHHHHTTCEEEECSGG
T ss_pred             CC---cCHHHHHHHHcCC-CCcEEEEcCCcHHHHHHHHhcccCc-eEEEEEeecCCCcccccCHHHHHHCCCEEEEEEec
Confidence            87   8899999999988 9999999999988899999999996 99999997654 56788888999999999999888


Q ss_pred             CCCCCCcHHHHHHHHHCCC
Q 024295          216 GIKTKSDLPTLLDKCKNKE  234 (269)
Q Consensus       216 ~~~~~~~~~~~~~l~~~g~  234 (269)
                      .+..+++++++++|+++||
T Consensus       156 ~~~~~~~~~~~~~l~~~Gk  174 (174)
T d1f8fa2         156 SGSPKKFIPELVRLYQQGK  174 (174)
T ss_dssp             GSCHHHHHHHHHHHHHTTS
T ss_pred             CCChHHHHHHHHHHHHcCC
Confidence            7766778999999999986



>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure