Citrus Sinensis ID: 024707


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MIEQRIDSMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTKGNATVDRKDKGTTPTDAKSTGSATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHRRDKDGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
cHHHHcccEEEEEEEEEHHHHHHHHHccccEEEEccccccEEEEEEEEEHHHHHHHHHHHHccccEEccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccEEEEEcccccccHHcccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHccHHHHHHcHHHHHHHHHHHHccccEEEEEcccccEEEEEcEEcHHHHHHHHHHHHcccEEEEccccEEccccccccccccccccccccccccccccccccccccccccEccccccEEEEEEccccccccEEcccccccccEcccccccccccccccccccccccccccccccccccccEcccEEEEcccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccEcc
MIEQRIDSMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDElkkdvviifpaevviptkkddgaaykkekdagttrkkdrddkatnkkddgnnatidkkYRGAITVYekfegpsmvykknegidavdektkgnatvdrkdkgttptdakstgsatsddkykdggrekgkdyvfndekdkaggrdtkqhrrdkdgsvmrnenpktylnydgrkvnneydyysplkysngidqmfsdenpnsycsil
MIEQRIDSMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVkvkgtvditevrsyikdelkkdvviifpaevviptkkddgaaykkekdagttrkkdrddkatnkkddgnnatidkkyrgaitvyekfegpsmvykknegidavdektkgnatvdrkdkgttptdakstgsatsddkykdggrekgkdyvfndekdkaggrdtkqhrrdkdgsvmrnenpktylnydgrkvnNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
MIEQRIDSMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTKGNATVDRKDKGTTPTDAKSTGSATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHRRDKDGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
********MNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPT***************************************KKYRGAITVYEKFEGPSMVY***************************************************************************************YLNYDGRKVNNEYDYYSPLKYSNGI****************
****R**SMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVII**************************************************************************************************AKSTGSATSDDKYKD**************************************************VNNEYDYYSPLKYSNGIDQ*FSDENPN**C*IL
MIEQRIDSMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKD**************************KDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTK*******************************GGREKGKDYVFNDEKDK*************DGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
MIEQRIDSMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPT***********************************ATIDKKYRGAITVYEKFEGPSMVY************************************ATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHRRDKDGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIEQRIDSMNYLKGKWHIRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTKGNATVDRKDKGTTPTDAKSTGSATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHRRDKDGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
356570770335 PREDICTED: uncharacterized protein LOC10 0.344 0.271 0.34 0.0003
297823503 388 hypothetical protein ARALYDRAFT_482676 [ 0.329 0.224 0.378 0.0008
>gi|356570770|ref|XP_003553557.1| PREDICTED: uncharacterized protein LOC100795652 [Glycine max] Back     alignment and taxonomy information
 Score = 52.0 bits (123), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 9/100 (9%)

Query: 18  IRHLINYISSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPT 77
           IR +I  + S G+E+VN++  +DLV VKGT+D+ E+  Y+ D+LK++V        V+P 
Sbjct: 150 IRKII--LKSKGVESVNIEGGKDLVSVKGTMDVKEIVPYLNDKLKRNV-------EVVPP 200

Query: 78  KKDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDK 117
           KK+ G   K+ K+ G    K    K    +D      ++K
Sbjct: 201 KKEGGDNKKENKEGGGGDSKKEGGKKQEGEDGAAKVEVNK 240




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297823503|ref|XP_002879634.1| hypothetical protein ARALYDRAFT_482676 [Arabidopsis lyrata subsp. lyrata] gi|297325473|gb|EFH55893.1| hypothetical protein ARALYDRAFT_482676 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
TAIR|locus:2057951386 AT2G36950 [Arabidopsis thalian 0.450 0.308 0.338 5.3e-08
TAIR|locus:2142614392 AT5G03380 [Arabidopsis thalian 0.337 0.227 0.357 1e-06
TAIR|locus:2153969319 AT5G24580 "AT5G24580" [Arabido 0.818 0.677 0.260 3e-05
ZFIN|ZDB-GENE-030131-6318 980 mbd1 "methyl-CpG binding domai 0.507 0.136 0.324 4.4e-05
WB|WBGene00016360390 C33G8.2 [Caenorhabditis elegan 0.617 0.417 0.271 0.00028
FB|FBgn0010282 577 TfIIFalpha "Transcription fact 0.484 0.221 0.286 0.00066
GENEDB_PFALCIPARUM|PF13_0191 459 PF13_0191 "hypothetical protei 0.810 0.466 0.229 0.00079
UNIPROTKB|Q8IDY5 459 PF13_0191 "Uncharacterized pro 0.810 0.466 0.229 0.00079
UNIPROTKB|I3LGC2 1500 RRBP1 "Uncharacterized protein 0.579 0.102 0.264 0.00097
TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 148 (57.2 bits), Expect = 5.3e-08, P = 5.3e-08
 Identities = 47/139 (33%), Positives = 72/139 (51%)

Query:    29 GLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKE 88
             G+ETV +D  +D+V VKGT+D+ E+   +  +LK+ V      E ++P KKDDGAA  K+
Sbjct:   180 GVETVAIDGAKDVVTVKGTIDVKELVPLLTKKLKRTV------EPLVPAKKDDGAAENKK 233

Query:    89 KDAGTT-RKKDRDDKATNK-KDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVD 146
              +A     KK+      N+ K +G++    KK  G        +G     KK EG D  +
Sbjct:   234 TEAAAPDAKKEAPSAGVNEAKKEGSDGGEKKKEVG--------DGGE---KKKEGGDGGE 282

Query:   147 EKTK-GNATVDRKDKGTTP 164
             +K + G+    +KD G  P
Sbjct:   283 KKKEAGDGGEKKKDGGGVP 301




GO:0005737 "cytoplasm" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
GO:0005507 "copper ion binding" evidence=IDA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA
TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6318 mbd1 "methyl-CpG binding domain protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00016360 C33G8.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0010282 TfIIFalpha "Transcription factor IIFalpha" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF13_0191 PF13_0191 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IDY5 PF13_0191 "Uncharacterized protein" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGC2 RRBP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

No confident hit detected by STRING


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 264
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.59
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.04
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.81
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.65
PLN02957238 copper, zinc superoxide dismutase 97.77
PRK10671 834 copA copper exporting ATPase; Provisional 97.25
TIGR0000368 copper ion binding protein. This model describes a 94.71
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 94.29
PRK10671 834 copA copper exporting ATPase; Provisional 92.23
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 84.21
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 82.34
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=99.59  E-value=3.3e-15  Score=110.02  Aligned_cols=60  Identities=25%  Similarity=0.288  Sum_probs=55.2

Q ss_pred             ceeEEEEEeCcchhhhccc-----ccCceeEEEeecCCCEEEEEeecCHHHHHHHHHHHhCCcee
Q 024707            7 DSMNYLKGKWHIRHLINYI-----SSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVV   66 (264)
Q Consensus         7 ~s~VVLKV~MHCEGCarKV-----kIkGVeSVeVDlekqKVTVtGtVDP~kLV~rLrKKTGK~Ae   66 (264)
                      .+.++++|.|||+||+++|     +++||++|.+|+++++|||.|.+||..|++.|++.+++++.
T Consensus         4 ~~~~v~kv~~~C~gc~~kV~~~l~~~~GV~~v~id~~~~kvtV~g~~~p~~vl~~l~k~~~k~~~   68 (73)
T KOG1603|consen    4 IKTVVLKVNMHCEGCARKVKRVLQKLKGVESVDIDIKKQKVTVKGNVDPVKLLKKLKKTGGKRAE   68 (73)
T ss_pred             ccEEEEEECcccccHHHHHHHHhhccCCeEEEEecCCCCEEEEEEecCHHHHHHHHHhcCCCceE
Confidence            4678999999999999999     99999999999999999999999999999999886646663



>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.22
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.05
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 98.98
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.89
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.79
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.75
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.75
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.71
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.57
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.56
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.54
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.54
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.53
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.51
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.51
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.49
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.47
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.47
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.46
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.45
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.42
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.41
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.4
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.39
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.39
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.37
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.34
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.33
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.32
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.31
2kyz_A67 Heavy metal binding protein; structural genomics, 98.28
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.23
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.21
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.21
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.18
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.13
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.05
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.83
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 97.73
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 97.48
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 97.3
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.22  E-value=2.5e-11  Score=83.04  Aligned_cols=60  Identities=10%  Similarity=0.089  Sum_probs=53.4

Q ss_pred             eEEEEEeCcchhhhccc-----ccCceeEEEeecCCCEEEEEeecCHHHHHHHHHHHhCCceeeecC
Q 024707            9 MNYLKGKWHIRHLINYI-----SSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFP   70 (264)
Q Consensus         9 ~VVLKV~MHCEGCarKV-----kIkGVeSVeVDlekqKVTVtGtVDP~kLV~rLrKKTGK~AeIyvP   70 (264)
                      .++|+|+|||.+|+.+|     +++|| ++.+|+..++++|.+.+++..|+++|+ ..|..+.++.|
T Consensus         3 ~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~-~~Gy~~~~~~~   67 (68)
T 3iwl_A            3 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLK-KTGKTVSYLGL   67 (68)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHH-TTCSCEEEEEC
T ss_pred             eEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHH-HcCCceEecCC
Confidence            35788899999999999     89999 999999999999999999999999995 67888855443



>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.49
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.45
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.4
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.17
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.06
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.01
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 98.98
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 98.97
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.97
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 98.9
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 98.88
d1p6ta172 Potential copper-translocating P-type ATPase CopA 98.86
d1p6ta279 Potential copper-translocating P-type ATPase CopA 98.77
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 98.73
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.49  E-value=2.2e-14  Score=102.86  Aligned_cols=58  Identities=19%  Similarity=0.358  Sum_probs=54.1

Q ss_pred             eEEEEEeCcchhhhccc-----ccCceeEEEeecCCCEEEEEeecCHHHHHHHHHHHhCCceee
Q 024707            9 MNYLKGKWHIRHLINYI-----SSTGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVI   67 (264)
Q Consensus         9 ~VVLKV~MHCEGCarKV-----kIkGVeSVeVDlekqKVTVtGtVDP~kLV~rLrKKTGK~AeI   67 (264)
                      .++|+|+|||++|+++|     +++||++|.||++.++|+|+|.++|+.|+++| +.+|++|+|
T Consensus         7 ~~~f~V~M~C~~C~~~Iek~l~~~~gV~~v~vdl~~~~v~V~~~~~~~~i~~~I-~~~G~~A~l   69 (72)
T d1qupa2           7 EATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTL-RNCGKDAII   69 (72)
T ss_dssp             EEEEECCCCSTTHHHHHHHHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHH-HHTTCCCEE
T ss_pred             EEEEEEccCCHHHHHHHHHHHhcCCCeeEEEEECCCCEEEEEeeCCHHHHHHHH-HHhCCCEEE
Confidence            46899999999999999     99999999999999999999999999999999 478888854



>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure