Citrus Sinensis ID: 024465
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 267 | ||||||
| 449446279 | 287 | PREDICTED: unknown protein DS12 from 2D- | 0.973 | 0.905 | 0.753 | 1e-114 | |
| 449494163 | 283 | PREDICTED: unknown protein DS12 from 2D- | 0.958 | 0.904 | 0.746 | 1e-112 | |
| 224110178 | 217 | predicted protein [Populus trichocarpa] | 0.812 | 1.0 | 0.917 | 1e-110 | |
| 224097618 | 218 | predicted protein [Populus trichocarpa] | 0.816 | 1.0 | 0.899 | 1e-110 | |
| 388495334 | 282 | unknown [Lotus japonicus] | 0.891 | 0.843 | 0.820 | 1e-108 | |
| 21592963 | 301 | unknown [Arabidopsis thaliana] | 0.970 | 0.860 | 0.754 | 1e-107 | |
| 15238305 | 301 | ACT domain-containing protein [Arabidops | 0.970 | 0.860 | 0.754 | 1e-107 | |
| 255560331 | 214 | amino acid binding protein, putative [Ri | 0.797 | 0.995 | 0.897 | 1e-107 | |
| 356575488 | 282 | PREDICTED: unknown protein DS12 from 2D- | 0.966 | 0.914 | 0.759 | 1e-107 | |
| 359486976 | 280 | PREDICTED: unknown protein DS12 from 2D- | 0.932 | 0.889 | 0.784 | 1e-106 |
| >gi|449446279|ref|XP_004140899.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 416 bits (1069), Expect = e-114, Method: Compositional matrix adjust.
Identities = 208/276 (75%), Positives = 233/276 (84%), Gaps = 16/276 (5%)
Query: 6 SLTSPADFTNKEFVFREKIFLQ--------------LLSRNILFASVNGTNAVSPTPLKS 51
S TSP+ F + F + LL NIL AS NG NAVSP L
Sbjct: 14 SYTSPSPFPCRSRFFEPEFVAHVPHRCFGGGARLAFLLKWNILSASTNGLNAVSPASLMF 73
Query: 52 DQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGS 111
DQD+ +PMP VLIDQDS+S+ATIV++SFGDRLGALIDTM ALKDLGLDVAKGTV+TEGS
Sbjct: 74 DQDS--VPMPIVLIDQDSDSNATIVEVSFGDRLGALIDTMRALKDLGLDVAKGTVSTEGS 131
Query: 112 VKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKL 171
VKQTKF++TRLD+GRKVEDPDLLE IRLTIINNLLKYHPESS+QLAMGEAFGI+ PEKKL
Sbjct: 132 VKQTKFYLTRLDSGRKVEDPDLLESIRLTIINNLLKYHPESSQQLAMGEAFGIQPPEKKL 191
Query: 172 DVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDK 231
DVDIATH+HVK DGPKRSLLY+ETADRPGLL+E++K++AD+N+DVESAEIDTEGLVAKDK
Sbjct: 192 DVDIATHVHVKADGPKRSLLYLETADRPGLLLEVIKMLADINIDVESAEIDTEGLVAKDK 251
Query: 232 FHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY 267
FHVSYGGAALNSSLSQV+VNCLRYYLRRPETDIDSY
Sbjct: 252 FHVSYGGAALNSSLSQVVVNCLRYYLRRPETDIDSY 287
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449494163|ref|XP_004159466.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224110178|ref|XP_002315438.1| predicted protein [Populus trichocarpa] gi|222864478|gb|EEF01609.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224097618|ref|XP_002311013.1| predicted protein [Populus trichocarpa] gi|222850833|gb|EEE88380.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388495334|gb|AFK35733.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|21592963|gb|AAM64912.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15238305|ref|NP_196094.1| ACT domain-containing protein [Arabidopsis thaliana] gi|7413536|emb|CAB86016.1| putative protein [Arabidopsis thaliana] gi|9758449|dbj|BAB08978.1| unnamed protein product [Arabidopsis thaliana] gi|18252933|gb|AAL62393.1| putative protein [Arabidopsis thaliana] gi|21389645|gb|AAM48021.1| putative protein [Arabidopsis thaliana] gi|332003394|gb|AED90777.1| ACT domain-containing protein [Arabidopsis thaliana] gi|347949480|gb|AEP31953.1| ACT domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255560331|ref|XP_002521182.1| amino acid binding protein, putative [Ricinus communis] gi|223539629|gb|EEF41213.1| amino acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356575488|ref|XP_003555872.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359486976|ref|XP_002268975.2| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 267 | ||||||
| TAIR|locus:2175458 | 301 | ACR12 "ACT domain repeats 12" | 0.970 | 0.860 | 0.754 | 8.2e-99 | |
| TAIR|locus:2015616 | 290 | ACR11 "ACT domain repeats 11" | 0.940 | 0.865 | 0.592 | 1.6e-72 | |
| TAIR|locus:2044289 | 456 | ACR5 "ACT domain repeat 5" [Ar | 0.299 | 0.175 | 0.296 | 5e-09 | |
| TAIR|locus:2033223 | 455 | ACR4 "ACT domain repeat 4" [Ar | 0.299 | 0.175 | 0.308 | 4.6e-08 | |
| TAIR|locus:2132609 | 449 | ACR7 "ACT domain repeat 7" [Ar | 0.303 | 0.180 | 0.268 | 2e-07 | |
| TAIR|locus:2078678 | 433 | ACR6 "ACT domain repeat 6" [Ar | 0.310 | 0.191 | 0.285 | 6.5e-07 | |
| TAIR|locus:2034630 | 441 | ACR8 "AT1G12420" [Arabidopsis | 0.299 | 0.181 | 0.333 | 1.8e-06 | |
| TAIR|locus:2152094 | 477 | ACR1 "ACT domain repeat 1" [Ar | 0.310 | 0.174 | 0.273 | 3.7e-06 | |
| TAIR|locus:2025317 | 453 | ACR3 "ACT domain repeat 3" [Ar | 0.415 | 0.245 | 0.243 | 1e-05 | |
| TIGR_CMR|SPO_0397 | 908 | SPO_0397 "protein-P-II uridyly | 0.614 | 0.180 | 0.285 | 0.00012 |
| TAIR|locus:2175458 ACR12 "ACT domain repeats 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 981 (350.4 bits), Expect = 8.2e-99, P = 8.2e-99
Identities = 197/261 (75%), Positives = 226/261 (86%)
Query: 9 SPADFTNK-EFVFREKIFLQLLSRNILFASVNGTN-AVSPTPLKSDQDADYIPMPHVLID 66
SPA F ++ +FV L +N ++AS+N + A +P+ KS+ D D +PMP V+ID
Sbjct: 41 SPALFDDRRKFVGGVMSLLTKSIKNRVYASINSIDSAATPSYPKSEDDDDVVPMPMVMID 100
Query: 67 QDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGR 126
QD++ +ATIVQLSFG+RLGALIDTM ALKDLGLDV KGTV+TEGS+KQTKF IT+ DTGR
Sbjct: 101 QDADPEATIVQLSFGNRLGALIDTMRALKDLGLDVIKGTVSTEGSIKQTKFSITKRDTGR 160
Query: 127 KVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGP 186
KVEDPDLLE+IRLTIINNLLKYHPE SEQLAMGE FGIKAPEKK+DVDIATHIHVKEDGP
Sbjct: 161 KVEDPDLLEQIRLTIINNLLKYHPECSEQLAMGETFGIKAPEKKIDVDIATHIHVKEDGP 220
Query: 187 KRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLS 246
KRSLL IETADRPGL+VE++K++ADVN+DVESAEIDTEGLVAKDKFHVSY G ALN SLS
Sbjct: 221 KRSLLVIETADRPGLVVEMIKVMADVNIDVESAEIDTEGLVAKDKFHVSYQGQALNRSLS 280
Query: 247 QVLVNCLRYYLRRPETDIDSY 267
QVLVNCLRY+LRRPETDIDSY
Sbjct: 281 QVLVNCLRYFLRRPETDIDSY 301
|
|
| TAIR|locus:2015616 ACR11 "ACT domain repeats 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044289 ACR5 "ACT domain repeat 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132609 ACR7 "ACT domain repeat 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034630 ACR8 "AT1G12420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152094 ACR1 "ACT domain repeat 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025317 ACR3 "ACT domain repeat 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0397 SPO_0397 "protein-P-II uridylyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.X.3434.1 | hypothetical protein (217 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 267 | |||
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 7e-08 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 3e-07 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 1e-06 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 1e-06 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 8e-06 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 1e-04 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 2e-04 | |
| PRK03059 | 856 | PRK03059, PRK03059, PII uridylyl-transferase; Prov | 2e-04 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 4e-04 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 0.001 | |
| cd04876 | 71 | cd04876, ACT_RelA-SpoT, ACT domain found C-termina | 0.001 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 0.003 | |
| pfam13291 | 77 | pfam13291, ACT_4, ACT domain | 0.003 |
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
Score = 52.8 bits (127), Expect = 7e-08
Identities = 46/200 (23%), Positives = 74/200 (37%), Gaps = 11/200 (5%)
Query: 54 DADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNT-EGSV 112
A P LID S T V + D+ G AL L L V VNT + V
Sbjct: 649 RALSSGGPLALIDGTRPSGGTEVFIYAPDQPGLFAKVAGALAMLSLSVHDAQVNTTKDGV 708
Query: 113 KQTKFFITRLDTGRKVEDPDLLERIRLT--IINNLLKYHPESSEQLAMGEAFGIKAPEKK 170
F + L + E ++ ++ L K + ++
Sbjct: 709 ALDTFVVQDLFGSPPAAERVFQELLQGLVDVLAGLAKDPD--TISARRARRRRLQHFAVP 766
Query: 171 LDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKD 230
V I K +++ + DRPGLL + + + ++ + ++SA+I T G A+D
Sbjct: 767 PRVTILNTA-----SRKATIMEVRALDRPGLLARVGRTLEELGLSIQSAKITTFGEKAED 821
Query: 231 KFHVS-YGGAALNSSLSQVL 249
F+V+ G L Q L
Sbjct: 822 VFYVTDLFGLKLTDEEEQRL 841
|
This model describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for the nitrogen regulatory protein PII. Not all homologs of PII share the property of uridylyltransferase modification on the characteristic Tyr residue (see Prosite pattern PS00496 and document PDOC00439), but the modification site is preserved in the PII homolog of all species with a member of this family [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, Protein interactions]. Length = 850 |
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235101 PRK03059, PRK03059, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222030 pfam13291, ACT_4, ACT domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 267 | |||
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 100.0 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 100.0 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.97 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.97 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.96 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.96 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.96 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.95 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.95 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.84 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.82 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.81 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.81 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.68 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.61 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.61 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.61 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.61 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.6 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.6 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.57 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.54 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.4 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.38 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.37 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.36 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.35 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.32 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.32 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.32 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.3 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.28 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.26 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.25 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.24 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.22 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.18 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.05 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 99.03 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 99.02 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 98.94 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.63 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.54 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.5 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.43 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.42 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.28 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.27 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 98.26 | |
| PRK00194 | 90 | hypothetical protein; Validated | 98.06 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 98.06 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.02 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 98.01 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 98.0 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 97.98 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 97.98 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.97 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 97.91 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.9 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.87 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 97.81 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.73 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 97.62 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.58 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.58 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 97.51 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.46 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.42 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.42 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.41 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.38 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.3 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 97.29 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.25 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 97.25 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.24 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.2 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.19 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.16 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.14 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 97.12 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 97.08 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.06 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 97.06 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 97.05 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.03 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 97.01 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 97.0 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.0 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 96.98 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.95 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.94 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 96.93 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.92 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 96.91 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 96.86 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.85 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.85 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 96.84 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 96.83 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 96.8 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 96.78 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.76 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 96.71 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 96.66 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.64 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 96.62 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 96.6 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.58 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 96.57 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 96.57 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 96.57 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.57 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.53 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 96.52 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 96.43 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.35 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.34 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 96.32 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.32 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.31 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.24 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 96.23 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 96.22 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.21 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 96.19 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 96.1 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 96.04 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.03 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.01 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 96.01 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.96 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 95.95 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 95.92 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 95.89 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 95.81 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 95.78 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 95.7 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 95.67 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 95.56 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 95.38 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 95.36 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 95.34 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 95.31 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 95.27 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 95.22 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 95.16 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 95.06 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 95.05 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 95.01 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 94.96 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 94.93 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 94.89 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 94.72 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 94.68 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 94.59 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 94.47 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 94.45 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 94.42 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 94.37 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 94.35 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 93.81 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 93.59 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 93.37 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 93.29 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 93.22 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 93.18 | |
| PLN02551 | 521 | aspartokinase | 93.03 | |
| PRK09181 | 475 | aspartate kinase; Validated | 92.91 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 92.83 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 92.76 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 92.76 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 92.6 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 92.37 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 92.15 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 91.98 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 91.74 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 91.49 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 91.24 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 91.23 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 91.2 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 90.96 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 90.78 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 90.66 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 90.26 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 90.26 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 90.24 | |
| PRK11898 | 283 | prephenate dehydratase; Provisional | 89.76 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 89.63 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 89.49 | |
| PLN02317 | 382 | arogenate dehydratase | 89.34 | |
| TIGR01268 | 436 | Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra | 89.08 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 88.91 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 88.74 | |
| TIGR01270 | 464 | Trp_5_monoox tryptophan 5-monooxygenase, tetrameri | 88.6 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 88.47 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 88.27 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 88.22 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 88.1 | |
| PRK14646 | 155 | hypothetical protein; Provisional | 87.35 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 86.71 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 86.4 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 86.21 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 86.13 | |
| PRK09224 | 504 | threonine dehydratase; Reviewed | 86.03 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 86.03 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 85.72 | |
| PRK14634 | 155 | hypothetical protein; Provisional | 84.0 | |
| PRK14636 | 176 | hypothetical protein; Provisional | 83.77 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 83.65 | |
| PRK14640 | 152 | hypothetical protein; Provisional | 83.61 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 83.38 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 82.78 | |
| cd04935 | 75 | ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK | 82.77 | |
| PLN02550 | 591 | threonine dehydratase | 82.13 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 81.99 | |
| PRK14647 | 159 | hypothetical protein; Provisional | 81.94 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 81.67 | |
| PRK14645 | 154 | hypothetical protein; Provisional | 81.49 | |
| PRK00092 | 154 | ribosome maturation protein RimP; Reviewed | 81.34 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 81.08 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 80.66 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 80.58 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 80.15 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 80.14 |
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-32 Score=282.72 Aligned_cols=191 Identities=24% Similarity=0.286 Sum_probs=168.6
Q ss_pred CCCEEEEeecCCCCeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEcCCee-EEEEEEEeCCCCCCCCChHHHHHH
Q 024465 59 PMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVK-QTKFFITRLDTGRKVEDPDLLERI 137 (267)
Q Consensus 59 ~~p~V~i~~~~~~~~t~V~V~~~DRpGLL~di~~~L~~~~lnI~~A~I~T~~~~~-~d~F~I~~~~~g~~l~~~~~~erl 137 (267)
.+|.|.++++.+.++++|+|+++||||||++||++|+.+|+||++|+|+|.++|. +|+|+|++. +|.++ +++++++|
T Consensus 687 ~~p~V~i~~~~~~~~t~V~V~a~DrpGLfa~Ia~~La~~~L~I~~A~I~T~~dg~alD~F~V~d~-~g~~~-~~~~~~~I 764 (884)
T PRK05007 687 DKPLVLLSKQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTSRDGMAMDTFIVLEP-DGSPL-SQDRHQVI 764 (884)
T ss_pred CCCeEEEEecCCCCeEEEEEEecCCcCHHHHHHHHHHHCCCEEEEEEEEEcCCCeEEEEEEEECC-CCCCC-CHHHHHHH
Confidence 5788999999999999999999999999999999999999999999999999855 699999997 88888 46789999
Q ss_pred HHHHHHHhhccCCCchhHhhhccccCccCCCcccccccceeEEeccCCCC-eEEEEEEeCCcccHHHHHHHHHHhCCccE
Q 024465 138 RLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPK-RSLLYIETADRPGLLVEIMKIIADVNVDV 216 (267)
Q Consensus 138 ~~~L~~~L~~~~~~~~~~la~~~~~~~~~~~r~~~~~~~~~V~i~~~~s~-~t~l~i~~~DRpGLL~~Itr~l~~~gl~I 216 (267)
+++|.++|.+.... .. . .+ +.+++.+.+..+++|.|+++.+. +|+|+|.|.||||||++|+++|.++|++|
T Consensus 765 ~~~L~~aL~~~~~~-~~-~----~~--~~~~~~~~~~~~~~V~~d~~~s~~~TvlEV~a~DRpGLL~~I~~~l~~~~l~I 836 (884)
T PRK05007 765 RKALEQALTQSSPQ-PP-K----PR--RLPAKLRHFNVPTEVSFLPTHTDRRSYMELIALDQPGLLARVGKIFADLGISL 836 (884)
T ss_pred HHHHHHHHcCCCCC-cc-c----cc--ccccccCCCCCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHHHCCcEE
Confidence 99999999763211 11 1 11 12345667889999999998865 99999999999999999999999999999
Q ss_pred EEEEEEecCCeeeeEEEEEe-CCCCCChHHHHHHHHHHHHHcCC
Q 024465 217 ESAEIDTEGLVAKDKFHVSY-GGAALNSSLSQVLVNCLRYYLRR 259 (267)
Q Consensus 217 ~~a~i~T~g~~a~d~F~v~d-~G~~l~~~~~~~L~~~L~~~l~~ 259 (267)
++|+|+|.|++|+|+|||++ +|.|++++.++.|+++|..+|+.
T Consensus 837 ~~AkI~T~gera~DvFyV~~~~g~~l~~~~~~~l~~~L~~~l~~ 880 (884)
T PRK05007 837 HGARITTIGERVEDLFILATADRRALNEELQQELRQRLTEALNP 880 (884)
T ss_pred EEEEEeccCceEEEEEEEEcCCCCcCCHHHHHHHHHHHHHHHhh
Confidence 99999999999999999999 99999977889999999999965
|
|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11898 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >PLN02317 arogenate dehydratase | Back alignment and domain information |
|---|
| >TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14646 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09224 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK14634 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14636 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK14640 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein | Back alignment and domain information |
|---|
| >PLN02550 threonine dehydratase | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK14647 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >PRK14645 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00092 ribosome maturation protein RimP; Reviewed | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 267 | |||
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 | Back alignment and structure |
|---|
Score = 41.1 bits (97), Expect = 2e-05
Identities = 5/45 (11%), Positives = 20/45 (44%)
Query: 191 LYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVS 235
+ I D+ G+ +I +I+ + ++ + ++ + + +
Sbjct: 8 IRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIF 52
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 267 | |||
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.8 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.76 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.9 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.56 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 98.22 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.18 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.1 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 98.03 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 98.0 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 97.78 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.63 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 97.34 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 97.27 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.26 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 97.22 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.19 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.17 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.14 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.05 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.04 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.99 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 96.99 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 96.96 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 96.95 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 96.86 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 96.83 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 96.73 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 96.73 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 96.6 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 96.48 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 96.43 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.32 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 96.24 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 96.21 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 95.87 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 95.47 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 95.19 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 95.06 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 94.97 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 94.35 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 94.12 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 93.92 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 93.65 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 93.65 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 93.3 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 93.09 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 91.79 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 90.83 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 88.92 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 88.34 | |
| 1phz_A | 429 | Protein (phenylalanine hydroxylase); aromatic amin | 87.8 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 87.48 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 87.26 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 85.86 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 84.18 |
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
Probab=99.80 E-value=8.4e-19 Score=150.59 Aligned_cols=156 Identities=14% Similarity=0.180 Sum_probs=113.4
Q ss_pred CeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEcCCeeEEEEEEEeCCCCCCCCChHHHHHHHHHHHHHhhccCCC
Q 024465 72 DATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPE 151 (267)
Q Consensus 72 ~~t~V~V~~~DRpGLL~di~~~L~~~~lnI~~A~I~T~~~~~~d~F~I~~~~~g~~l~~~~~~erl~~~L~~~L~~~~~~ 151 (267)
..++|+|+|+|||||++.|+++|+++|+||.+|++++..+++.-.|.+... +. ..+.++++|++.|...+.....
T Consensus 4 ~~~~ltv~~~DrpGiva~vs~~La~~g~NI~da~q~~~~~~f~m~~~v~~~--~~--~~~~~~~~l~~~L~~~~~~~~~- 78 (195)
T 2nyi_A 4 QSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAMIVLVSLN--AK--DGKLIQSALESALPGFQISTRR- 78 (195)
T ss_dssp EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEES--SS--SSHHHHHHHHHHSTTCEEEEEE-
T ss_pred eEEEEEEEeCCCCcHHHHHHHHHHHCCCCEEEEEeEEECCeEEEEEEEEec--Cc--cchhHHHHHHHHHHHHHHhcCC-
Confidence 457999999999999999999999999999999999999888667777653 21 2234567777775543321100
Q ss_pred chhHhhhccccCccCCCcccccccceeEEeccCCCCeEEEEEEeCCcccHHHHHHHHHHhCCccEEEEEEEecC--Ceee
Q 024465 152 SSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEG--LVAK 229 (267)
Q Consensus 152 ~~~~la~~~~~~~~~~~r~~~~~~~~~V~i~~~~s~~t~l~i~~~DRpGLL~~Itr~l~~~gl~I~~a~i~T~g--~~a~ 229 (267)
....+ . .+ .......++|+|.|+|||||+++|+++|+++|+||..++..|.+ +++.
T Consensus 79 -------------~~~~~--~---~~----~~~~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~ 136 (195)
T 2nyi_A 79 -------------ASSVA--E---RH----VSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGF 136 (195)
T ss_dssp -------------CCCC-------------CCTTEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTC
T ss_pred -------------eEEEE--e---CC----cCCCCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCC
Confidence 00001 0 01 12223478999999999999999999999999999999999998 7788
Q ss_pred eEEEEEe-CCCCCChHHHHHHHHHHHHH
Q 024465 230 DKFHVSY-GGAALNSSLSQVLVNCLRYY 256 (267)
Q Consensus 230 d~F~v~d-~G~~l~~~~~~~L~~~L~~~ 256 (267)
+.|+++. .+.+ .... +.|+++|...
T Consensus 137 ~~F~m~~~~~~~-~~~~-~~l~~~l~~~ 162 (195)
T 2nyi_A 137 TLFRMGSRVAFP-FPLY-QEVVTALSRV 162 (195)
T ss_dssp EEEEEEEEEEEE-GGGH-HHHHHHHHHH
T ss_pred CeEEEEEEEEcC-CCcc-HHHHHHHHHH
Confidence 9999986 4433 1224 6666666644
|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 267 | ||||
| d1y7pa2 | 77 | d.58.18.12 (A:2-78) Hypothetical protein AF1403, N | 0.004 |
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: AF1403 N-terminal domain-like domain: Hypothetical protein AF1403, N-terminal domain species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Score = 33.2 bits (76), Expect = 0.004
Identities = 8/33 (24%), Positives = 17/33 (51%)
Query: 191 LYIETADRPGLLVEIMKIIADVNVDVESAEIDT 223
L I ++ G+L ++ IIA+ ++ A+
Sbjct: 4 LRIIAENKIGVLRDLTTIIAEEGGNITFAQTFL 36
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 267 | |||
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.7 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.51 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.5 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.32 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 98.15 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 98.04 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 97.9 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.77 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.62 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.6 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.52 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.49 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.45 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.37 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.21 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.18 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 97.06 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 96.97 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 96.94 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 96.93 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 96.78 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 96.73 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 96.7 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 96.45 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 92.54 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 92.07 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 87.78 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 86.1 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 84.03 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 81.89 |
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: Glycine cleavage system transcriptional repressor domain: putative transcriptional repressor VC2159 species: Vibrio cholerae [TaxId: 666]
Probab=98.70 E-value=7.9e-08 Score=69.87 Aligned_cols=64 Identities=14% Similarity=0.205 Sum_probs=53.7
Q ss_pred CeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEcCCeeEEEEEEEeCCCCCCCCChHHHHHHHHHHHH
Q 024465 72 DATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIIN 143 (267)
Q Consensus 72 ~~t~V~V~~~DRpGLL~di~~~L~~~~lnI~~A~I~T~~~~~~d~F~I~~~~~g~~l~~~~~~erl~~~L~~ 143 (267)
.+.+|+|.|+||||++++++++|+++|+||.+++..+.++.+.-.+.|.- . ++.+++|+..|..
T Consensus 4 ~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~~----~----~~~~~~l~~~L~~ 67 (86)
T d1u8sa1 4 QHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISG----S----PSNITRVETTLPL 67 (86)
T ss_dssp EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEE----C----HHHHHHHHHHHHH
T ss_pred cEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEEc----C----cccHHHHHHHHHH
Confidence 57899999999999999999999999999999999999998876566643 1 3456777777665
|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|