Citrus Sinensis ID: 024699
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| 225423975 | 265 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.996 | 0.713 | 2e-93 | |
| 449446201 | 261 | PREDICTED: uncharacterized protein LOC10 | 0.973 | 0.984 | 0.651 | 6e-89 | |
| 358344687 | 283 | hypothetical protein MTR_040s0047 [Medic | 0.928 | 0.865 | 0.476 | 2e-56 | |
| 147810266 | 279 | hypothetical protein VITISV_027853 [Viti | 0.973 | 0.921 | 0.482 | 4e-56 | |
| 359482838 | 282 | PREDICTED: uncharacterized protein LOC10 | 0.977 | 0.914 | 0.475 | 9e-56 | |
| 357454679 | 271 | hypothetical protein MTR_2g100240 [Medic | 0.867 | 0.845 | 0.482 | 2e-55 | |
| 356556722 | 286 | PREDICTED: uncharacterized protein LOC10 | 0.837 | 0.772 | 0.502 | 3e-53 | |
| 307136246 | 175 | hypothetical protein [Cucumis melo subsp | 0.662 | 1.0 | 0.634 | 1e-52 | |
| 148909320 | 288 | unknown [Picea sitchensis] gi|224286475| | 0.954 | 0.875 | 0.446 | 9e-51 | |
| 363806838 | 285 | uncharacterized protein LOC100787621 [Gl | 0.821 | 0.761 | 0.486 | 2e-50 |
| >gi|225423975|ref|XP_002282562.1| PREDICTED: uncharacterized protein LOC100242187 isoform 1 [Vitis vinifera] gi|147801663|emb|CAN76874.1| hypothetical protein VITISV_007099 [Vitis vinifera] gi|297737820|emb|CBI27021.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 348 bits (892), Expect = 2e-93, Method: Compositional matrix adjust.
Identities = 189/265 (71%), Positives = 221/265 (83%), Gaps = 1/265 (0%)
Query: 1 MAARNHISRHPDSARGFRDGPRPVLTRGLAPMHFHPMTLEEEIEIQRREMHRIISENRHA 60
MA RN + R+P+ RGFRDGP PVL RG P+ HP+ +EEE+E+Q RE+ RI++ENRH
Sbjct: 1 MAGRNRMPRNPNGFRGFRDGPPPVLNRGPGPLPLHPVAMEEELELQHRELQRIVAENRHV 60
Query: 61 IDDNTHLQRELTASKDEIHRLGQIIPKLRADKEAHTRELFDRGLKLEVELRASEPVRAEV 120
IDDNT LQ EL A+KD+IHRLGQIIPKLRAD+E REL DRGLKLE +LRA EP+R EV
Sbjct: 61 IDDNTMLQSELAAAKDDIHRLGQIIPKLRADREVQARELIDRGLKLEADLRAVEPLRTEV 120
Query: 121 VQLRAEVQKLNSSRQELTTQIKGLTKDVNRLEAENKQLIAMRADIDGIRSELVEARRAFE 180
+QLRAE QKLN+SRQ+L+ Q++GLT+DV RL+AEN+QLIAMRADID +R EL EARRAFE
Sbjct: 121 IQLRAEAQKLNASRQDLSAQVQGLTQDVARLQAENQQLIAMRADIDRMRKELAEARRAFE 180
Query: 181 FEKKANEEQIEQKQAMENNLISMAREIEKLRAELLNTERRA-CGLGGSAYGLLNGCPDMR 239
+EKKANEEQ+EQKQAME NLISMAREIEKLRA+ LNT+RRA GG YGLLNG P+MR
Sbjct: 181 YEKKANEEQLEQKQAMEKNLISMAREIEKLRADQLNTDRRARGLGGGGGYGLLNGSPEMR 240
Query: 240 YPGGAFDNGYGGAWGHYDKHGPPRR 264
YPGGAF +GYGG WG YDK GPPRR
Sbjct: 241 YPGGAFGDGYGGVWGPYDKRGPPRR 265
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449446201|ref|XP_004140860.1| PREDICTED: uncharacterized protein LOC101218774 [Cucumis sativus] gi|449512724|ref|XP_004164125.1| PREDICTED: uncharacterized protein LOC101226085 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|358344687|ref|XP_003636419.1| hypothetical protein MTR_040s0047 [Medicago truncatula] gi|355502354|gb|AES83557.1| hypothetical protein MTR_040s0047 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147810266|emb|CAN71449.1| hypothetical protein VITISV_027853 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359482838|ref|XP_002278937.2| PREDICTED: uncharacterized protein LOC100253153 [Vitis vinifera] gi|297743072|emb|CBI35939.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357454679|ref|XP_003597620.1| hypothetical protein MTR_2g100240 [Medicago truncatula] gi|124360403|gb|ABN08416.1| Protein kinase PKN/PRK1, effector [Medicago truncatula] gi|355486668|gb|AES67871.1| hypothetical protein MTR_2g100240 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356556722|ref|XP_003546672.1| PREDICTED: uncharacterized protein LOC100809038 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|307136246|gb|ADN34079.1| hypothetical protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|148909320|gb|ABR17759.1| unknown [Picea sitchensis] gi|224286475|gb|ACN40944.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|363806838|ref|NP_001242546.1| uncharacterized protein LOC100787621 [Glycine max] gi|255645257|gb|ACU23126.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| TAIR|locus:2035751 | 283 | AT1G55170 "AT1G55170" [Arabido | 0.977 | 0.911 | 0.413 | 2.8e-43 | |
| TAIR|locus:2089616 | 331 | AT3G14750 "AT3G14750" [Arabido | 0.943 | 0.752 | 0.339 | 1.9e-35 | |
| TAIR|locus:2033681 | 359 | AT1G67170 "AT1G67170" [Arabido | 0.886 | 0.651 | 0.313 | 1.7e-27 | |
| TAIR|locus:2060848 | 288 | AT2G30120 [Arabidopsis thalian | 0.825 | 0.756 | 0.301 | 1.8e-25 | |
| TAIR|locus:2156146 | 238 | AT5G61920 "AT5G61920" [Arabido | 0.791 | 0.878 | 0.285 | 1.2e-19 | |
| UNIPROTKB|Q3A9A0 | 155 | CHY_2490 "Conserved domain pro | 0.371 | 0.632 | 0.284 | 2.6e-07 | |
| TIGR_CMR|CHY_2490 | 155 | CHY_2490 "conserved domain pro | 0.371 | 0.632 | 0.284 | 2.6e-07 | |
| UNIPROTKB|Q6V4L1 | 398 | Q6V4L1 "M protein" [Streptococ | 0.655 | 0.434 | 0.263 | 6.5e-07 | |
| UNIPROTKB|Q6V4L4 | 397 | Q6V4L4 "M protein" [Streptococ | 0.659 | 0.438 | 0.256 | 8.4e-07 | |
| UNIPROTKB|Q6V4L9 | 391 | Q6V4L9 "M protein" [Streptococ | 0.659 | 0.445 | 0.256 | 1.1e-06 |
| TAIR|locus:2035751 AT1G55170 "AT1G55170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 457 (165.9 bits), Expect = 2.8e-43, P = 2.8e-43
Identities = 113/273 (41%), Positives = 165/273 (60%)
Query: 1 MAARNHISRH-PDSARGFRDGP--RPVLTRGLAPMHFHPMTLEEEIEIQ----RR---EM 50
M+ RN I R DS RD P RP L RG + P +L E+++IQ RR E+
Sbjct: 1 MSGRNRIHRDIRDSYHDHRDLPPERPFL-RGPPLLQPPPPSLLEDLQIQEGEIRRQDAEI 59
Query: 51 HRIISENRHAIDDNTHLQRELTASKDEIHRLGQIIPKLRADKEAHTRELFDRGLKLEVEL 110
R++S+N DD L+REL A+K+E+HR+ +I LRA+++ RE ++ KLE ++
Sbjct: 60 RRLLSDNHGLADDRMVLERELVAAKEELHRMNLMISDLRAEQDLQLREFSEKRHKLEGDV 119
Query: 111 RASEPVRAEVVQLRAEVQKLNSSRQELTTQIKGLTKDVNRLEAENKQLIAMRADIDGIRS 170
RA E + E QLR EVQKL+ ++EL+ ++ L KD+ +L+++NKQ+ MRA++ ++
Sbjct: 120 RAMESYKKEASQLRGEVQKLDEIKRELSGNVQLLRKDLAKLQSDNKQIPGMRAEVKDLQK 179
Query: 171 ELVEARRAFEFEKKANEEQIEQKQAMENNLISMAREIEKLRAELLNTERRACGLGGSAYG 230
EL+ AR A E+EKK E +EQ+Q ME N++SMARE+EKLRAEL + R G GGS YG
Sbjct: 180 ELMHARDAIEYEKKEKFELMEQRQTMEKNMVSMAREVEKLRAELATVDSRPWGFGGS-YG 238
Query: 231 LLNGCPDMRYPGGAFDNG-YGGAW--GHYDKHG 260
+ D + G +N Y G+ Y HG
Sbjct: 239 MNYNNMDGTFRGSYGENDTYLGSSERSQYYSHG 271
|
|
| TAIR|locus:2089616 AT3G14750 "AT3G14750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033681 AT1G67170 "AT1G67170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2060848 AT2G30120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156146 AT5G61920 "AT5G61920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3A9A0 CHY_2490 "Conserved domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_2490 CHY_2490 "conserved domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6V4L1 Q6V4L1 "M protein" [Streptococcus pyogenes (taxid:1314)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6V4L4 Q6V4L4 "M protein" [Streptococcus pyogenes (taxid:1314)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6V4L9 Q6V4L9 "M protein" [Streptococcus pyogenes (taxid:1314)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00030337001 | SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (227 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 5e-04 | |
| pfam05483 | 787 | pfam05483, SCP-1, Synaptonemal complex protein 1 ( | 7e-04 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 8e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 8e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| pfam07106 | 169 | pfam07106, TBPIP, Tat binding protein 1(TBP-1)-int | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.003 | |
| pfam04977 | 80 | pfam04977, DivIC, Septum formation initiator | 0.004 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 55.9 bits (135), Expect = 6e-09
Identities = 39/190 (20%), Positives = 80/190 (42%), Gaps = 10/190 (5%)
Query: 39 LEEEIEIQRREMHRIISENRHAIDDNTHLQRELTASKDEIHRLGQIIPKLRADKEAHTRE 98
L ++E R++ + E ++ LQ L ++E+ L + + +L+ E E
Sbjct: 707 LRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEE 766
Query: 99 L---FDRGLKLEVELRASEPVRAEVVQLRAEVQK----LNSSRQELTTQIKGLTKDVNRL 151
L + KL+ E+ E R + + E+++ L +++ L + RL
Sbjct: 767 LESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERL 826
Query: 152 EAENKQLIAMRADIDGIRSELVEARRAFEFEKKANEEQIEQKQAMENNLISMAREIEKLR 211
E E ++L +++ EL E E E + +E++E+ +A + L E+++L
Sbjct: 827 EQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELED---ELKELE 883
Query: 212 AELLNTERRA 221
E E
Sbjct: 884 EEKEELEEEL 893
|
Length = 1163 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|114219 pfam05483, SCP-1, Synaptonemal complex protein 1 (SCP-1) | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|148614 pfam07106, TBPIP, Tat binding protein 1(TBP-1)-interacting protein (TBPIP) | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|203138 pfam04977, DivIC, Septum formation initiator | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.68 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.66 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.57 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.57 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.55 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.11 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.08 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.04 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.01 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.99 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.94 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.87 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.76 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 96.75 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.75 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.73 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.67 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.66 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 96.53 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.52 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.5 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.47 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.47 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.42 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.37 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.34 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.32 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.31 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.26 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.25 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.22 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.19 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.18 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.16 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.07 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.72 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.71 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 95.65 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 95.53 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 95.52 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.47 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.39 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.38 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 95.34 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 95.31 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.29 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.28 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 95.16 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.06 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 95.05 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 94.88 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 94.86 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.84 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.83 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.7 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 94.67 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 94.61 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.59 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 94.53 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 94.53 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.25 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 94.25 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 94.1 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 94.08 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 94.0 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 93.95 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 93.94 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 93.8 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.78 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 93.78 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 93.77 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 93.65 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 93.61 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 93.6 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 93.58 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 93.58 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 93.49 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 93.36 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 93.32 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 93.31 | |
| PRK09039 | 343 | hypothetical protein; Validated | 93.3 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 93.28 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.22 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 93.17 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 93.15 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.06 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 93.04 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 92.95 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 92.92 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 92.76 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.76 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 92.69 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 92.62 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 92.61 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 92.56 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 92.56 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 92.5 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 92.32 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 92.25 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 91.97 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 91.93 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 91.9 | |
| PF13514 | 1111 | AAA_27: AAA domain | 91.82 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 91.78 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 91.68 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 91.64 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 91.6 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 91.58 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 91.56 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 91.55 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 91.51 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 91.46 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 91.34 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 91.14 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 91.06 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 90.95 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 90.9 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 90.89 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 90.74 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 90.72 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 90.7 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 90.57 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 90.54 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 90.49 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 90.48 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 90.45 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 90.4 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 90.35 | |
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 90.27 | |
| PRK11546 | 143 | zraP zinc resistance protein; Provisional | 90.03 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 89.98 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 89.91 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 89.85 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 89.71 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 89.64 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 89.63 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 89.58 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 89.48 | |
| cd00890 | 129 | Prefoldin Prefoldin is a hexameric molecular chape | 89.41 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 89.24 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 89.17 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 89.03 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 88.75 | |
| KOG3478 | 120 | consensus Prefoldin subunit 6, KE2 family [Posttra | 88.69 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 88.43 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 88.42 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 88.29 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.17 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 88.16 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 88.1 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 87.83 | |
| KOG0993 | 542 | consensus Rab5 GTPase effector Rabaptin-5 [Intrace | 87.74 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 87.56 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 87.48 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 87.44 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 87.35 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 87.21 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 87.2 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 87.19 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 87.17 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 87.14 | |
| PF08776 | 40 | VASP_tetra: VASP tetramerisation domain; InterPro: | 86.89 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 86.8 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 86.76 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 86.55 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 86.52 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 86.46 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 86.41 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 86.12 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 85.85 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 85.82 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 85.62 | |
| KOG3433 | 203 | consensus Protein involved in meiotic recombinatio | 85.55 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 85.54 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 85.48 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 85.21 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 85.16 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 85.12 | |
| PF05837 | 106 | CENP-H: Centromere protein H (CENP-H); InterPro: I | 85.05 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 84.97 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 84.77 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 84.65 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 84.65 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 84.57 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 84.56 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 84.5 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 84.39 | |
| PF12592 | 57 | DUF3763: Protein of unknown function (DUF3763); In | 84.37 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 84.36 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 84.23 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 84.15 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 83.91 | |
| PF07794 | 790 | DUF1633: Protein of unknown function (DUF1633); In | 83.83 | |
| PF07139 | 302 | DUF1387: Protein of unknown function (DUF1387); In | 83.67 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 83.41 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 83.08 | |
| PF04626 | 132 | DEC-1_C: Dec-1 protein, C terminal region; InterPr | 82.87 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 82.52 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 82.46 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 81.97 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 81.94 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 81.82 | |
| PF08912 | 69 | Rho_Binding: Rho Binding; InterPro: IPR015008 Rho | 81.8 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 81.68 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 81.62 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 81.54 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 81.39 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 81.33 | |
| TIGR02473 | 141 | flagell_FliJ flagellar export protein FliJ. Member | 81.29 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 81.27 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 81.2 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 81.19 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 81.02 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 80.99 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 80.93 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 80.87 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 80.81 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 80.79 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 80.77 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 80.41 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 80.02 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 80.02 |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Probab=97.68 E-value=0.0092 Score=62.51 Aligned_cols=24 Identities=21% Similarity=0.335 Sum_probs=10.2
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHhh
Q 024699 193 KQAMENNLISMAREIEKLRAELLN 216 (264)
Q Consensus 193 ~qaMEknlismarEvEKLRaElan 216 (264)
...+.+++-.+..++.+++.++..
T Consensus 471 l~~~~~~l~~l~~~l~~l~~~~~~ 494 (1164)
T TIGR02169 471 LYDLKEEYDRVEKELSKLQRELAE 494 (1164)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHH
Confidence 333333444444444444444443
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. |
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >PRK11546 zraP zinc resistance protein; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF08776 VASP_tetra: VASP tetramerisation domain; InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF12592 DUF3763: Protein of unknown function (DUF3763); InterPro: IPR022547 This domain is found in bacterial regulartory ATPases 3 | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF07794 DUF1633: Protein of unknown function (DUF1633); InterPro: IPR012436 This family contains sequences derived from a group of hypothetical proteins expressed by Arabidopsis thaliana (Mouse-ear cress) | Back alignment and domain information |
|---|
| >PF07139 DUF1387: Protein of unknown function (DUF1387); InterPro: IPR009816 This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04626 DEC-1_C: Dec-1 protein, C terminal region; InterPro: IPR006720 The defective chorion-1 gene (dec-1) in Drosophila encodes follicle cell proteins necessary for proper eggshell assembly | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08912 Rho_Binding: Rho Binding; InterPro: IPR015008 Rho is responsible for the recognition and binding of Rho binding domain-containing proteins (such as ROCK) to Rho, resulting in activation of the GTPase which in turn modulates the phosphorylation of various signalling proteins | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >TIGR02473 flagell_FliJ flagellar export protein FliJ | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 8e-05 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 9e-05 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 62.2 bits (151), Expect = 3e-11
Identities = 30/187 (16%), Positives = 76/187 (40%), Gaps = 3/187 (1%)
Query: 39 LEEEIEIQRREMHRIISENRHAIDDNTHLQRELTASKDEIHRLGQIIPKLRADKEAHTRE 98
+++++ ++ + + + ++ +D+I + KL +++
Sbjct: 953 MQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEER 1012
Query: 99 LFDRGLKLEVELRASEPVRAEVVQLRAEVQKLNSSRQELTTQIKGLTKDVNRLEAENKQL 158
+ D L E ++ + + + + +L ++ + L K +LE E+ L
Sbjct: 1013 VSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDL 1072
Query: 159 IAMRADIDGIRSELVEARRAFEFEKKANEEQIEQKQAMENNLISMAREIEKLRAEL---L 215
A++ +EL E E +A ++E + + +NN + RE+E ++L L
Sbjct: 1073 HEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDL 1132
Query: 216 NTERRAC 222
+E+ A
Sbjct: 1133 ESEKAAR 1139
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.93 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.9 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.81 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.9 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 95.86 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.59 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.5 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.46 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 94.94 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.93 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 93.93 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 93.21 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 92.95 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 92.39 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 92.3 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 91.91 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 91.55 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 91.54 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 91.34 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 90.98 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 90.78 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 90.49 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 90.12 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 89.45 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 89.26 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 89.06 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 88.98 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 88.74 | |
| 3plt_A | 234 | Sphingolipid long chain base-responsive protein L; | 88.69 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 88.32 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 87.13 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 86.47 | |
| 2w6b_A | 56 | RHO guanine nucleotide exchange factor 7; X-RAY cr | 86.02 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 85.51 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 85.37 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 85.32 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 85.13 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 84.75 | |
| 3lay_A | 175 | Zinc resistance-associated protein; salmonella typ | 84.46 | |
| 3onj_A | 97 | T-snare VTI1; helix, HABC, protein transport; 1.92 | 84.35 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 84.34 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 83.83 | |
| 4e61_A | 106 | Protein BIM1; EB1-like motif, coiled-coil, spindle | 82.98 | |
| 1use_A | 45 | VAsp, vasodilator-stimulated phosphoprotein; signa | 82.23 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 82.17 | |
| 4dzn_A | 33 | Coiled-coil peptide CC-PIL; de novo protein; HET: | 81.96 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 81.75 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 81.35 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 80.86 |
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
Probab=96.93 E-value=0.026 Score=59.72 Aligned_cols=122 Identities=11% Similarity=0.092 Sum_probs=44.1
Q ss_pred cccccccccchHHHHHHHHhhHHHHHHHhhhhhHhhhhhHHHHHHHHHhhhhhHHhhhhchhHHHHHHHHHHHHHHHHHH
Q 024699 54 ISENRHAIDDNTHLQRELTASKDEIHRLGQIIPKLRADKEAHTRELFDRGLKLEVELRASEPVRAEVVQLRAEVQKLNSS 133 (264)
Q Consensus 54 l~dNqRLaathvaLrqeLaaaq~Elqrl~~~~~~l~ae~e~q~R~l~ek~~KmEAelra~e~lk~El~q~raE~q~L~~~ 133 (264)
...|..|-..-..|++.|.....+...|...+..+....+.++-+| +.++...+....|+.++...+..|...
T Consensus 920 ~~~~~~LE~kl~eLq~rL~~~e~~n~~L~~~~~~~~~~~~~e~~~L-------~~~l~~le~~~~e~~~~~~~v~~L~~e 992 (1080)
T 2dfs_A 920 KKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMNNLEITYSTETEKL-------RSDVERLRMSEEEAKNATNRVLSLQEE 992 (1080)
T ss_dssp -------------------------------CHHHHHHHHHHHHHH-------HHTHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3334445444445555555444454444444444443334444444 333333333444444444444444444
Q ss_pred HHHHHHHHHHHHHHHHHHHHhhhhh-HHHHHHHHHHHHHHHHHhhhhhhh
Q 024699 134 RQELTTQIKGLTKDVNRLEAENKQL-IAMRADIDGIRSELVEARRAFEFE 182 (264)
Q Consensus 134 RQeL~~qvq~l~qeL~r~~ad~qqi-pal~aEie~lrqElqr~Raa~EyE 182 (264)
-.+|..+++.+.+|...++...+++ ..|...+..|..|.+.+|..++.-
T Consensus 993 ~~~l~~~~~~~~ke~~~lee~~~~~~~~L~~kv~~L~~e~~~L~qq~~~l 1042 (1080)
T 2dfs_A 993 IAKLRKELHQTQTEKKTIEEWADKYKHETEQLVSELKEQNTLLKTEKEEL 1042 (1080)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4445555555555444444443333 244455666777777777665543
|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >2w6b_A RHO guanine nucleotide exchange factor 7; X-RAY crystallography, phosphoprotein, guanine-nucleotide releasing factor, GIT, PAK, PIX, COOL; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3onj_A T-snare VTI1; helix, HABC, protein transport; 1.92A {Saccharomyces cerevisiae} PDB: 3onl_C | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >4e61_A Protein BIM1; EB1-like motif, coiled-coil, spindle orientation, mitosis, K phosphorylation, mitotic spindle, microtubules, cell cycle; 2.45A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1use_A VAsp, vasodilator-stimulated phosphoprotein; signaling protein, null; 1.3A {Homo sapiens} SCOP: h.1.29.1 PDB: 1usd_A | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.39 |
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: ClpB, AAA+ modules species: Thermus thermophilus [TaxId: 274]
Probab=80.39 E-value=11 Score=33.01 Aligned_cols=54 Identities=22% Similarity=0.344 Sum_probs=37.4
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHhhhhhhhhhhh
Q 024699 133 SRQELTTQIKGLTKDVNRLEAENKQLIAMRADIDGIRSELVEARRAFEFEKKAN 186 (264)
Q Consensus 133 ~RQeL~~qvq~l~qeL~r~~ad~qqipal~aEie~lrqElqr~Raa~EyEKk~~ 186 (264)
...+|..+...++........-+.++-.++.+|+.++.++..+....+|++-+.
T Consensus 290 el~~lee~~~~L~~~w~~ek~~l~~i~~Lk~~Le~lr~~le~A~r~gd~e~Aae 343 (387)
T d1qvra2 290 EIAKLTEEIAKLRAEWEREREILRKLREAQHRLDEVRREIELAERQYDLNRAAE 343 (387)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTCHHHHHH
T ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHH
Confidence 333444455556666666666777777888888888888888777777777544
|