Citrus Sinensis ID: 024360

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27

MGYAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEELGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNKKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESSIRYVLSQIDNCIQWGEDADLKIKDFDPEDDDE

ccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEEcccHHHHHHHHHHHccccEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHccccccccccccccccccc

cccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccEcHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEccHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccc

mgyaqlvigpagsgkstycsslYRHCEtvrrtmhivnldpaaenfdypvaMDIRELISLEDVMeelglgpngglIYCMEHLEDNLDDWLAEELDnyldddylvfdcpgqielfthvpVLRNFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLElphvnilskmDLVTNKKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDeysmvsfmpldlrkeSSIRYVLSQIDNCiqwgedadlkikdfdpeddde

mgyaqlvigpagsgkstyCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEELGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNKKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESSIRYVLSQIDNciqwgedadlkikdfdpeddde

MGYAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEELGLGPNGGLIYCMEHLEDNLDDWlaeeldnyldddylVFDCPGQIELFTHVPVLRNFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNKKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESSIRYVLSQIDNCIQWGEDADLKIKDFDPEDDDE

*****LVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEELGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNKKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESSIRYVLSQIDNCIQWGEDADLKI**********

*GYAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEELGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNKKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESSIRYVLSQIDNCIQWGED***************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		268	2.2.26 [Sep-21-2011]
Q6ZM63		285	GPN-loop GTPase 3 OS=Dani	yes	no	0.970	0.912	0.527	2e-78
Q6CQA6		271	GPN-loop GTPase 3 homolog	yes	no	0.970	0.959	0.526	5e-78
Q54NK8		285	GPN-loop GTPase 3 homolog	yes	no	0.944	0.887	0.519	1e-77
Q9D3W4		284	GPN-loop GTPase 3 OS=Mus	yes	no	0.944	0.890	0.542	1e-76
Q4V7Z0		285	GPN-loop GTPase 3 OS=Xeno	N/A	no	0.985	0.926	0.523	2e-76
Q6R518		284	GPN-loop GTPase 3 OS=Ratt	yes	no	0.944	0.890	0.542	2e-76
Q6FSS0		271	GPN-loop GTPase 3 homolog	yes	no	0.932	0.922	0.523	4e-76
Q4PF70		281	GPN-loop GTPase 3 homolog	N/A	no	0.970	0.925	0.514	7e-76
Q6BI59		274	GPN-loop GTPase 3 homolog	yes	no	0.914	0.894	0.547	2e-75
Q9UHW5		284	GPN-loop GTPase 3 OS=Homo	yes	no	0.944	0.890	0.526	2e-75

>sp\|Q6ZM63\|GPN3_DANRE GPN-loop GTPase 3 OS=Danio rerio GN=gpn3 PE=2 SV=2	Back alignment and function desciption

 Score =  291 bits (746), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 143/271 (52%), Positives = 202/271 (74%), Gaps = 11/271 (4%)

Query: 3   YAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDV 62
           YAQLV+GPAGSGKSTYC+++  HC+ + R++ +VNLDPAAE+F+YPV  DIRELI ++DV
Sbjct: 4   YAQLVMGPAGSGKSTYCATMLEHCQALNRSVQVVNLDPAAEHFEYPVIADIRELIQVDDV 63

Query: 63  MEE--LGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLR 120
           ME+  L  GPNGGLI+CME+  +N D WL E L  +++DDY++FDCPGQIEL+TH+PV++
Sbjct: 64  MEDDSLRFGPNGGLIFCMEYFSNNFD-WLEESL-GHVEDDYILFDCPGQIELYTHLPVMK 121

Query: 121 NFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVT- 179
             V+ L+   F VC V+L+DSQF+ +  KFISG MA+LSAMV LE+P VNI++KMDL++ 
Sbjct: 122 QLVEQLQQWEFRVCGVFLVDSQFMVETFKFISGVMAALSAMVMLEIPQVNIMTKMDLLSP 181

Query: 180 -NKKEIEDYLNPESQFLLSELNQHM-APQFAKLNKSLIELVDEYSMVSFMPLDLRKESSI 237
             KKEIE YL+P+   ++ + +  + + +F+KL K++  L+D+YSMV F+P D   E  I
Sbjct: 182 KAKKEIEKYLDPDMYSMMEDNSVALRSKKFSKLTKAICGLIDDYSMVRFLPFDRTDEEGI 241

Query: 238 RYVLSQIDNCIQWGEDADLKIKDFDPEDDDE 268
             VL  ID  IQ+GED ++K    +P++ DE
Sbjct: 242 NIVLQHIDFSIQYGEDLEVK----EPKEVDE 268

Danio rerio (taxid: 7955)

>sp\|Q6CQA6\|GPN3_KLULA GPN-loop GTPase 3 homolog KLLA0D18557g OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D18557g PE=3 SV=2	Back alignment and function description

>sp\|Q54NK8\|GPN3_DICDI GPN-loop GTPase 3 homolog OS=Dictyostelium discoideum GN=gpn3 PE=3 SV=1	Back alignment and function description

>sp\|Q9D3W4\|GPN3_MOUSE GPN-loop GTPase 3 OS=Mus musculus GN=Gpn3 PE=2 SV=1	Back alignment and function description

>sp\|Q4V7Z0\|GPN3_XENLA GPN-loop GTPase 3 OS=Xenopus laevis GN=gpn3 PE=2 SV=1	Back alignment and function description

>sp\|Q6R518\|GPN3_RAT GPN-loop GTPase 3 OS=Rattus norvegicus GN=Gpn3 PE=2 SV=1	Back alignment and function description

>sp\|Q6FSS0\|GPN3_CANGA GPN-loop GTPase 3 homolog CAGL0G08294g OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G08294g PE=3 SV=1	Back alignment and function description

>sp\|Q4PF70\|GPN3_USTMA GPN-loop GTPase 3 homolog UM01243 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UM01243 PE=3 SV=1	Back alignment and function description

>sp\|Q6BI59\|GPN3_DEBHA GPN-loop GTPase 3 homolog DEHA2G13222g OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G13222g PE=3 SV=2	Back alignment and function description

>sp\|Q9UHW5\|GPN3_HUMAN GPN-loop GTPase 3 OS=Homo sapiens GN=GPN3 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		268
255567152		267	XPA-binding protein, putative [Ricinus c	0.996	1.0	0.883	1e-138
225468099		268	PREDICTED: GPN-loop GTPase 3 homolog [Vi	0.966	0.966	0.891	1e-137
388500596		267	unknown [Lotus japonicus]	0.996	1.0	0.846	1e-135
356526825		267	PREDICTED: GPN-loop GTPase 3-like [Glyci	0.996	1.0	0.850	1e-135
388493224		267	unknown [Lotus japonicus]	0.996	1.0	0.842	1e-135
118489704		268	unknown [Populus trichocarpa x Populus d	1.0	1.0	0.858	1e-135
224131986		268	predicted protein [Populus trichocarpa]	1.0	1.0	0.858	1e-134
255638486		267	unknown [Glycine max]	0.996	1.0	0.846	1e-134
108710748		266	expressed protein [Oryza sativa Japonica	0.992	1.0	0.834	1e-133
357462187		267	GPN-loop GTPase-like protein [Medicago t	0.996	1.0	0.835	1e-132

>gi\|255567152\|ref\|XP_002524557.1\| XPA-binding protein, putative [Ricinus communis] gi\|223536110\|gb\|EEF37765.1\| XPA-binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 259/267 (97%)

Query: 1   MGYAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLE 60
           MGYAQLVIGPAGSGKSTYCSSLY+HCETV R++HIVNLDPAAENFDYPV+MDIRELISL+
Sbjct: 1   MGYAQLVIGPAGSGKSTYCSSLYQHCETVGRSIHIVNLDPAAENFDYPVSMDIRELISLD 60

Query: 61  DVMEELGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLR 120
           DVMEELGLGPNG L+YCM+ LEDNLDDWL+EELDNY+DDDYLVFDCPGQIELF+HV VLR
Sbjct: 61  DVMEELGLGPNGALMYCMDELEDNLDDWLSEELDNYMDDDYLVFDCPGQIELFSHVSVLR 120

Query: 121 NFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTN 180
           NFV+HLK +NFNVCAVYLLDSQFITDVTKFISGCMASLSAM+QLELPHVNILSKMDLVTN
Sbjct: 121 NFVEHLKRKNFNVCAVYLLDSQFITDVTKFISGCMASLSAMIQLELPHVNILSKMDLVTN 180

Query: 181 KKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESSIRYV 240
           KK+IEDYLNPES+ LLSELN+ MAPQF KLNK+LIELVDEYSMVSF+PLDLRKESSI+YV
Sbjct: 181 KKDIEDYLNPESRVLLSELNKRMAPQFVKLNKALIELVDEYSMVSFVPLDLRKESSIQYV 240

Query: 241 LSQIDNCIQWGEDADLKIKDFDPEDDD 267
           L+QIDNCIQ+GEDAD+KIKDFDPEDD+
Sbjct: 241 LAQIDNCIQFGEDADVKIKDFDPEDDE 267

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225468099\|ref\|XP_002266090.1\| PREDICTED: GPN-loop GTPase 3 homolog [Vitis vinifera] gi\|296088830\|emb\|CBI38288.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|388500596\|gb\|AFK38364.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|356526825\|ref\|XP_003532017.1\| PREDICTED: GPN-loop GTPase 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|388493224\|gb\|AFK34678.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|118489704\|gb\|ABK96653.1\| unknown [Populus trichocarpa x Populus deltoides]	Back alignment and taxonomy information

>gi\|224131986\|ref\|XP_002321227.1\| predicted protein [Populus trichocarpa] gi\|222862000\|gb\|EEE99542.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255638486\|gb\|ACU19552.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|108710748\|gb\|ABF98543.1\| expressed protein [Oryza sativa Japonica Group] gi\|215769078\|dbj\|BAH01307.1\| unnamed protein product [Oryza sativa Japonica Group] gi\|218193640\|gb\|EEC76067.1\| hypothetical protein OsI_13279 [Oryza sativa Indica Group] gi\|222625678\|gb\|EEE59810.1\| hypothetical protein OsJ_12343 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|357462187\|ref\|XP_003601375.1\| GPN-loop GTPase-like protein [Medicago truncatula] gi\|355490423\|gb\|AES71626.1\| GPN-loop GTPase-like protein [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		268
TAIR\|locus:2135793		271	AT4G12790 [Arabidopsis thalian	0.996	0.985	0.745	2.1e-107
DICTYBASE\|DDB_G0285197		285	gpn3 "GPN-loop GTPase 3" [Dict	0.992	0.933	0.483	5.5e-70
ZFIN\|ZDB-GENE-040724-141		285	gpn3 "GPN-loop GTPase 3" [Dani	0.970	0.912	0.505	4.9e-69
MGI\|MGI:1289326		284	Gpn3 "GPN-loop GTPase 3" [Mus	0.970	0.915	0.509	2.7e-68
RGD\|1303034		284	Gpn3 "GPN-loop GTPase 3" [Ratt	0.970	0.915	0.509	2.7e-68
UNIPROTKB\|E1C8Z1		284	GPN3 "Uncharacterized protein"	0.970	0.915	0.505	1.2e-67
UNIPROTKB\|Q9UHW5		284	GPN3 "GPN-loop GTPase 3" [Homo	0.973	0.919	0.498	4e-67
UNIPROTKB\|F1P8E5		284	GPN3 "Uncharacterized protein"	0.970	0.915	0.5	5.1e-67
UNIPROTKB\|F1RNN2		284	GPN3 "Uncharacterized protein"	0.970	0.915	0.496	1.1e-66
UNIPROTKB\|Q0P5E2		284	GPN3 "GPN-loop GTPase 3" [Bos	0.970	0.915	0.492	1.3e-66

TAIR\|locus:2135793 AT4G12790 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1062 (378.9 bits), Expect = 2.1e-107, P = 2.1e-107
 Identities = 199/267 (74%), Positives = 229/267 (85%)

Query:     1 MGYAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLE 60
             MGYAQLVIGPAGSGKSTYCSSLY HCET+ RTMH+VNLDPAAE F+YPVAMDIRELISLE
Sbjct:     1 MGYAQLVIGPAGSGKSTYCSSLYEHCETIGRTMHVVNLDPAAEIFNYPVAMDIRELISLE 60

Query:    61 DVMEELGLGPNGGLIYCMEHLEDNLDDWXXXXXXXXXXXXXXVFDCPGQIELFTHVPVLR 120
             DVME+L LGPNG L+YCME+LED+L DW              +FDCPGQIELFTHVPVL+
Sbjct:    61 DVMEDLKLGPNGALMYCMEYLEDSLHDWVDEELENYRDDDYLIFDCPGQIELFTHVPVLK 120

Query:   121 NFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTN 180
             NFV+HLK +NFNVC VYLLDSQFITDVTKFISGCM+SL+AM+QLELPHVNILSKMDL+ +
Sbjct:   121 NFVEHLKQKNFNVCVVYLLDSQFITDVTKFISGCMSSLAAMIQLELPHVNILSKMDLLQD 180

Query:   181 KKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESSIRYV 240
             K  I+DYLNPE + LL+ELN+ M PQ+AKLNK+LIE+V EY MV+F+P++LRKE SI+YV
Sbjct:   181 KSNIDDYLNPEPRTLLAELNKRMGPQYAKLNKALIEMVGEYGMVNFIPINLRKEKSIQYV 240

Query:   241 LSQIDNCIQWGEDADLKIKDFDPEDDD 267
             LSQID CIQ+GEDAD+ IKD D   DD
Sbjct:   241 LSQIDVCIQFGEDADVNIKDDDDFSDD 267

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005524 "ATP binding" evidence=ISS

GO:0008150 "biological_process" evidence=ND

DICTYBASE\|DDB_G0285197 gpn3 "GPN-loop GTPase 3" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040724-141 gpn3 "GPN-loop GTPase 3" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1289326 Gpn3 "GPN-loop GTPase 3" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1303034 Gpn3 "GPN-loop GTPase 3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C8Z1 GPN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UHW5 GPN3 "GPN-loop GTPase 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P8E5 GPN3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RNN2 GPN3 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0P5E2 GPN3 "GPN-loop GTPase 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q54NK8	GPN3_DICDI	No assigned EC number	0.5193	0.9440	0.8877	yes	no
Q0P5E2	GPN3_BOVIN	No assigned EC number	0.5192	0.9440	0.8908	yes	no
Q5A0W6	GPN3_CANAL	No assigned EC number	0.5223	0.9552	0.9377	N/A	no
Q6FSS0	GPN3_CANGA	No assigned EC number	0.5234	0.9328	0.9225	yes	no
Q28I42	GPN3_XENTR	No assigned EC number	0.5166	0.9850	0.9263	yes	no
Q6CQA6	GPN3_KLULA	No assigned EC number	0.5263	0.9701	0.9594	yes	no
O14443	GPN3_SCHPO	No assigned EC number	0.5109	0.9813	0.9528	yes	no
Q4IQT8	GPN3_GIBZE	No assigned EC number	0.4242	0.9738	0.8671	yes	no
Q06543	GPN3_YEAST	No assigned EC number	0.5232	0.9328	0.9191	yes	no
Q9UHW5	GPN3_HUMAN	No assigned EC number	0.5269	0.9440	0.8908	yes	no
Q750Q9	GPN3_ASHGO	No assigned EC number	0.5156	0.9328	0.9225	yes	no
Q6BI59	GPN3_DEBHA	No assigned EC number	0.5476	0.9141	0.8941	yes	no
Q9D3W4	GPN3_MOUSE	No assigned EC number	0.5423	0.9440	0.8908	yes	no
Q6ZM63	GPN3_DANRE	No assigned EC number	0.5276	0.9701	0.9122	yes	no
Q4V7Z0	GPN3_XENLA	No assigned EC number	0.5239	0.9850	0.9263	N/A	no
Q6CBB5	GPN3_YARLI	No assigned EC number	0.4880	0.9179	0.9077	yes	no
Q4WT40	GPN3_ASPFU	No assigned EC number	0.4760	0.9291	0.8498	yes	no
Q4PF70	GPN3_USTMA	No assigned EC number	0.5143	0.9701	0.9252	N/A	no
P0CN94	GPN3_CRYNJ	No assigned EC number	0.5204	0.9701	0.9059	yes	no
P0CN95	GPN3_CRYNB	No assigned EC number	0.5204	0.9701	0.9059	N/A	no
Q6R518	GPN3_RAT	No assigned EC number	0.5423	0.9440	0.8908	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		268
pfam03029		235	pfam03029, ATP_bind_1, Conserved hypothetical ATP	6e-95
PRK13768		253	PRK13768, PRK13768, GTPase; Provisional	9e-48
COG1100		219	COG1100, COG1100, GTPase SAR1 and related small G	6e-24

>gnl\|CDD\|217326 pfam03029, ATP_bind_1, Conserved hypothetical ATP binding protein	Back alignment and domain information

 Score =  278 bits (714), Expect = 6e-95
 Identities = 103/245 (42%), Positives = 156/245 (63%), Gaps = 11/245 (4%)

Query: 7   VIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEEL 66
           V+GPAGSGK+T+  +L      + R++++VNLDPAAEN  Y   +DIRELI++ DVME+ 
Sbjct: 1   VVGPAGSGKTTFVGALSEILPLLGRSVYVVNLDPAAENLPYEADIDIRELITVADVMEDD 60

Query: 67  GLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNFVDHL 126
           GLGPNG L   M+ L   L DWL EEL+   +DDY +FD PGQIELFTH   L   V+ L
Sbjct: 61  GLGPNGALTVAMDFLRITL-DWLLEELEY--EDDYYLFDTPGQIELFTHWESLARGVEAL 117

Query: 127 KSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNKKEIED 186
           ++ +  + AVYL+D++ +TD + F SG + +LS M++L LP V  L+K DL++ +  ++ 
Sbjct: 118 EA-SLRLGAVYLVDTRRLTDPSDFFSGLLYALSIMLRLGLPFVVALNKFDLLSLEFALKW 176

Query: 187 YLNPESQFLLSELNQHMAPQFAKLNKSLIELVDEYSMV-SFMPLDLRKESSIRYVLSQID 245
           + +P+   LL EL        +KLN+++ E +D + +V  F+P       S+  +L+ ID
Sbjct: 177 FTDPDDLQLLLEL------DPSKLNEAIREALDLFYLVPRFLPDARETGESMEDLLTLID 230

Query: 246 NCIQW 250
             +Q+
Sbjct: 231 EALQY 235

Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity. Length = 235

>gnl\|CDD\|237498 PRK13768, PRK13768, GTPase; Provisional	Back alignment and domain information

>gnl\|CDD\|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		268
KOG1534		273	consensus Putative transcription factor FET5 [Tran	100.0
KOG1533		290	consensus Predicted GTPase [General function predi	100.0
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	100.0
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	100.0
PRK13768		253	GTPase; Provisional	99.97
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	99.95
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	99.95
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	99.94
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	99.94
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	99.93
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	99.93
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	99.93
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	99.92
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	99.92
PRK13537		306	nodulation ABC transporter NodI; Provisional	99.92
COG1127		263	Ttg2A ABC-type transport system involved in resist	99.91
PRK13536		340	nodulation factor exporter subunit NodI; Provision	99.91
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	99.91
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	99.91
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	99.91
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	99.9
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	99.9
COG2884		223	FtsE Predicted ATPase involved in cell division [C	99.9
COG4152		300	ABC-type uncharacterized transport system, ATPase	99.9
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	99.9
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	99.9
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	99.9
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	99.9
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	99.9
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	99.9
cd03269		210	ABC_putative_ATPase This subfamily is involved in	99.9
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	99.9
COG3638		258	ABC-type phosphate/phosphonate transport system, A	99.9
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	99.9
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	99.89
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	99.89
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	99.89
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	99.89
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	99.89
COG0411		250	LivG ABC-type branched-chain amino acid transport	99.89
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	99.89
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	99.89
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	99.89
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	99.89
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	99.89
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	99.89
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	99.89
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	99.89
COG4604		252	CeuD ABC-type enterochelin transport system, ATPas	99.89
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	99.89
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	99.89
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	99.89
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	99.89
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	99.89
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	99.89
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	99.89
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	99.89
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	99.89
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	99.89
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	99.89
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	99.89
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	99.89
COG1137		243	YhbG ABC-type (unclassified) transport system, ATP	99.88
PRK10908		222	cell division protein FtsE; Provisional	99.88
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	99.88
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	99.88
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	99.88
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	99.88
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	99.88
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	99.88
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	99.88
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	99.88
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	99.88
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	99.88
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	99.88
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	99.88
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	99.88
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	99.88
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	99.88
COG4559		259	ABC-type hemin transport system, ATPase component	99.88
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	99.88
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.88
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	99.88
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	99.88
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	99.88
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	99.88
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	99.88
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	99.88
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	99.88
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	99.88
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	99.88
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	99.88
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.88
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	99.88
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	99.88
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	99.87
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	99.87
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	99.87
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	99.87
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	99.87
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	99.87
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	99.87
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	99.87
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	99.87
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	99.87
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	99.87
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	99.87
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	99.87
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	99.87
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	99.87
COG0410		237	LivF ABC-type branched-chain amino acid transport	99.87
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
COG4586		325	ABC-type uncharacterized transport system, ATPase	99.87
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	99.87
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	99.87
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	99.87
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	99.87
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	99.87
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.87
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	99.87
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	99.87
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	99.86
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	99.86
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.86
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	99.86
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	99.86
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	99.86
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	99.86
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.86
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	99.86
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	99.86
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	99.86
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	99.86
TIGR01187		325	potA spermidine/putrescine ABC transporter ATP-bin	99.86
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	99.86
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.86
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.86
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	99.86
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	99.86
PRK13546		264	teichoic acids export protein ATP-binding subunit;	99.86
COG3845		501	ABC-type uncharacterized transport systems, ATPase	99.86
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	99.86
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	99.86
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	99.86
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	99.86
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.86
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	99.86
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.86
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	99.86
cd03299		235	ABC_ModC_like Archeal protein closely related to M	99.86
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.85
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	99.85
COG4598		256	HisP ABC-type histidine transport system, ATPase c	99.85
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	99.85
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	99.85
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	99.85
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.85
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	99.85
PRK10938		490	putative molybdenum transport ATP-binding protein	99.85
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	99.85
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	99.85
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.85
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	99.85
cd03215		182	ABC_Carb_Monos_II This family represents domain II	99.85
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	99.85
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	99.85
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.85
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	99.85
cd03234		226	ABCG_White The White subfamily represents ABC tran	99.85
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.85
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	99.84
COG4181		228	Predicted ABC-type transport system involved in ly	99.84
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	99.84
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	99.84
PRK09984		262	phosphonate/organophosphate ester transporter subu	99.84
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.84
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	99.84
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	99.84
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.84
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	99.84
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.84
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	99.84
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.84
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.84
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.84
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	99.84
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	99.84
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	99.84
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	99.84
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	99.83
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	99.83
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	99.83
COG1123		539	ATPase components of various ABC-type transport sy	99.83
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.83
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	99.83
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	99.83
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	99.83
cd03246		173	ABCC_Protease_Secretion This family represents the	99.83
PRK03695		248	vitamin B12-transporter ATPase; Provisional	99.83
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	99.83
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	99.83
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	99.83
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	99.83
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.83
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	99.83
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	99.83
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	99.83
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.83
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	99.83
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	99.82
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	99.82
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	99.82
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	99.82
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	99.82
cd03216		163	ABC_Carb_Monos_I This family represents the domain	99.82
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.82
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.82
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	99.82
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	99.82
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	99.82
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.82
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	99.82
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	99.82
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	99.82
PRK13409		590	putative ATPase RIL; Provisional	99.82
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	99.82
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	99.82
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.82
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	99.82
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.82
PRK13409		590	putative ATPase RIL; Provisional	99.82
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.82
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	99.82
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	99.82
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.82
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	99.82
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	99.82
COG4525		259	TauB ABC-type taurine transport system, ATPase com	99.81
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	99.81
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	99.81
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	99.81
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	99.81
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	99.81
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	99.81
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	99.81
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	99.81
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	99.81
COG4133		209	CcmA ABC-type transport system involved in cytochr	99.81
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	99.81
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	99.81
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	99.81
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	99.81
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	99.81
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	99.81
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.81
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	99.81
PLN03211		659	ABC transporter G-25; Provisional	99.8
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	99.8
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	99.8
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	99.8
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	99.8
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	99.8
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	99.8
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	99.8
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	99.8
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	99.8
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	99.79
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.79
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	99.79
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	99.79
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	99.79
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	99.79
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	99.79
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	99.79
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	99.79
PRK10938		490	putative molybdenum transport ATP-binding protein	99.79
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	99.79
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	99.78
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	99.78
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	99.78
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	99.78
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	99.78
COG4988		559	CydD ABC-type transport system involved in cytochr	99.78
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.78
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	99.78
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	99.78
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	99.78
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	99.78
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	99.78
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	99.77
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	99.77
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	99.77
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	99.77
COG4161		242	ArtP ABC-type arginine transport system, ATPase co	99.77
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	99.77
PRK10535		648	macrolide transporter ATP-binding /permease protei	99.77
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.77
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.77
PRK11147		635	ABC transporter ATPase component; Reviewed	99.77
COG4619		223	ABC-type uncharacterized transport system, ATPase	99.77
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.76
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.76
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	99.76
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.76
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	99.76
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	99.76
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	99.76
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	99.76
TIGR00955		617	3a01204 The Eye Pigment Precursor Transporter (EPP	99.76
COG4674		249	Uncharacterized ABC-type transport system, ATPase	99.76
COG0488		530	Uup ATPase components of ABC transporters with dup	99.76
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	99.76
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	99.76
KOG0059		885	consensus Lipid exporter ABCA1 and related protein	99.76
COG4172		534	ABC-type uncharacterized transport system, duplica	99.76
COG1123		539	ATPase components of various ABC-type transport sy	99.75
TIGR01194		555	cyc_pep_trnsptr cyclic peptide transporter. This m	99.75
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	99.75
KOG0061		613	consensus Transporter, ABC superfamily (Breast can	99.75
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	99.75
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	99.75
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	99.75
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.75
PRK10522		547	multidrug transporter membrane component/ATP-bindi	99.74
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	99.74
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	99.74
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	99.73
PF00005		137	ABC_tran: ABC transporter This structure is on hol	99.73
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.73
KOG0057		591	consensus Mitochondrial Fe/S cluster exporter, ABC	99.73
PRK11147		635	ABC transporter ATPase component; Reviewed	99.73
KOG0055		1228	consensus Multidrug/pheromone exporter, ABC superf	99.73
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	99.72
COG4167		267	SapF ABC-type antimicrobial peptide transport syst	99.72
PLN03140		1470	ABC transporter G family member; Provisional	99.72
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	99.71
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	99.71
COG4987		573	CydC ABC-type transport system involved in cytochr	99.71
PLN03073		718	ABC transporter F family; Provisional	99.7
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.7
TIGR00954		659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	99.7
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	99.7
PLN03232		1495	ABC transporter C family member; Provisional	99.69
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.69
COG0488		530	Uup ATPase components of ABC transporters with dup	99.68
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.68
PLN03140		1470	ABC transporter G family member; Provisional	99.67
PLN03130		1622	ABC transporter C family member; Provisional	99.67
COG4136		213	ABC-type uncharacterized transport system, ATPase	99.66
COG4778		235	PhnL ABC-type phosphonate transport system, ATPase	99.65
PTZ00243		1560	ABC transporter; Provisional	99.65
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.65
PLN03073		718	ABC transporter F family; Provisional	99.63
cd03272		243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	99.63
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	99.62
cd03270		226	ABC_UvrA_I The excision repair protein UvrA domain	99.62
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.61
COG4615		546	PvdE ABC-type siderophore export system, fused ATP	99.61
cd03273		251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	99.6
PLN03130		1622	ABC transporter C family member; Provisional	99.6
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	99.6
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.6
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	99.6
cd03240		204	ABC_Rad50 The catalytic domains of Rad50 are simil	99.59
KOG0055		1228	consensus Multidrug/pheromone exporter, ABC superf	99.59
PTZ00243		1560	ABC transporter; Provisional	99.58
cd03279		213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	99.57
PLN03232		1495	ABC transporter C family member; Provisional	99.57
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.56
KOG0062		582	consensus ATPase component of ABC transporters wit	99.55
cd03274		212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	99.54
KOG0065		1391	consensus Pleiotropic drug resistance proteins (PD	99.54
COG4172		534	ABC-type uncharacterized transport system, duplica	99.53
cd03275		247	ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein	99.52
COG4138		248	BtuD ABC-type cobalamin transport system, ATPase c	99.51
KOG0056		790	consensus Heavy metal exporter HMT1, ABC superfami	99.51
KOG0927		614	consensus Predicted transporter (ABC superfamily)	99.5
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	99.49
cd03271		261	ABC_UvrA_II The excision repair protein UvrA domai	99.48
COG5265		497	ATM1 ABC-type transport system involved in Fe-S cl	99.44
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	99.43
cd03276		198	ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein	99.42
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	99.42
COG4178		604	ABC-type uncharacterized transport system, permeas	99.39
KOG0054		1381	consensus Multidrug resistance-associated protein/	99.37
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.37
KOG0054		1381	consensus Multidrug resistance-associated protein/	99.36
KOG0066		807	consensus eIF2-interacting protein ABC50 (ABC supe	99.31
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	99.31
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	99.31
KOG0927		614	consensus Predicted transporter (ABC superfamily)	99.28
KOG2355		291	consensus Predicted ABC-type transport, ATPase com	99.24
COG4170		330	SapD ABC-type antimicrobial peptide transport syst	99.23
cd03227		162	ABC_Class2 ABC-type Class 2 contains systems invol	99.22
cd03239		178	ABC_SMC_head The structural maintenance of chromos	99.21
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	99.21
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	99.19
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	99.18
PRK00635		1809	excinuclease ABC subunit A; Provisional	99.16
cd03277		213	ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein	99.13
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	99.12
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.12
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	99.12
KOG0062		582	consensus ATPase component of ABC transporters wit	99.1
cd03284		216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	99.08
cd03285		222	ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS	99.06
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	99.04
COG2401		593	ABC-type ATPase fused to a predicted acetyltransfe	99.03
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	99.03
KOG0063		592	consensus RNAse L inhibitor, ABC superfamily [RNA	98.99
KOG0060		659	consensus Long-chain acyl-CoA transporter, ABC sup	98.96
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	98.89
PF02463		220	SMC_N: RecF/RecN/SMC N terminal domain; InterPro:	98.87
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.87
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	98.87
PRK00089		292	era GTPase Era; Reviewed	98.86
KOG0066		807	consensus eIF2-interacting protein ABC50 (ABC supe	98.84
PRK08533		230	flagellar accessory protein FlaH; Reviewed	98.84
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	98.84
cd01881		176	Obg_like The Obg-like subfamily consists of five w	98.84
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	98.84
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	98.84
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	98.82
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	98.81
PRK10416		318	signal recognition particle-docking protein FtsY;	98.8
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	98.8
COG3910		233	Predicted ATPase [General function prediction only	98.79
KOG0064		728	consensus Peroxisomal long-chain acyl-CoA transpor	98.79
PRK09435		332	membrane ATPase/protein kinase; Provisional	98.79
COG3845		501	ABC-type uncharacterized transport systems, ATPase	98.74
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	98.73
COG1100		219	GTPase SAR1 and related small G proteins [General	98.72
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	98.72
cd03241		276	ABC_RecN RecN ATPase involved in DNA repair; ABC (	98.71
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	98.7
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	98.7
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	98.7
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	98.69
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	98.69
PRK00409		782	recombination and DNA strand exchange inhibitor pr	98.68
cd03286		218	ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS	98.68
PRK13695		174	putative NTPase; Provisional	98.68
COG0178		935	UvrA Excinuclease ATPase subunit [DNA replication,	98.67
PRK09866		741	hypothetical protein; Provisional	98.66
PRK00635		1809	excinuclease ABC subunit A; Provisional	98.65
KOG0065		1391	consensus Pleiotropic drug resistance proteins (PD	98.65
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	98.64
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	98.64
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	98.63
cd00881		189	GTP_translation_factor GTP translation factor fami	98.62
smart00382		148	AAA ATPases associated with a variety of cellular	98.62
COG1159		298	Era GTPase [General function prediction only]	98.61
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	98.6
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	98.6
PRK12298		390	obgE GTPase CgtA; Reviewed	98.6
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	98.59
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	98.59
PRK14974		336	cell division protein FtsY; Provisional	98.59
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	98.59
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	98.57
cd03115		173	SRP The signal recognition particle (SRP) mediates	98.54
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	98.54
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	98.53
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	98.53
PRK12299		335	obgE GTPase CgtA; Reviewed	98.51
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	98.49
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	98.48
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	98.48
cd03242		270	ABC_RecF RecF is a recombinational DNA repair ATPa	98.47
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	98.47
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	98.47
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	98.46
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	98.44
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	98.44
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	98.43
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	98.42
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	98.42
PRK06067		234	flagellar accessory protein FlaH; Validated	98.41
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	98.41
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	98.41
PRK07721		438	fliI flagellum-specific ATP synthase; Validated	98.4
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	98.4
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	98.39
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	98.39
TIGR00064		272	ftsY signal recognition particle-docking protein F	98.38
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	98.38
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	98.37
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	98.37
KOG0063		592	consensus RNAse L inhibitor, ABC superfamily [RNA	98.37
cd03112		158	CobW_like The function of this protein family is u	98.37
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	98.36
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	98.36
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	98.35
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	98.35

>KOG1534 consensus Putative transcription factor FET5 [Transcription]	Back alignment and domain information

Probab=100.00  E-value=1.4e-62  Score=413.58  Aligned_cols=264  Identities=64%  Similarity=1.142  Sum_probs=246.8

Q ss_pred             CCeEEEEEcCCCccHHHHHHHHHcCCCCCCceEEEeccCCcCCCCCCCcccChhhhhhHHHHHHHhCCCCCCChhhhHhh
Q 024360            1 MGYAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEELGLGPNGGLIYCMEH   80 (268)
Q Consensus         1 ~~~~~~liGpnGSGKSTLl~~l~g~l~~~~G~v~i~~~d~~~~~~~y~~~~~i~~~i~~~~~m~~~~L~~~g~~~~~~~~   80 (268)
                      |+|.+.++||+||||||+|+.|..+.+..++++.++|+|||++.+.|+..++||+.|+++++|+.+.+|||||++||+++
T Consensus         2 m~ya~lV~GpAgSGKSTyC~~~~~h~e~~gRs~~vVNLDPAae~f~y~~~iDiRdlIsvdDVmEdl~~GPNGgLv~cmEy   81 (273)
T KOG1534|consen    2 MRYAQLVMGPAGSGKSTYCSSMYEHCETVGRSVHVVNLDPAAEHFNYPVTIDIRDLISVDDVMEDLDLGPNGGLVYCMEY   81 (273)
T ss_pred             CceeEEEEccCCCCcchHHHHHHHHHHhhCceeEEeecCHHHHhhCCcccccHHHhccHHHHHHHhccCCCccchhHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhHHHHHHHHHhcCCCCCEEEEeCCCcCCHHhHHHHHHHHHHHHHhCCCeEEEEEecccccccCHHHHHHHHHHHHHH
Q 024360           81 LEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNFVDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSA  160 (268)
Q Consensus        81 ~~~~ls~~la~al~~~~~p~~lilDEP~~LD~~~~~~i~~~ll~~l~~~~~~ii~v~l~d~~~~~d~~~~~s~~l~~~~~  160 (268)
                      +.+++ .|+...+..+ +.+|+|||+|||+++++|..+++++++++++.+.++++||++|+.++.|..+|+|+++.++++
T Consensus        82 l~~Nl-dwL~~~~Gd~-eddylifDcPGQIELytH~pVm~~iv~hl~~~~F~~c~Vylldsqf~vD~~KfiSG~lsAlsA  159 (273)
T KOG1534|consen   82 LLENL-DWLEEEIGDV-EDDYLIFDCPGQIELYTHLPVMPQIVEHLKQWNFNVCVVYLLDSQFLVDSTKFISGCLSALSA  159 (273)
T ss_pred             HHHHH-HHHHhhccCc-cCCEEEEeCCCeeEEeecChhHHHHHHHHhcccCceeEEEEeccchhhhHHHHHHHHHHHHHH
Confidence            99999 9999988866 889999999999999999999999999998889999999999999999999999999999999


Q ss_pred             HHhhcCCeeEeeccccccCC--ccccccccCcCHHHHHH--HhhcccchhHHHHHHHHHHHhhhcCCeeeEEeeccChhh
Q 024360          161 MVQLELPHVNILSKMDLVTN--KKEIEDYLNPESQFLLS--ELNQHMAPQFAKLNKSLIELVDEYSMVSFMPLDLRKESS  236 (268)
Q Consensus       161 ~~~~~~p~i~vlsk~dll~~--~~~~~~~~~~~~~~l~~--~l~~~~~~~~~~l~~~~~~~i~~~~~~~~~~l~~~~~~~  236 (268)
                      |+++++|||||+||.||++.  +.++++|+++|...+.+  +.+. .++||.+|++.++++++||++|+|+|++..+++|
T Consensus       160 Mi~lE~P~INvlsKMDLlk~~~k~~l~~Fl~~d~~~l~~~~~~~~-~s~Kf~~L~~~i~~~v~d~~Mv~FlPl~~~~eeS  238 (273)
T KOG1534|consen  160 MISLEVPHINVLSKMDLLKDKNKKELERFLNPDEYLLLEDSEINL-RSPKFKKLTKCIAQLVDDYSMVNFLPLDSSDEES  238 (273)
T ss_pred             HHHhcCcchhhhhHHHHhhhhhHHHHHHhcCCchhhhhccccccc-ccHHHHHHHHHHHHHhccccceeeeecCCCCHHH
Confidence            99999999999999999985  23789999988666543  2332 3479999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhccccCCCCCCCCCCCCCC
Q 024360          237 IRYVLSQIDNCIQWGEDADLKIKDFDPEDDD  267 (268)
Q Consensus       237 ~~~l~~~id~~~~~~e~~~~~~~~~~~~~~~  267 (268)
                      +..+++.||.|.||+||.|+++|+.+|.+++
T Consensus       239 i~~iL~~ID~aiQy~Ed~E~k~~d~~e~d~~  269 (273)
T KOG1534|consen  239 INIILSYIDDAIQYGEDLEPKEPDEDEDDDS  269 (273)
T ss_pred             HHHHHHHHHHHHHhccccCccCCCccccccc
Confidence            9999999999999999999999987666554

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PLN03211 ABC transporter G-25; Provisional	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein	Back alignment and domain information

>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only]	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains	Back alignment and domain information

>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only]	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only]	Back alignment and domain information

>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription]	Back alignment and domain information

>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport	Back alignment and domain information

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes	Back alignment and domain information

>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only]	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism]	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>PRK07721 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification]	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		268
1yr6_A		262	Pab0955 Crystal Structure : A Gtpase In Apo Form Fr		6e-11

>pdb|1YR6|A Chain A, Pab0955 Crystal Structure : A Gtpase In Apo Form From Pyrococcus Abyssi Length = 262

Back alignment and structure

Iteration: 1

Score = 64.3 bits (155), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 2/108 (1%) Query: 6 LVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEE 65 + +G AGSGK+T R+ E + + VNLD + Y ++D+RE +++E++M E Sbjct: 18 VFVGTAGSGKTTLTGEFGRYLEDNYKVAY-VNLDTGVKELPYEPSIDVREFVTVEEIMRE 76 Query: 66 LGLGPNGGLIYCMEHLEDNLDDWXXXXXXXXXXXXXXVFDCPGQIELF 113 G GPNG ++ + L + +++ + D PGQ+E F Sbjct: 77 -GYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETF 123

PyMOL of 1yr6

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		268
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	7e-73
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	5e-04

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262	Back alignment and structure

 Score =  223 bits (568), Expect = 7e-73
 Identities = 52/255 (20%), Positives = 110/255 (43%), Gaps = 13/255 (5%)

Query: 3   YAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDV 62
              + +G AGSGK+T      R+ E   +    VNLD   +   Y  ++D+RE +++E++
Sbjct: 15  MIVVFVGTAGSGKTTLTGEFGRYLEDNYKV-AYVNLDTGVKELPYEPSIDVREFVTVEEI 73

Query: 63  MEELGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNF 122
           M E G GPNG ++   + L +  +++L + L    ++DY++ D PGQ+E F         
Sbjct: 74  MRE-GYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFHEFGVRL 132

Query: 123 VDHLKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTN-- 180
           +++L         VY+ D + +     +      +L   ++L    +  L+K+DL++   
Sbjct: 133 MENLPYP----LVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNKVDLLSEEE 188

Query: 181 -KKEIEDYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDE-YSMVSFMPLDLRKESSIR 238
            ++  + + + +      +L+  M      +   +  ++ E    V  + L  +      
Sbjct: 189 KERHRKYFEDIDYLTARLKLDPSM---QGLMAYKMCSMMTEVLPPVRVLYLSAKTREGFE 245

Query: 239 YVLSQIDNCIQWGED 253
            + +          D
Sbjct: 246 DLETLAYEHYCTCGD 260

PyMOL of 1yrb

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		268
3tui_C		366	Methionine import ATP-binding protein METN; ABC-tr	99.93
2pcj_A		224	ABC transporter, lipoprotein-releasing system ATP-	99.92
3tif_A		235	Uncharacterized ABC transporter ATP-binding prote;	99.92
2onk_A		240	Molybdate/tungstate ABC transporter, ATP-binding p	99.92
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	99.92
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	99.92
3fvq_A		359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	99.92
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	99.92
3rlf_A		381	Maltose/maltodextrin import ATP-binding protein M;	99.92
1b0u_A		262	Histidine permease; ABC transporter, transport pro	99.92
1ji0_A		240	ABC transporter; ATP binding protein, structural g	99.91
1g6h_A		257	High-affinity branched-chain amino acid transport	99.91
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	99.91
1z47_A		355	CYSA, putative ABC-transporter ATP-binding protein	99.91
3d31_A		348	Sulfate/molybdate ABC transporter, ATP-binding pro	99.91
2yyz_A		359	Sugar ABC transporter, ATP-binding protein; sugar	99.91
2it1_A		362	362AA long hypothetical maltose/maltodextrin trans	99.91
1oxx_K		353	GLCV, glucose, ABC transporter, ATP binding protei	99.91
1v43_A		372	Sugar-binding transport ATP-binding protein; ATPas	99.91
1g29_1		372	MALK, maltose transport protein MALK; ATPase, acti	99.91
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	99.91
1sgw_A		214	Putative ABC transporter; structural genomics, P p	99.91
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	99.9
2qi9_C		249	Vitamin B12 import ATP-binding protein BTUD; inner	99.9
2d2e_A		250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	99.9
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	99.89
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	99.89
2pjz_A		263	Hypothetical protein ST1066; ATP binding protein,	99.88
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	99.88
1mv5_A		243	LMRA, multidrug resistance ABC transporter ATP-bin	99.87
2zu0_C		267	Probable ATP-dependent transporter SUFC; iron-sulf	99.87
3nh6_A		306	ATP-binding cassette SUB-family B member 6, mitoc;	99.86
2ghi_A		260	Transport protein; multidrug resistance protein, M	99.86
2pze_A		229	Cystic fibrosis transmembrane conductance regulat;	99.85
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	99.84
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	99.84
3gd7_A		390	Fusion complex of cystic fibrosis transmembrane co	99.83
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	99.83
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	99.82
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	99.82
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	99.82
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	99.82
3b60_A		582	Lipid A export ATP-binding/permease protein MSBA;	99.82
3b5x_A		582	Lipid A export ATP-binding/permease protein MSBA;	99.81
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	99.81
2bbs_A		290	Cystic fibrosis transmembrane conductance regulato	99.81
2yl4_A		595	ATP-binding cassette SUB-family B member 10, mitoc	99.8
4a82_A		578	Cystic fibrosis transmembrane conductance regulat;	99.8
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	99.79
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	99.79
3qf4_B		598	Uncharacterized ABC transporter ATP-binding prote	99.78
3qf4_A		587	ABC transporter, ATP-binding protein; multidrug tr	99.78
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	99.72
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	99.69
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	99.69
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	99.68
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	99.68
3b85_A		208	Phosphate starvation-inducible protein; PHOH2, ATP	99.67
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	99.65
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	99.64
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	99.64
1tq4_A		413	IIGP1, interferon-inducible GTPase; interferon gam	99.63
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	99.63
2npi_A		460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	99.59
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	99.56
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	99.55
3szr_A		608	Interferon-induced GTP-binding protein MX1; interf	99.52
2pt7_A		330	CAG-ALFA; ATPase, protein-protein complex, type IV	99.51
2og2_A		359	Putative signal recognition particle receptor; nuc	99.5
2vf7_A		842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	99.5
2eyu_A		261	Twitching motility protein PILT; pilus retraction	99.49
3pih_A		916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	99.47
4aby_A		415	DNA repair protein RECN; hydrolase, double strand	99.45
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	99.45
2r6f_A		972	Excinuclease ABC subunit A; UVRA, nucleotide excis	99.45
3sop_A		270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	99.44
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	99.42
2ygr_A		993	Uvrabc system protein A; hydrolase, nucleotide exc	99.41
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	99.35
1e69_A		322	Chromosome segregation SMC protein; structural mai	99.35
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	99.34
4a74_A		231	DNA repair and recombination protein RADA; hydrola	99.34
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	99.33
3thx_A		934	DNA mismatch repair protein MSH2; ABC family ATPas	99.3
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	99.29
3qf7_A		365	RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.	99.29
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	99.27
3thx_B		918	DNA mismatch repair protein MSH3; ABC family ATPas	99.25
2o8b_B		1022	DNA mismatch repair protein MSH6; DNA damage respo	99.24
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	99.24
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	99.23
2ewv_A		372	Twitching motility protein PILT; pilus retraction	99.23
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	99.22
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	99.22
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	99.19
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	99.17
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	99.14
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	99.13
1ewq_A		765	DNA mismatch repair protein MUTS; multiple domains	99.13
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	99.12
3qkt_A		339	DNA double-strand break repair RAD50 ATPase; RECA-	99.12
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	99.08
1wb9_A		800	DNA mismatch repair protein MUTS; DNA-binding, ATP	99.08
2cvh_A		220	DNA repair and recombination protein RADB; filamen	99.06
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	99.05
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	99.05
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	99.05
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	99.02
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	99.02
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	99.01
2qnr_A		301	Septin-2, protein NEDD5; structural genomics conso	99.01
2www_A		349	Methylmalonic aciduria type A protein, mitochondri	98.99
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	98.96
1lw7_A		365	Transcriptional regulator NADR; NMN, NMN adenylyl	98.96
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	98.92
2dpy_A		438	FLII, flagellum-specific ATP synthase; beta barrel	98.92
2p67_A		341	LAO/AO transport system kinase; ARGK, structural G	98.91
2obl_A		347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	98.91
1htw_A		158	HI0065; nucleotide-binding fold, structural genomi	98.89
3pqc_A		195	Probable GTP-binding protein ENGB; rossmann fold,	98.89
2gza_A		361	Type IV secretion system protein VIRB11; ATPase, h	98.89
4dhe_A		223	Probable GTP-binding protein ENGB; melioidosis, RA	98.86
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	98.86
2qag_C		418	Septin-7; cell cycle, cell division, GTP-binding,	98.85
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	98.83
3lxx_A		239	GTPase IMAP family member 4; structural genomics c	98.81
1svi_A		195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	98.78
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	98.78
2qag_B		427	Septin-6, protein NEDD5; cell cycle, cell division	98.77
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	98.76
3iev_A		308	GTP-binding protein ERA; ERA, GTPase, KH domain, a	98.76
3k53_A		271	Ferrous iron transport protein B; GTPase fold, hel	98.76
1pui_A		210	ENGB, probable GTP-binding protein ENGB; structura	98.73
2dyk_A		161	GTP-binding protein; GTPase, ribosome-binding prot	98.68
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	98.68
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	98.68
3i8s_A		274	Ferrous iron transport protein B; GTPase, GPCR, ir	98.68
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	98.66
3euj_A		483	Chromosome partition protein MUKB, linker; MUKB, M	98.66
2wjg_A		188	FEOB, ferrous iron transport protein B homolog; me	98.65
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	98.65
1oix_A		191	RAS-related protein RAB-11A; small G protein, intr	98.62
1kao_A		167	RAP2A; GTP-binding protein, small G protein, GDP,	98.61
1c1y_A		167	RAS-related protein RAP-1A; GTP-binding proteins,	98.61
3b1v_A		272	Ferrous iron uptake transporter protein B; G prote	98.6
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	98.59
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	98.59
2wji_A		165	Ferrous iron transport protein B homolog; membrane	98.58
1ky3_A		182	GTP-binding protein YPT7P; vesicular traffic, GTP	98.58
1wms_A		177	RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p	98.58
2a9k_A		187	RAS-related protein RAL-A; bacterial ADP-ribosyltr	98.56
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	98.56
1ega_A		301	Protein (GTP-binding protein ERA); GTPase, RNA-bin	98.56
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	98.56
3iby_A		256	Ferrous iron transport protein B; G protein, G dom	98.54
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	98.53
1u8z_A		168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	98.53
2gj8_A		172	MNME, tRNA modification GTPase TRME; G-domain dime	98.53
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	98.53
2qtf_A		364	Protein HFLX, GTP-binding protein; beta-alpha-barr	98.52
3t34_A		360	Dynamin-related protein 1A, linker, dynamin-relat	98.51
1mky_A		439	Probable GTP-binding protein ENGA; GTPase, DER, KH	98.51
1qhl_A		227	Protein (cell division protein MUKB); SMC, chromos	98.51
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	98.51
3a1s_A		258	Iron(II) transport protein B; FEOB, iron transport	98.51
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	98.51
2fn4_A		181	P23, RAS-related protein R-RAS; GDP/GTP binding, G	98.51
2qu8_A		228	Putative nucleolar GTP-binding protein 1; GTPase,	98.51
2bov_A		206	RAla, RAS-related protein RAL-A; C3BOT, exoenzyme,	98.51
1z2a_A		168	RAS-related protein RAB-23; RAB GTPase, vesicular	98.49
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	98.48
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	98.48
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	98.48
2cxx_A		190	Probable GTP-binding protein ENGB; structural geno	98.48
1u0l_A		301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	98.47
3clv_A		208	RAB5 protein, putative; malaria, GTPase, structura	98.46
1p9r_A		418	General secretion pathway protein E; bacterial typ	98.46
1udx_A		416	The GTP-binding protein OBG; TGS domain, riken str	98.45
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	98.45
3t1o_A		198	Gliding protein MGLA; G domain containing protein,	98.44
3con_A		190	GTPase NRAS; structural genomics consortium, SGC,	98.44
2erx_A		172	GTP-binding protein DI-RAS2; GTP hydrolysis, trans	98.44
1ek0_A		170	Protein (GTP-binding protein YPT51); vesicular tra	98.44
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	98.41
1m2o_B		190	GTP-binding protein SAR1, GTP binding protein; zin	98.41
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	98.41
3pih_A		916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	98.4
3kkq_A		183	RAS-related protein M-RAS; GTP-binding, GTPase, si	98.39
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	98.39
1f2t_B		148	RAD50 ABC-ATPase; DNA double-strand break repair,	98.39
1lnz_A		342	SPO0B-associated GTP-binding protein; GTPase, OBG,	98.38
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	98.37
1zj6_A		187	ADP-ribosylation factor-like protein 5; ARL, GTP-b	98.36
3q85_A		169	GTP-binding protein REM 2; G-domain, CAV2 beta, si	98.35
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	98.35
3sjy_A		403	Translation initiation factor 2 subunit gamma; zin	98.35
1vg8_A		207	RAS-related protein RAB-7; GTP-binding protein, pr	98.35
4dsu_A		189	GTPase KRAS, isoform 2B; small G-protein, signalin	98.35
1wf3_A		301	GTP-binding protein; GTPase, riken structural geno	98.34
2yv5_A		302	YJEQ protein; hydrolase, GTPase, permutation, stru	98.34
2oap_1		511	GSPE-2, type II secretion system protein; hexameri	98.34
1mh1_A		186	RAC1; GTP-binding, GTPase, small G-protein, RHO fa	98.34
2gf0_A		199	GTP-binding protein DI-RAS1; GDP/GTP binding, GTP	98.34
3q72_A		166	GTP-binding protein RAD; G-domain, CAV2 beta, sign	98.33
2y8e_A		179	RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti	98.32
1z08_A		170	RAS-related protein RAB-21; RAB GTPase, vesicular	98.32
2ged_A		193	SR-beta, signal recognition particle receptor beta	98.31
2g6b_A		180	RAS-related protein RAB-26; G-protein, GTP analogu	98.31
2e87_A		357	Hypothetical protein PH1320; GTP-binding, GTPase,	98.31
1nij_A		318	Hypothetical protein YJIA; structural genomics, P-	98.31
3lxw_A		247	GTPase IMAP family member 1; immunity, structural	98.31
4gzl_A		204	RAS-related C3 botulinum toxin substrate 1; rossma	98.3
1upt_A		171	ARL1, ADP-ribosylation factor-like protein 1; hydr	98.3
3lnc_A		231	Guanylate kinase, GMP kinase; ALS collaborative cr	98.29
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	98.29
2rcn_A		358	Probable GTPase ENGC; YJEQ, circularly permuted, G	98.29
3ihw_A		184	Centg3; RAS, centaurin, GTPase, structural genomic	98.29
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	98.29
1z0f_A		179	RAB14, member RAS oncogene family; RAB GTPase, ves	98.28
3t5g_A		181	GTP-binding protein RHEB; immunoglobulin-like beta	98.28
3bwd_D		182	RAC-like GTP-binding protein ARAC6; G domain, cyto	98.28
3tkl_A		196	RAS-related protein RAB-1A; vesicle trafficking, p	98.28
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	98.28
1nrj_B		218	SR-beta, signal recognition particle receptor beta	98.27
1wb1_A		482	Translation elongation factor SELB; selenocysteine	98.27
1m7b_A		184	RND3/RHOE small GTP-binding protein; small GTPase,	98.27
2atx_A		194	Small GTP binding protein TC10; GTPase, P-loop, al	98.26
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	98.26
2j1l_A		214	RHO-related GTP-binding protein RHOD; GTPase, memb	98.25
2fv8_A		207	H6, RHO-related GTP-binding protein RHOB; GDP/GTP	98.25
1r8s_A		164	ADP-ribosylation factor 1; protein transport/excha	98.25
2fg5_A		192	RAB-22B, RAS-related protein RAB-31; G-protein, GT	98.24
1t9h_A		307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	98.24
1z0j_A		170	RAB-22, RAS-related protein RAB-22A; RAB GTPase, R	98.23
2lkc_A		178	Translation initiation factor IF-2; NMR {Geobacill	98.23
1fzq_A		181	ADP-ribosylation factor-like protein 3; protein-GD	98.23
2oil_A		193	CATX-8, RAS-related protein RAB-25; G-protein, GDP	98.23
4e22_A		252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	98.23
3t5d_A		274	Septin-7; GTP-binding protein, cytoskeleton, signa	98.23
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	98.23
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	98.22
2gco_A		201	H9, RHO-related GTP-binding protein RHOC; GTPase,s	98.22
2il1_A		192	RAB12; G-protein, GDP, GTPase, predicted, structur	98.21
2vp4_A		230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	98.21
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	98.21
1gwn_A		205	RHO-related GTP-binding protein RHOE; GTPase, inac	98.2
2r6a_A		454	DNAB helicase, replicative helicase; replication,	98.2
1r2q_A		170	RAS-related protein RAB-5A; GTPase, GNP, atomic re	98.2
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	98.2
3dz8_A		191	RAS-related protein RAB-3B; GDP, GTPase, structura	98.2
1zd9_A		188	ADP-ribosylation factor-like 10B; transport protei	98.2
3c5c_A		187	RAS-like protein 12; GDP, GTPase, structural genom	98.19
2nzj_A		175	GTP-binding protein REM 1; GDP/GTP binding, GTP hy	98.19
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	98.19
1f6b_A		198	SAR1; gtpases, N-terminal helix, Mg-containing com	98.18
4djt_A		218	GTP-binding nuclear protein GSP1; structural genom	98.18
3oes_A		201	GTPase rhebl1; small GTPase, structural genomics,	98.18
2atv_A		196	RERG, RAS-like estrogen-regulated growth inhibitor	98.17
2qag_A		361	Septin-2, protein NEDD5; cell cycle, cell division	98.17
3bc1_A		195	RAS-related protein RAB-27A; RAB27, GTPase, RAB, s	98.17
4bas_A		199	ADP-ribosylation factor, putative (small GTPase, p	98.17
2fh5_B		214	SR-beta, signal recognition particle receptor beta	98.15
2iwr_A		178	Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi	98.14
2efe_B		181	Small GTP-binding protein-like; GEF, GTPase, VPS9,	98.14
3reg_A		194	RHO-like small GTPase; cytoskeleton, nucleotide-bi	98.14
2hjg_A		436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	98.14
1ksh_A		186	ARF-like protein 2; small GTPase, small GTP-bindin	98.14
2xtp_A		260	GTPase IMAP family member 2; immune system, G prot	98.13
3kta_A		182	Chromosome segregation protein SMC; structural mai	98.13
2f7s_A		217	C25KG, RAS-related protein RAB-27B; G-protein, str	98.13
2hup_A		201	RAS-related protein RAB-43; G-protein, GDP, struct	98.12
2hxs_A		178	RAB-26, RAS-related protein RAB-28; GTPase, signal	98.12
2p5s_A		199	RAS and EF-hand domain containing; G-protein, RAB,	98.11
3llu_A		196	RAS-related GTP-binding protein C; structural geno	98.11
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	98.11
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	98.1
3gee_A		476	MNME, tRNA modification GTPase MNME; G protein, cy	98.1
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	98.1
1moz_A		183	ARL1, ADP-ribosylation factor-like protein 1; GTP-	98.1
2hjg_A		436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	98.09
2h57_A		190	ADP-ribosylation factor-like protein 6; GTP, GTPas	98.09
2c78_A		405	Elongation factor TU-A; hydrolase, GTPase, transla	98.08
2j0v_A		212	RAC-like GTP-binding protein ARAC7; nucleotide-bin	98.08
2yc2_C		208	IFT27, small RAB-related GTPase; transport protein	98.07
2gf9_A		189	RAS-related protein RAB-3D; G-protein, structural	98.07
1zbd_A		203	Rabphilin-3A; G protein, effector, RABCDR, synapti	98.06
2q3h_A		201	RAS homolog gene family, member U; GTPase, structu	98.06
2b6h_A		192	ADP-ribosylation factor 5; membrane trafficking, G	98.05
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	98.05
2aka_B		299	Dynamin-1; fusion protein, GTPase domain, myosin,	98.05
2bcg_Y		206	Protein YP2, GTP-binding protein YPT1; RABGTPase,	98.04
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	98.04
2r6f_A		972	Excinuclease ABC subunit A; UVRA, nucleotide excis	98.03
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	98.03
2f9l_A		199	RAB11B, member RAS oncogene family; RAB11B GTPase,	98.02
4dcu_A		456	GTP-binding protein ENGA; GTPase, GDP, protein bin	98.01
2vf7_A		842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	98.01
2x2e_A		353	Dynamin-1; nitration, hydrolase, membrane fission,	98.01
1jwy_B		315	Dynamin A GTPase domain; dynamin, GTPase, GDP, myo	98.01
2elf_A		370	Protein translation elongation factor 1A; tRNA, py	98.01
3bos_A		242	Putative DNA replication factor; P-loop containing	98.01
3cbq_A		195	GTP-binding protein REM 2; FLJ38964A, structural g	98.0
1z06_A		189	RAS-related protein RAB-33B; RAB GTPase, RAB33B GT	98.0
2o52_A		200	RAS-related protein RAB-4B; G-protein, GDP, struct	98.0
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	97.99
3r7w_A		307	Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT	97.99
2ygr_A		993	Uvrabc system protein A; hydrolase, nucleotide exc	97.98
3j2k_7		439	ERF3, eukaryotic polypeptide chain release factor	97.98
2a5j_A		191	RAS-related protein RAB-2B; GTPase, signal transdu	97.98
1ni3_A		392	YCHF GTPase, YCHF GTP-binding protein; structural	97.97
2x77_A		189	ADP-ribosylation factor; GTP-binding protein, smal	97.96
1g7s_A		594	Translation initiation factor IF2/EIF5B; translati	97.95
3th5_A		204	RAS-related C3 botulinum toxin substrate 1; rossma	97.19
4dcu_A		456	GTP-binding protein ENGA; GTPase, GDP, protein bin	97.94
3geh_A		462	MNME, tRNA modification GTPase MNME; G protein, U3	97.93
2dy1_A		665	Elongation factor G; translocation, GTP complex, s	97.93
2ius_A		512	DNA translocase FTSK; nucleotide-binding, chromoso	97.92
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	97.92
2xxa_A		433	Signal recognition particle protein; protein trans	97.92
3o47_A		329	ADP-ribosylation factor GTPase-activating protein	97.91
1kk1_A		410	EIF2gamma; initiation of translation; HET: GNP; 1.	97.9
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	97.89
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	97.89
2j69_A		695	Bacterial dynamin-like protein; FZO, FZL, GTPase,	97.88
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	97.88
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	97.87
3cr8_A		552	Sulfate adenylyltranferase, adenylylsulfate kinase	97.85
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	97.85
3p26_A		483	Elongation factor 1 alpha-like protein; GTP/GDP bi	97.85
1s0u_A		408	EIF-2-gamma, translation initiation factor 2 gamma	97.85
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	97.85
2wkq_A		332	NPH1-1, RAS-related C3 botulinum toxin substrate 1	97.84
3gj0_A		221	GTP-binding nuclear protein RAN; G protein, GDP, a	97.84
1u94_A		356	RECA protein, recombinase A; homologous recombinat	97.84
3q3j_B		214	RHO-related GTP-binding protein RHO6; RAS-binding	97.83
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	97.81
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	97.8
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	97.79
3izq_1		611	HBS1P, elongation factor 1 alpha-like protein; NO-	97.79
3def_A		262	T7I23.11 protein; chloroplast, TOC33, GTPase, hydr	97.79
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	97.77
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	97.77
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	97.77
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	97.76
3kta_B		173	Chromosome segregation protein SMC; structural mai	97.74
3dpu_A		535	RAB family protein; roccor, G-domain, COR, GTP-bin	97.74
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	97.74
1zun_B		434	Sulfate adenylate transferase, subunit 1/adenylyls	97.72
1d2e_A		397	Elongation factor TU (EF-TU); G-protein, beta-barr	97.72
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	97.71
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	97.7
3qq5_A		423	Small GTP-binding protein; hydrogenase, H-cluster,	97.68
1f2t_A		149	RAD50 ABC-ATPase; DNA double-strand break repair,	97.68
1xp8_A		366	RECA protein, recombinase A; recombination, radior	97.66
1w1w_A		430	Structural maintenance of chromosome 1; cohesin, c	97.66
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	97.65
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	97.64
1jny_A		435	EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-	97.64
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	97.63
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	97.62
2r8r_A		228	Sensor protein; KDPD, PFAM02702, MCSG, structural	97.61
2z43_A		324	DNA repair and recombination protein RADA; archaea	97.6
1h65_A		270	Chloroplast outer envelope protein OEP34; GTPase,	97.6
2o5v_A		359	DNA replication and repair protein RECF; ABC ATPas	97.6
3lvq_E		497	ARF-GAP with SH3 domain, ANK repeat and PH domain	97.57
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	97.57
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	97.56
1via_A		175	Shikimate kinase; structural genomics, transferase	97.55
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	97.53
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	97.53
1f60_A		458	Elongation factor EEF1A; protein-protein complex,	97.53
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	97.53
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	97.53
3cb4_D		599	GTP-binding protein LEPA; GTPase, OB-fold, membran	97.53
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	97.52
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	97.51
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	97.51
4ad8_A		517	DNA repair protein RECN; DNA binding protein, ATPa	97.5
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	97.49
1vht_A		218	Dephospho-COA kinase; structural genomics, transfe	97.49
1dar_A		691	EF-G, elongation factor G; ribosomal translocase,	97.48
3ake_A		208	Cytidylate kinase; CMP kinase, CMP complex, open c	97.48
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	97.48
3tr5_A		528	RF-3, peptide chain release factor 3; protein synt	97.48
1mky_A		439	Probable GTP-binding protein ENGA; GTPase, DER, KH	97.46
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	97.46
2ywe_A		600	GTP-binding protein LEPA; G domain, beta-barrel, f	97.46
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	97.45
3avx_A		1289	Elongation factor TS, elongation factor TU, linke	97.45
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	97.45
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	97.43
3mca_A		592	HBS1, elongation factor 1 alpha-like protein; prot	97.43
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	97.42
2qgz_A		308	Helicase loader, putative primosome component; str	97.42
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	97.41
3qks_A		203	DNA double-strand break repair RAD50 ATPase; RECA-	97.4
3r20_A		233	Cytidylate kinase; structural genomics, seattle st	97.39
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	97.38
2zej_A		184	Dardarin, leucine-rich repeat kinase 2; parkinson'	97.38
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	97.37
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	97.37
3zvr_A		772	Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito	97.37
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	97.36
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	97.36
1xzp_A		482	Probable tRNA modification GTPase TRME; GTP-bindin	97.35
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	97.35
2xex_A		693	Elongation factor G; GTPase, translation, biosynth	97.34
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	97.34
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	97.33
1svm_A		377	Large T antigen; AAA+ fold, viral protein; HET: AT	97.31
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	97.29
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	97.29
3d3q_A		340	TRNA delta(2)-isopentenylpyrophosphate transferase	97.29
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	97.29
2ohf_A		396	Protein OLA1, GTP-binding protein 9; ATPase, GTPas	97.28
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	97.27
3auy_A		371	DNA double-strand break repair RAD50 ATPase; DNA r	97.27
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	97.27
3co5_A		143	Putative two-component system transcriptional RES	97.25
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	97.25
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	97.24
2rdo_7		704	EF-G, elongation factor G; elongation factor G, EF	97.24
1q3t_A		236	Cytidylate kinase; nucleotide monophosphate kinase	97.24
4dkx_A		216	RAS-related protein RAB-6A; GTP binding fold, memb	97.24
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	97.23
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	97.23
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	97.22
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	97.22
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	97.22
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	97.22
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	97.21
1jal_A		363	YCHF protein; nucleotide-binding fold, structural	97.21
3sr0_A		206	Adenylate kinase; phosphoryl transfer analogue, AL	97.2
4ag6_A		392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	97.18
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	97.18
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	97.17
2vli_A		183	Antibiotic resistance protein; transferase, tunica	97.16
3umf_A		217	Adenylate kinase; rossmann fold, transferase; 2.05	97.14
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	97.14
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	97.13
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	97.13
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	97.12
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	97.12
3tlx_A		243	Adenylate kinase 2; structural genomics, structura	97.11
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	97.11
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	97.1
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	97.1
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	97.1
2grj_A		192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	97.09
2h5e_A		529	Peptide chain release factor RF-3; beta barrel, tr	97.09
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	97.09
2f6r_A		281	COA synthase, bifunctional coenzyme A synthase; 18	97.08
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	97.07
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	97.07
3kjh_A		254	CO dehydrogenase/acetyl-COA synthase complex, acce	97.07
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	97.04
1w1w_A		430	Structural maintenance of chromosome 1; cohesin, c	97.03
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	97.01
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	97.0
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	96.99
3io5_A		333	Recombination and repair protein; storage dimer, i	96.99
2xb4_A		223	Adenylate kinase; ATP-binding, nucleotide-binding,	96.97
3crm_A		323	TRNA delta(2)-isopentenylpyrophosphate transferase	96.97
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	96.97
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	96.93
2o5v_A		359	DNA replication and repair protein RECF; ABC ATPas	96.93
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	96.93
2r2a_A		199	Uncharacterized protein; zonular occludens toxin,	96.88
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	96.88
3be4_A		217	Adenylate kinase; malaria, cryptosporidium parvum	96.86
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	96.86
2h92_A		219	Cytidylate kinase; rossmann fold, transferase; HET	96.85
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	96.84
1g16_A		170	RAS-related protein SEC4; G protein RAB, signaling	96.8
1g3q_A		237	MIND ATPase, cell division inhibitor; alpha-beta-a	96.8
4dzz_A		206	Plasmid partitioning protein PARF; deviant walker	96.77
3tw8_B		181	RAS-related protein RAB-35; longin domain, RAB GTP	96.77
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	96.77
1ak2_A		233	Adenylate kinase isoenzyme-2; nucleoside monophosp	96.76
2hf9_A		226	Probable hydrogenase nickel incorporation protein	96.76
3auy_A		371	DNA double-strand break repair RAD50 ATPase; DNA r	96.76
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	96.74
2zts_A		251	Putative uncharacterized protein PH0186; KAIC like	96.71
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	96.66
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	96.65
3q9l_A		260	Septum site-determining protein MIND; ATPase, bact	96.6
2bme_A		186	RAB4A, RAS-related protein RAB4A; GTP-binding prot	96.59
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	96.58
3foz_A		316	TRNA delta(2)-isopentenylpyrophosphate transferas;	96.57
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	96.56
4edh_A		213	DTMP kinase, thymidylate kinase; structural genomi	96.53
4hlc_A		205	DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri	96.5
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	96.49
4ad8_A		517	DNA repair protein RECN; DNA binding protein, ATPa	96.49
3ea0_A		245	ATPase, para family; alpha-beta-alpha sandwich, st	96.49
1x3s_A		195	RAS-related protein RAB-18; GTPase, GNP, structura	96.47
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	96.47
2h17_A		181	ADP-ribosylation factor-like protein 5A; GDP, GTPa	96.47
2dby_A		368	GTP-binding protein; GDP, structural genomics, NPP	96.46
3cio_A		299	ETK, tyrosine-protein kinase ETK; WZC, escherichia	96.46

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C	Back alignment and structure

Probab=99.93  E-value=9.5e-26  Score=208.26  Aligned_cols=137  Identities=15%  Similarity=0.229  Sum_probs=108.7

Q ss_pred             eEEEEEcCCCccHHHHHHHHHcCCCCCCceEEEeccCCcC----------CCCCC-------CcccChhhhhh-------
Q 024360            3 YAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAA----------ENFDY-------PVAMDIRELIS-------   58 (268)
Q Consensus         3 ~~~~liGpnGSGKSTLl~~l~g~l~~~~G~v~i~~~d~~~----------~~~~y-------~~~~~i~~~i~-------   58 (268)
                      -+++|+||||||||||+|+|+|+++|++|+|.++|.+...          ..++|       .+.+||++++.       
T Consensus        55 ei~~IiGpnGaGKSTLlr~i~GL~~p~~G~I~i~G~~i~~~~~~~~~~~r~~Ig~v~Q~~~l~~~~TV~env~~~~~~~~  134 (366)
T 3tui_C           55 QIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDN  134 (366)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECSSCCHHHHHHHHTTEEEECSSCCCCTTSCHHHHHHHHHHHSC
T ss_pred             CEEEEEcCCCchHHHHHHHHhcCCCCCceEEEECCEECCcCCHHHHHHHhCcEEEEeCCCccCCCCCHHHHHHHHHHhcC
Confidence            4789999999999999999999999999999999987632          22333       44678888874       


Q ss_pred             ---------HHHHHHHhCCCCCCChhhhHhhhhhhH------HHHHHHHHhcCCCCCEEEEeCCCc-CCHHhHHHHHHHH
Q 024360           59 ---------LEDVMEELGLGPNGGLIYCMEHLEDNL------DDWLAEELDNYLDDDYLVFDCPGQ-IELFTHVPVLRNF  122 (268)
Q Consensus        59 ---------~~~~m~~~~L~~~g~~~~~~~~~~~~l------s~~la~al~~~~~p~~lilDEP~~-LD~~~~~~i~~~l  122 (268)
                               +.++++.+||.+.      .+.++.++      +++|||||+.  +|++||+||||+ ||+.++..++ ++
T Consensus       135 ~~~~~~~~~v~~lL~~vgL~~~------~~~~~~~LSGGqkQRVaIArAL~~--~P~lLLlDEPTs~LD~~~~~~i~-~l  205 (366)
T 3tui_C          135 TPKDEVKRRVTELLSLVGLGDK------HDSYPSNLSGGQKQRVAIARALAS--NPKVLLCDQATSALDPATTRSIL-EL  205 (366)
T ss_dssp             CCHHHHHHHHHHHHHHHTCGGG------TTCCTTTSCHHHHHHHHHHHHTTT--CCSEEEEESTTTTSCHHHHHHHH-HH
T ss_pred             CCHHHHHHHHHHHHHHcCCchH------hcCChhhCCHHHHHHHHHHHHHhc--CCCEEEEECCCccCCHHHHHHHH-HH
Confidence                     5678899999764      23444333      3999999999  999999999999 9999999998 99


Q ss_pred             HHHHHh-CCCeEEEEEecccccccCHHHHHH
Q 024360          123 VDHLKS-RNFNVCAVYLLDSQFITDVTKFIS  152 (268)
Q Consensus       123 l~~l~~-~~~~ii~v~l~d~~~~~d~~~~~s  152 (268)
                      ++++++ .|.++++|    +|.+.....+|+
T Consensus       206 L~~l~~~~g~Tii~v----THdl~~~~~~aD  232 (366)
T 3tui_C          206 LKDINRRLGLTILLI----THEMDVVKRICD  232 (366)
T ss_dssp             HHHHHHHSCCEEEEE----ESCHHHHHHHCS
T ss_pred             HHHHHHhCCCEEEEE----ecCHHHHHHhCC
Confidence            999975 48888766    466554445543

PyMOL of 3tui

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A	Back alignment and structure

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*	Back alignment and structure

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}	Back alignment and structure

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12	Back alignment and structure

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}	Back alignment and structure

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}	Back alignment and structure

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*	Back alignment and structure

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*	Back alignment and structure

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C	Back alignment and structure

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12	Back alignment and structure

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A	Back alignment and structure

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}	Back alignment and structure

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A	Back alignment and structure

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*	Back alignment and structure

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B	Back alignment and structure

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}	Back alignment and structure

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A	Back alignment and structure

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A*	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A*	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B*	Back alignment and structure

>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B*	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A*	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A*	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A*	Back alignment and structure

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}	Back alignment and structure

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10	Back alignment and structure

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*	Back alignment and structure

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A	Back alignment and structure

>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A	Back alignment and structure

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}	Back alignment and structure

>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis}	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens}	Back alignment and structure

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A*	Back alignment and structure

>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus}	Back alignment and structure

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8	Back alignment and structure

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A*	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*	Back alignment and structure

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*	Back alignment and structure

>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R*	Back alignment and structure

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*	Back alignment and structure

>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A*	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*	Back alignment and structure

>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A*	Back alignment and structure

>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A*	Back alignment and structure

>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A*	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila}	Back alignment and structure

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*	Back alignment and structure

>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A	Back alignment and structure

>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A*	Back alignment and structure

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1	Back alignment and structure

>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A*	Back alignment and structure

>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum}	Back alignment and structure

>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens}	Back alignment and structure

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8	Back alignment and structure

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum}	Back alignment and structure

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*	Back alignment and structure

>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A*	Back alignment and structure

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*	Back alignment and structure

>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B*	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}	Back alignment and structure

>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A*	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B*	Back alignment and structure

>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A*	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A*	Back alignment and structure

>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B*	Back alignment and structure

>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A*	Back alignment and structure

>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1	Back alignment and structure

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}	Back alignment and structure

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1	Back alignment and structure

>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ...	Back alignment and structure

>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A*	Back alignment and structure

>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A*	Back alignment and structure

>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A*	Back alignment and structure

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}	Back alignment and structure

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1	Back alignment and structure

>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A*	Back alignment and structure

>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A*	Back alignment and structure

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V	Back alignment and structure

>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A*	Back alignment and structure

>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A*	Back alignment and structure

>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C	Back alignment and structure

>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens}	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A*	Back alignment and structure

>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B*	Back alignment and structure

>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens}	Back alignment and structure

>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ...	Back alignment and structure

>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A*	Back alignment and structure

>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A*	Back alignment and structure

>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A*	Back alignment and structure

>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens}	Back alignment and structure

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}	Back alignment and structure

>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A*	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ...	Back alignment and structure

>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens}	Back alignment and structure

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A*	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A*	Back alignment and structure

>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens}	Back alignment and structure

>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens}	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A*	Back alignment and structure

>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi}	Back alignment and structure

>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens}	Back alignment and structure

>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A*	Back alignment and structure

>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927}	Back alignment and structure

>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2	Back alignment and structure

>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A	Back alignment and structure

>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B*	Back alignment and structure

>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A*	Back alignment and structure

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}	Back alignment and structure

>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A*	Back alignment and structure

>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A	Back alignment and structure

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*	Back alignment and structure

>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A*	Back alignment and structure

>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens}	Back alignment and structure

>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A*	Back alignment and structure

>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens}	Back alignment and structure

>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A*	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A*	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}	Back alignment and structure

>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens}	Back alignment and structure

>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ...	Back alignment and structure

>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana}	Back alignment and structure

>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C	Back alignment and structure

>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A*	Back alignment and structure

>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8	Back alignment and structure

>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens}	Back alignment and structure

>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A*	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A*	Back alignment and structure

>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A*	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*	Back alignment and structure

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*	Back alignment and structure

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*	Back alignment and structure

>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A	Back alignment and structure

>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B*	Back alignment and structure

>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei}	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens}	Back alignment and structure

>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B*	Back alignment and structure

>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens}	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A*	Back alignment and structure

>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus}	Back alignment and structure

>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A*	Back alignment and structure

>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2	Back alignment and structure

>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major}	Back alignment and structure

>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A*	Back alignment and structure

>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens}	Back alignment and structure

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*	Back alignment and structure

>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP}	Back alignment and structure

>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A*	Back alignment and structure

>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens}	Back alignment and structure

>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A*	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A*	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A*	Back alignment and structure

>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A*	Back alignment and structure

>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ...	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A*	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A*	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B*	Back alignment and structure

>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum}	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8	Back alignment and structure

>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A*	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana}	Back alignment and structure

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A*	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A*	Back alignment and structure

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C*	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans}	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A	Back alignment and structure

>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ...	Back alignment and structure

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii}	Back alignment and structure

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A*	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe}	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A*	Back alignment and structure

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B*	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus}	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens}	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B*	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H	Back alignment and structure

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1	Back alignment and structure

>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A*	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2	Back alignment and structure

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*	Back alignment and structure

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}	Back alignment and structure

>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W*	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A*	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*	Back alignment and structure

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}	Back alignment and structure

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6	Back alignment and structure

>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58}	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus}	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A	Back alignment and structure

>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A*	Back alignment and structure

>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A*	Back alignment and structure

>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens}	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B*	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A*	Back alignment and structure

>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A*	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*	Back alignment and structure

>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A*	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans}	Back alignment and structure

>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum}	Back alignment and structure

>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A*	Back alignment and structure

>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A	Back alignment and structure

>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		268
d1yrba1		244	c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09	4e-41

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: ATP(GTP)-binding protein PAB0955
species: Pyrococcus abyssi [TaxId: 29292]

 Score =  139 bits (351), Expect = 4e-41
 Identities = 51/241 (21%), Positives = 106/241 (43%), Gaps = 7/241 (2%)

Query: 6   LVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPAAENFDYPVAMDIRELISLEDVMEE 65
           + +G AGSGK+T      R+ E   +    VNLD   +   Y  ++D+RE +++E++M E
Sbjct: 4   VFVGTAGSGKTTLTGEFGRYLEDNYKV-AYVNLDTGVKELPYEPSIDVREFVTVEEIMRE 62

Query: 66  LGLGPNGGLIYCMEHLEDNLDDWLAEELDNYLDDDYLVFDCPGQIELFTHVPVLRNFVDH 125
            G GPNG ++   + L +  +++L + L    ++DY++ D PGQ+E F         +++
Sbjct: 63  -GYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFHEFGVRLMEN 121

Query: 126 LKSRNFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNKKEIE 185
           L         VY+ D + +     +      +L   ++L    +  L+K+DL++ +++  
Sbjct: 122 L----PYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNKVDLLSEEEKER 177

Query: 186 DYLNPESQFLLSELNQHMAPQFAKLNKSLIELVDE-YSMVSFMPLDLRKESSIRYVLSQI 244
                E    L+   +        +   +  ++ E    V  + L  +       + +  
Sbjct: 178 HRKYFEDIDYLTARLKLDPSMQGLMAYKMCSMMTEVLPPVRVLYLSAKTREGFEDLETLA 237

Query: 245 D 245
            
Sbjct: 238 Y 238

PyMOL of d1yrba1

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		268
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	99.95
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	99.95
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	99.95
d2awna2		232	Maltose transport protein MalK, N-terminal domain	99.95
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	99.95
d1g2912		240	Maltose transport protein MalK, N-terminal domain	99.95
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	99.94
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	99.94
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	99.94
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	99.94
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	99.94
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	99.93
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	99.92
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	99.91
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	99.89
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	99.89
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	99.88
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	99.88
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	99.87
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	99.87
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	99.84
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	99.42
g1f2t.1		292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	99.11
d1udxa2		180	Obg GTP-binding protein middle domain {Thermus the	98.9
d1wf3a1		178	GTPase Era, N-terminal domain {Thermus thermophilu	98.85
d1svia_		195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	98.8
d1lnza2		185	Obg GTP-binding protein middle domain {Bacillus su	98.78
d1mkya2		186	Probable GTPase Der, N-terminal and middle domains	98.72
d2cxxa1		184	GTP-binding protein engB {Pyrococcus horikoshii [T	98.71
d1g7sa4		227	Initiation factor IF2/eIF5b, N-terminal (G) domain	98.66
d2qy9a2		211	GTPase domain of the signal recognition particle r	98.57
d1wb1a4		179	Elongation factor SelB, N-terminal domain {Methano	98.56
d2gj8a1		161	Probable tRNA modification GTPase TrmE (MnmE), G d	98.55
d1j8yf2		211	GTPase domain of the signal sequence recognition p	98.55
d1kk1a3		195	Initiation factor eIF2 gamma subunit, N-terminal (	98.54
d1egaa1		179	GTPase Era, N-terminal domain {Escherichia coli [T	98.54
d1mkya1		171	Probable GTPase Der, N-terminal and middle domains	98.53
d1vmaa2		213	GTPase domain of the signal recognition particle r	98.52
d1okkd2		207	GTPase domain of the signal recognition particle r	98.48
d2c78a3		204	Elongation factor Tu (EF-Tu), N-terminal (G) domai	98.34
d1puia_		188	Probable GTPase EngB {Escherichia coli [TaxId: 562	98.31
d1ky3a_		175	Rab-related protein ypt7p {Baker's yeast (Saccharo	98.29
d1ls1a2		207	GTPase domain of the signal sequence recognition p	98.28
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	98.22
d1d2ea3		196	Elongation factor Tu (EF-Tu), N-terminal (G) domai	98.19
d1nrjb_		209	Signal recognition particle receptor beta-subunit	98.18
d2qn6a3		205	Initiation factor eIF2 gamma subunit, N-terminal (	98.17
d1zd9a1		164	ADP-ribosylation factor {Human (Homo sapiens), ARL	98.12
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	98.11
d1tq4a_		400	Interferon-inducible GTPase {Mouse (Mus musculus)	98.09
d1kaoa_		167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	98.09
d1ewqa2		224	DNA repair protein MutS, the C-terminal domain {Th	98.08
d1wb9a2		234	DNA repair protein MutS, the C-terminal domain {Es	98.08
d1kmqa_		177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	98.05
d1ctqa_		166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	98.05
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	98.04
d1zunb3		222	Sulfate adenylate transferase subunit cysN/C, EF-T	98.04
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	98.03
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	98.03
d1ksha_		165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	98.02
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	98.02
d1zj6a1		177	ADP-ribosylation factor {Human (Homo sapiens), ARL	98.02
d1xzpa2		160	TrmE GTPase domain {Thermotoga maritima [TaxId: 23	98.01
d1fzqa_		176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	97.97
d2erya1		171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	97.96
d1z2aa1		164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	97.94
d1wmsa_		174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	97.93
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	97.87
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	97.86
d2g3ya1		172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	97.86
d1yzqa1		164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	97.85
d2erxa1		171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	97.84
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	97.84
d1moza_		182	ADP-ribosylation factor {Baker's yeast (Saccharomy	97.81
d1c1ya_		167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	97.81
d1vg8a_		184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	97.81
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	97.79
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	97.78
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	97.77
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	97.77
d1z0ja1		167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	97.77
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	97.75
d1z0fa1		166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	97.75
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	97.74
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	97.74
d1e0sa_		173	ADP-ribosylation factor {Human (Homo sapiens), ARF	97.73
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	97.73
d1u8za_		168	Ras-related protein RalA {Cotton-top tamarin (Sagu	97.72
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	97.7
d2fn4a1		173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	97.7
d2dy1a2		267	Elongation factor G (EF-G), N-terminal (G) domain	97.67
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	97.67
d1x1ra1		169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	97.66
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	97.65
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	97.65
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	97.62
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	97.62
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	97.61
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	97.61
d2atxa1		185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	97.6
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	97.59
d1jnya3		224	Elongation factor eEF-1alpha, N-terminal (G) domai	97.59
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	97.59
d1r2qa_		170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	97.59
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	97.59
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	97.58
d2bv3a2		276	Elongation factor G (EF-G), N-terminal (G) domain	97.58
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	97.54
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	97.51
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	97.5
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	97.49
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	97.48
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	97.47
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	97.47
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.46
g1ii8.1		369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	97.45
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	97.44
d1m7ba_		179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	97.41
d1qhla_		222	Cell division protein MukB {Escherichia coli [TaxI	97.4
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	97.4
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	97.4
d1f60a3		239	Elongation factor eEF-1alpha, N-terminal (G) domai	97.39
g1xew.1		329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	97.38
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	97.38
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	97.36
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	97.35
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	97.35
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.35
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	97.34
d1e69a_		308	Smc head domain {Thermotoga maritima [TaxId: 2336]	97.34
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	97.32
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	97.28
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	97.27
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	97.26
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	97.26
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	97.23
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	97.22
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	97.22
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	97.19
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	97.14
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	97.13
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	97.12
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	97.1
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	97.09
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	97.07
d1f6ba_		186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	97.06
d2qtvb1		166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	97.06
d1upta_		169	ADP-ribosylation factor {Human (Homo sapiens), ARL	97.02
d1g3qa_		237	Cell division regulator MinD {Archaeon Pyrococcus	96.95
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	96.95
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	96.91
d1t9ha2		231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	96.87
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	96.87
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	96.83
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	96.82
d2fh5b1		207	Signal recognition particle receptor beta-subunit	96.79
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	96.76
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	96.75
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	96.74
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	96.73
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	96.72
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	96.7
d1n0ua2		341	Elongation factor 2 (eEF-2), N-terminal (G) domain	96.7
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	96.69
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	96.63
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	96.62
d1h65a_		257	Chloroplast protein translocon GTPase Toc34 {Garde	96.6
d1deka_		241	Deoxynucleoside monophosphate kinase {Bacteriophag	96.58
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	96.55
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	96.55
d2akab1		299	Dynamin G domain {Rat (Rattus norvegicus) [TaxId:	96.54
d3raba_		169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	96.47
g1ii8.1		369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	96.46
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	96.41
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	96.39
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	96.39
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	96.36
d2f9la1		175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	96.36
d1g16a_		166	Rab-related protein Sec4 {Baker's yeast (Saccharom	96.35
d2f7sa1		186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	96.34
d2gjsa1		168	Rad {Human (Homo sapiens) [TaxId: 9606]}	96.32
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	96.3
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	96.3
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	96.29
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	96.27
d2ew1a1		171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	96.26
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	96.25
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	96.23
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	96.21
d2a5ja1		173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	96.21
d1xtqa1		167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	96.19
d1z06a1		165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	96.12
d1i2ma_		170	Ran {Human (Homo sapiens) [TaxId: 9606]}	96.11
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	96.11
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	96.09
d2bcgy1		194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	96.09
d2atva1		168	Ras-like estrogen-regulated growth inhibitor, RERG	96.04
d1jala1		278	YchF GTP-binding protein N-terminal domain {Haemop	96.04
d2bmea1		174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	96.0
d1z08a1		167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	96.0
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	96.0
d1x3sa1		177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	95.99
d1ek0a_		170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	95.96
d2g6ba1		170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	95.86
d1mh1a_		183	Rac {Human (Homo sapiens) [TaxId: 9606]}	95.79
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	95.75
d2fu5c1		173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	95.72
d1azta2		221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	95.72
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	95.68
d1zcba2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	95.61
d2bmja1		175	Centaurin gamma 1, G domain {Human (Homo sapiens)	95.56
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	95.55
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	95.52
d2ngra_		191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	95.48
d1kkma_		176	HPr kinase HprK C-terminal domain {Lactobacillus c	95.47
d1ni3a1		296	YchF GTP-binding protein N-terminal domain {Fissio	95.47
d1svsa1		195	Transducin (alpha subunit) {Rat (Rattus norvegicus	95.4
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	95.37
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	95.37
d1knxa2		177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	95.36
d1wxqa1		319	GTP-binding protein PH0525 {Pyrococcus horikoshii	95.35
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	95.34
d1f5na2		277	Interferon-induced guanylate-binding protein 1 (GB	95.33
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	95.28
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	95.26
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	95.16
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	94.98
d2bcjq2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	94.98
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	94.97
d1ko7a2		169	HPr kinase HprK C-terminal domain {Staphylococcus	94.94
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	94.87
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	94.81
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	94.68
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	94.51
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	94.47
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	94.42
d1jwyb_		306	Dynamin G domain {Dictyostelium discoideum [TaxId:	94.38
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	94.37
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	94.28
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	94.28
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	94.24
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	94.19
d1u0ja_		267	Rep 40 protein helicase domain {Adeno-associated v	93.75
d1osna_		331	Thymidine kinase {Varicella-zoster virus [TaxId: 1	93.4
d1p6xa_		333	Thymidine kinase {Equine herpesvirus type 4 [TaxId	93.25
d1tuea_		205	Replication protein E1 helicase domain {Human papi	93.23
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	92.66
d1e2ka_		329	Thymidine kinase {Herpes simplex virus type 1, dif	92.62
d1byia_		224	Dethiobiotin synthetase {Escherichia coli [TaxId:	92.23
d1xpua3		289	Transcription termination factor Rho, ATPase domai	92.05
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	91.92
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	91.73
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	91.45
d1puja_		273	Probable GTPase YlqF {Bacillus subtilis [TaxId: 14	91.32
d1g8fa3		122	ATP sulfurylase C-terminal domain {Baker's yeast (	91.19
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	90.97
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	90.82
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	89.71
d1r5ba3		245	Eukaryotic peptide chain release factor ERF2, G do	89.7
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	89.56
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	89.2
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	88.68
d1fx0a3		276	Central domain of alpha subunit of F1 ATP synthase	87.51
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	87.41
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	86.32
d2olra1		313	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	85.7
d1j3ba1		318	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	85.69
d2gjsa1		168	Rad {Human (Homo sapiens) [TaxId: 9606]}	84.56
d2b8ta1		139	Thymidine kinase, TK1, N-terminal domain {Ureaplas	84.35
d1lkxa_		684	Myosin S1, motor domain {Dictyostelium discoideum,	83.96
d1br2a2		710	Myosin S1, motor domain {Chicken (Gallus gallus),	83.74
d1ii2a1		323	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	83.66
d1e69a_		308	Smc head domain {Thermotoga maritima [TaxId: 2336]	83.62
d1d0xa2		712	Myosin S1, motor domain {Dictyostelium discoideum	83.53
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	83.02
d1ek0a_		170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	82.07
d1c9ka_		180	Adenosylcobinamide kinase/adenosylcobinamide phosp	81.88
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	81.84
d2mysa2		794	Myosin S1, motor domain {Chicken (Gallus gallus),	81.69
d2ew1a1		171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	81.68
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	80.88
d1kk8a2		789	Myosin S1, motor domain {Bay scallop (Aequipecten	80.64
d2bmea1		174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	80.53

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Molybdate/tungstate import ATP-binding protein WtpC (ModC)
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=99.95  E-value=1.7e-28  Score=212.11  Aligned_cols=151  Identities=16%  Similarity=0.260  Sum_probs=120.1

Q ss_pred             eEEEEEcCCCccHHHHHHHHHcCCCCCCceEEEeccCCc-----CCCCCC-------CcccChhhhhh------------
Q 024360            3 YAQLVIGPAGSGKSTYCSSLYRHCETVRRTMHIVNLDPA-----AENFDY-------PVAMDIRELIS------------   58 (268)
Q Consensus         3 ~~~~liGpnGSGKSTLl~~l~g~l~~~~G~v~i~~~d~~-----~~~~~y-------~~~~~i~~~i~------------   58 (268)
                      -+++|+||||||||||+++|+|+++|++|+|.++|.+..     ++.++|       .+.+||+|++.            
T Consensus        25 e~~~liGpnGaGKSTll~~i~Gl~~p~~G~I~~~G~~i~~~~~~~r~ig~v~Q~~~l~~~ltV~enl~~~l~~~~~~~~~  104 (240)
T d2onka1          25 DYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPERRGIGFVPQDYALFPHLSVYRNIAYGLRNVERVERD  104 (240)
T ss_dssp             SEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTTSCTTTSCCBCCCSSCCCCTTSCHHHHHHTTCTTSCHHHHH
T ss_pred             EEEEEECCCCChHHHHHHHHHcCCCCCceEEEECCEECCcCCHHHcCceeeccchhhcccchhhHhhhhhhcccCHHHHH
Confidence            367899999999999999999999999999999997652     234444       35678998875            


Q ss_pred             --HHHHHHHhCCCCCCChhhhHhhhhhhHH------HHHHHHHhcCCCCCEEEEeCCCc-CCHHhHHHHHHHHHHHHHhC
Q 024360           59 --LEDVMEELGLGPNGGLIYCMEHLEDNLD------DWLAEELDNYLDDDYLVFDCPGQ-IELFTHVPVLRNFVDHLKSR  129 (268)
Q Consensus        59 --~~~~m~~~~L~~~g~~~~~~~~~~~~ls------~~la~al~~~~~p~~lilDEP~~-LD~~~~~~i~~~ll~~l~~~  129 (268)
                        +.++++.+||.+.      .+..+.++|      ++|||||+.  +|+++|+||||+ ||+.++..++ ++++.++++
T Consensus       105 ~~v~~~l~~~gl~~~------~~~~~~~LSGG~kQRvaiAral~~--~P~illlDEPts~LD~~~~~~i~-~~i~~l~~~  175 (240)
T d2onka1         105 RRVREMAEKLGIAHL------LDRKPARLSGGERQRVALARALVI--QPRLLLLDEPLSAVDLKTKGVLM-EELRFVQRE  175 (240)
T ss_dssp             HHHHHHHHTTTCTTT------TTCCGGGSCHHHHHHHHHHHHHTT--CCSSBEEESTTSSCCHHHHHHHH-HHHHHHHHH
T ss_pred             HHHHHHHHhcCcHhh------hhCChhhCCHHHHHHHHHHHHHhc--cCCceEecCccccCCHHHHHHHH-HHHHHHHHh
Confidence              7889999999876      355554443      999999999  999999999999 9999998888 999998754


Q ss_pred             -CCeEEEEEecccccccCHHHHHHHHHHHHHHHHhhcCCeeEeeccccccCCc
Q 024360          130 -NFNVCAVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVTNK  181 (268)
Q Consensus       130 -~~~ii~v~l~d~~~~~d~~~~~s~~l~~~~~~~~~~~p~i~vlsk~dll~~~  181 (268)
                       |.++++|    +|.+.+...+++               ++.|+.+..++...
T Consensus       176 ~g~tvi~v----tHd~~~~~~~ad---------------ri~vm~~G~ii~~G  209 (240)
T d2onka1         176 FDVPILHV----THDLIEAAMLAD---------------EVAVMLNGRIVEKG  209 (240)
T ss_dssp             HTCCEEEE----ESCHHHHHHHCS---------------EEEEEETTEEEEEE
T ss_pred             cCCeEEEE----eCCHHHHHHhCC---------------EEEEEECCEEEEEe
Confidence             8888766    476665555553               66677777665443

PyMOL of d2onka1

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}	Back information, alignment and structure

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}	Back information, alignment and structure

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}	Back information, alignment and structure

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}	Back information, alignment and structure

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}	Back information, alignment and structure

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}	Back information, alignment and structure

>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}	Back information, alignment and structure

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]}	Back information, alignment and structure

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}	Back information, alignment and structure

>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}	Back information, alignment and structure

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}	Back information, alignment and structure

>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]}	Back information, alignment and structure

>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}	Back information, alignment and structure

>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}	Back information, alignment and structure

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure