Citrus Sinensis ID: 024742

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
cccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccHHHcccccccccccccccEEEEcccccccccccccEEccccHHHHHHHHHHHHHHcccEEEEccccccccccccEEEccc
cHHccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccccccccccccccccEEcHHHHHHHHHccccEEEcccccccccHHHHcEEEEc
MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQnkevapalawcsdnksrlkksksKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKsntecttykalfepkqwdFLVDQFKQEFCKLYGMTLEPLLNIYLQAGlsalntpycyeddctkedplsqesfrklasplpyskqhhsKLVCYITKelmdtenppqvlpngyvySTKALEEMAKknngkitcprtglvcnySDLVKAYIS
MLRMSYYETAEKlaessniqdlVDIEVFQEAKKVIDALqnkevapalawcsdnksrlkkskskfEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLasplpyskqhHSKLVCYITKELmdtenppqvlpNGYVYSTKALEEMAKKnngkitcprtglvcnysdlvkayis
MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
******************IQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSD**********KFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCT***********************HSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAY**
MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
***************SSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query263 2.2.26 [Sep-21-2011]
Q7SXR3396 Macrophage erythroblast a yes no 0.988 0.656 0.449 3e-62
Q6GR10396 Macrophage erythroblast a N/A no 0.988 0.656 0.445 9e-62
Q5F398396 Macrophage erythroblast a yes no 0.988 0.656 0.441 2e-61
Q5RKJ1396 Macrophage erythroblast a yes no 0.988 0.656 0.437 1e-60
Q4VC33396 Macrophage erythroblast a yes no 0.988 0.656 0.437 1e-60
Q4R9A8396 Macrophage erythroblast a N/A no 0.988 0.656 0.430 7e-60
Q5R532396 Macrophage erythroblast a yes no 0.988 0.656 0.430 7e-60
Q7L5Y9396 Macrophage erythroblast a yes no 0.988 0.656 0.430 7e-60
Q3MHJ2434 Macrophage erythroblast a yes no 0.988 0.599 0.376 4e-55
Q5AS80406 Protein fyv10 OS=Emericel yes no 0.954 0.618 0.372 3e-46
>sp|Q7SXR3|MAEA_DANRE Macrophage erythroblast attacher OS=Danio rerio GN=maea PE=2 SV=2 Back     alignment and function desciption
 Score =  238 bits (608), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 172/265 (64%), Gaps = 5/265 (1%)

Query: 1   MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKS 60
           +LR  YY TA KLA  S I+DLV+IE+F  AK+V ++L+ +E A  LAWC DNKSRL+K 
Sbjct: 133 LLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERQETATCLAWCHDNKSRLRKM 192

Query: 61  KSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECT 120
           KS  EF LR+QEFIEL+R    + A+ +ARK+ +      + E+++VM  LAF S+T  +
Sbjct: 193 KSCLEFSLRIQEFIELIRQNKRMDAVRHARKHFSQAEGGQLDEVRQVMGMLAFPSDTHIS 252

Query: 121 TYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKED- 179
            YK L +P +W  L+ QF+ +  +L+ +    +  I LQAGLSA+ TP CY++D T ++ 
Sbjct: 253 PYKDLLDPARWKMLIQQFRYDNYRLHQLGNNSVFTITLQAGLSAIKTPQCYKEDGTSKNP 312

Query: 180 --PLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAK 237
             P+  +S  KLA PLP +   +S+LVC I+ E+M+  NPP +LPNGYVY   +L  ++ 
Sbjct: 313 DCPVCSKSLNKLAQPLPMAHCANSRLVCKISGEVMNENNPPMMLPNGYVYGYNSL--LSI 370

Query: 238 KNNGKITCPRTGLVCNYSDLVKAYI 262
           + + K+ CPRT  V N+S   K YI
Sbjct: 371 RQDDKVICPRTKEVFNFSQAEKVYI 395
May play a possible role in erythroblast and macrophages maturation. May associate with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.
Danio rerio (taxid: 7955)
>sp|Q6GR10|MAEA_XENLA Macrophage erythroblast attacher OS=Xenopus laevis GN=maea PE=2 SV=2 Back     alignment and function description
>sp|Q5F398|MAEA_CHICK Macrophage erythroblast attacher OS=Gallus gallus GN=MAEA PE=2 SV=1 Back     alignment and function description
>sp|Q5RKJ1|MAEA_RAT Macrophage erythroblast attacher OS=Rattus norvegicus GN=Maea PE=2 SV=2 Back     alignment and function description
>sp|Q4VC33|MAEA_MOUSE Macrophage erythroblast attacher OS=Mus musculus GN=Maea PE=1 SV=1 Back     alignment and function description
>sp|Q4R9A8|MAEA_MACFA Macrophage erythroblast attacher OS=Macaca fascicularis GN=MAEA PE=2 SV=1 Back     alignment and function description
>sp|Q5R532|MAEA_PONAB Macrophage erythroblast attacher OS=Pongo abelii GN=MAEA PE=2 SV=1 Back     alignment and function description
>sp|Q7L5Y9|MAEA_HUMAN Macrophage erythroblast attacher OS=Homo sapiens GN=MAEA PE=1 SV=1 Back     alignment and function description
>sp|Q3MHJ2|MAEA_BOVIN Macrophage erythroblast attacher OS=Bos taurus GN=MAEA PE=2 SV=1 Back     alignment and function description
>sp|Q5AS80|FYV10_EMENI Protein fyv10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fyv10 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
356574997 414 PREDICTED: macrophage erythroblast attac 1.0 0.635 0.904 1e-135
449451687 469 PREDICTED: macrophage erythroblast attac 1.0 0.560 0.897 1e-135
356536518 414 PREDICTED: macrophage erythroblast attac 1.0 0.635 0.908 1e-135
224098160 412 predicted protein [Populus trichocarpa] 1.0 0.638 0.847 1e-135
225448765 412 PREDICTED: macrophage erythroblast attac 1.0 0.638 0.893 1e-133
255568187 414 erythroblast macrophage protein emp, put 1.0 0.635 0.878 1e-132
357445017 873 Macrophage erythroblast attacher [Medica 1.0 0.301 0.866 1e-128
297816802 418 hypothetical protein ARALYDRAFT_485927 [ 1.0 0.629 0.812 1e-127
15233170 418 LisH/CRA/RING-U-box domain-containing pr 1.0 0.629 0.815 1e-127
115462239 406 Os05g0160100 [Oryza sativa Japonica Grou 1.0 0.647 0.775 1e-123
>gi|356574997|ref|XP_003555629.1| PREDICTED: macrophage erythroblast attacher-like [Glycine max] Back     alignment and taxonomy information
 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/263 (90%), Positives = 253/263 (96%)

Query: 1   MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKS 60
           MLRMSYY+TA KLA+SSN+QDLVDI+VFQEAKKVIDALQNK+VAPALAWC+DNKSRLKKS
Sbjct: 152 MLRMSYYDTAVKLAKSSNLQDLVDIDVFQEAKKVIDALQNKDVAPALAWCADNKSRLKKS 211

Query: 61  KSKFEFQLRLQEFIELVRGENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNTECT 120
           KSK EFQLRLQEFIELVR ENNLRAITYARKYLAPWGATHMKELQRV+ATLAFK +TEC+
Sbjct: 212 KSKMEFQLRLQEFIELVRAENNLRAITYARKYLAPWGATHMKELQRVIATLAFKRDTECS 271

Query: 121 TYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTKEDP 180
           TYK LFE KQWD+LVDQFKQEFCKLYGMTLEPLLNIYLQAGLSAL TPYCYEDDCTKEDP
Sbjct: 272 TYKVLFEAKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYEDDCTKEDP 331

Query: 181 LSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNN 240
           LSQE+FR LA PLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNN
Sbjct: 332 LSQEAFRTLAMPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAKKNN 391

Query: 241 GKITCPRTGLVCNYSDLVKAYIS 263
           G+I CPRTGLVC+Y++LVKAYIS
Sbjct: 392 GRIICPRTGLVCSYTELVKAYIS 414

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449451687|ref|XP_004143593.1| PREDICTED: macrophage erythroblast attacher-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356536518|ref|XP_003536784.1| PREDICTED: macrophage erythroblast attacher-like [Glycine max] Back     alignment and taxonomy information
>gi|224098160|ref|XP_002311128.1| predicted protein [Populus trichocarpa] gi|222850948|gb|EEE88495.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225448765|ref|XP_002281688.1| PREDICTED: macrophage erythroblast attacher [Vitis vinifera] gi|297736449|emb|CBI25320.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568187|ref|XP_002525069.1| erythroblast macrophage protein emp, putative [Ricinus communis] gi|223535650|gb|EEF37316.1| erythroblast macrophage protein emp, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357445017|ref|XP_003592786.1| Macrophage erythroblast attacher [Medicago truncatula] gi|355481834|gb|AES63037.1| Macrophage erythroblast attacher [Medicago truncatula] Back     alignment and taxonomy information
>gi|297816802|ref|XP_002876284.1| hypothetical protein ARALYDRAFT_485927 [Arabidopsis lyrata subsp. lyrata] gi|297322122|gb|EFH52543.1| hypothetical protein ARALYDRAFT_485927 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15233170|ref|NP_191067.1| LisH/CRA/RING-U-box domain-containing protein [Arabidopsis thaliana] gi|7329637|emb|CAB82702.1| putative protein [Arabidopsis thaliana] gi|111074420|gb|ABH04583.1| At3g55070 [Arabidopsis thaliana] gi|332645814|gb|AEE79335.1| LisH/CRA/RING-U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115462239|ref|NP_001054719.1| Os05g0160100 [Oryza sativa Japonica Group] gi|51038108|gb|AAT93911.1| unknown protein [Oryza sativa Japonica Group] gi|55168055|gb|AAV43923.1| unknown protein [Oryza sativa Japonica Group] gi|113578270|dbj|BAF16633.1| Os05g0160100 [Oryza sativa Japonica Group] gi|125550933|gb|EAY96642.1| hypothetical protein OsI_18556 [Oryza sativa Indica Group] gi|215707056|dbj|BAG93516.1| unnamed protein product [Oryza sativa Japonica Group] gi|222630285|gb|EEE62417.1| hypothetical protein OsJ_17208 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
TAIR|locus:2097248418 AT3G55070 "AT3G55070" [Arabido 1.0 0.629 0.815 1.2e-115
DICTYBASE|DDB_G0284463423 maea "CT11-RanBPM domain-conta 0.992 0.617 0.467 8.4e-58
ZFIN|ZDB-GENE-030131-294396 maea "macrophage erythroblast 0.988 0.656 0.449 1.4e-57
UNIPROTKB|Q5F398396 MAEA "Macrophage erythroblast 0.988 0.656 0.441 9.6e-57
MGI|MGI:1891748396 Maea "macrophage erythroblast 0.988 0.656 0.437 4.2e-56
RGD|1309877396 Maea "macrophage erythroblast 0.988 0.656 0.437 4.2e-56
UNIPROTKB|B4DQT1348 MAEA "Macrophage erythroblast 0.988 0.747 0.430 1.4e-55
UNIPROTKB|B4DVN3395 MAEA "cDNA FLJ54556, highly si 0.988 0.658 0.430 1.4e-55
UNIPROTKB|Q7L5Y9396 MAEA "Macrophage erythroblast 0.988 0.656 0.430 1.4e-55
UNIPROTKB|F1MXB7412 MAEA "Macrophage erythroblast 0.771 0.492 0.389 1.8e-54
TAIR|locus:2097248 AT3G55070 "AT3G55070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1140 (406.4 bits), Expect = 1.2e-115, P = 1.2e-115
 Identities = 217/266 (81%), Positives = 241/266 (90%)

Query:     1 MLRMSYYETAEKLAESSNIQDLVDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKS 60
             MLRMSY+ETA KL+ESSNI DLVDI++F+EAKKVIDAL+N+EVA AL WC+DNK+RLKKS
Sbjct:   153 MLRMSYFETATKLSESSNIMDLVDIDIFREAKKVIDALKNREVASALTWCADNKTRLKKS 212

Query:    61 KSKFEFQLRLQEFIELVR---GENNLRAITYARKYLAPWGATHMKELQRVMATLAFKSNT 117
             KSKFEFQLRLQEFIELVR    E+  +AI YARK+LA WG THMKELQ V+ATLAFKS T
Sbjct:   213 KSKFEFQLRLQEFIELVRVDTAESYKKAIQYARKHLASWGTTHMKELQHVLATLAFKSTT 272

Query:   118 ECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALNTPYCYEDDCTK 177
             EC+ YK LFE +QWD LVDQFKQEFCKLYGMT+EPLLNIYLQAGLSAL TPY  E+ CTK
Sbjct:   273 ECSKYKVLFELRQWDVLVDQFKQEFCKLYGMTMEPLLNIYLQAGLSALKTPYGLEEGCTK 332

Query:   178 EDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEEMAK 237
             EDPLSQE+FRKLA PLP+SKQHHSKLVCYI+KELMDTENPPQVLPNGYVYSTKAL+EMA+
Sbjct:   333 EDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTKALKEMAE 392

Query:   238 KNNGKITCPRTGLVCNYSDLVKAYIS 263
             KN GKITCPRTGLVCNY++LVKAYIS
Sbjct:   393 KNGGKITCPRTGLVCNYTELVKAYIS 418
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
DICTYBASE|DDB_G0284463 maea "CT11-RanBPM domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-294 maea "macrophage erythroblast attacher" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F398 MAEA "Macrophage erythroblast attacher" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1891748 Maea "macrophage erythroblast attacher" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309877 Maea "macrophage erythroblast attacher" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B4DQT1 MAEA "Macrophage erythroblast attacher" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DVN3 MAEA "cDNA FLJ54556, highly similar to Homo sapiens macrophage erythroblast attacher (MAEA), transcript variant 1, mRNA" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L5Y9 MAEA "Macrophage erythroblast attacher" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXB7 MAEA "Macrophage erythroblast attacher" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
pfam10607144 pfam10607, CLTH, CTLH/CRA C-terminal to LisH motif 7e-56
smart0075799 smart00757, CRA, CT11-RanBPM 5e-22
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 3e-18
COG5109396 COG5109, COG5109, Uncharacterized conserved protei 9e-14
smart0066858 smart00668, CTLH, C-terminal to LisH motif 2e-11
smart0050463 smart00504, Ubox, Modified RING finger domain 0.001
>gnl|CDD|220824 pfam10607, CLTH, CTLH/CRA C-terminal to LisH motif domain Back     alignment and domain information 
 Score =  175 bits (447), Expect = 7e-56
 Identities = 63/144 (43%), Positives = 92/144 (63%), Gaps = 1/144 (0%)

Query: 27  VFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVRGENNLRAI 86
           VF+E  K+ ++L N ++  AL WC++NK  L K  S  EF+LRLQ+FIEL+R    L A+
Sbjct: 1   VFKERNKIRESLLNGDLEEALEWCNENKPELLKINSNLEFELRLQQFIELIREGKILEAL 60

Query: 87  TYARKYLA-PWGATHMKELQRVMATLAFKSNTECTTYKALFEPKQWDFLVDQFKQEFCKL 145
            YAR+ LA  +   H+KE+Q++M  LAF   T+ + YK+L  P +W+ L ++F +   KL
Sbjct: 61  EYARENLAPFFNEQHLKEIQKLMGLLAFPDPTDSSPYKSLLSPSRWEKLANEFNRAILKL 120

Query: 146 YGMTLEPLLNIYLQAGLSALNTPY 169
            G++ E  L I L+AGLSAL T  
Sbjct: 121 LGLSSESPLEILLKAGLSALKTLL 144

RanBPM is a scaffolding protein and is important in regulating cellular function in both the immune system and the nervous system. This domain is at the C-terminus of the proteins and is the binding domain for the CRA motif (for CT11-RanBPM), which is comprised of approximately 100 amino acids at the C terminal of RanBPM. It was found to be important for the interaction of RanBPM with fragile X mental retardation protein (FMRP), but its functional significance has yet to be determined. This region contains CTLH and CRA domains annotated by SMART; however, these may be a single domain, and it is refereed to as a C-terminal to LisH motif. Length = 144
>gnl|CDD|214806 smart00757, CRA, CT11-RanBPM Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|227440 COG5109, COG5109, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|128914 smart00668, CTLH, C-terminal to LisH motif Back     alignment and domain information
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG0396389 consensus Uncharacterized conserved protein [Funct 100.0
COG5109396 Uncharacterized conserved protein, contains RING Z 100.0
PF10607145 CLTH: CTLH/CRA C-terminal to LisH motif domain; In 100.0
KOG2659228 consensus LisH motif-containing protein [Cytoskele 99.96
smart0075799 CRA CT11-RanBPM. protein-protein interaction domai 99.78
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.59
smart0066858 CTLH C-terminal to LisH motif. Alpha-helical motif 99.41
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.26
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.05
PF04641260 Rtf2: Rtf2 RING-finger 98.87
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.75
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.7
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.68
KOG3113 293 consensus Uncharacterized conserved protein [Funct 98.65
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.5
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.48
PF1463444 zf-RING_5: zinc-RING finger domain 98.47
KOG0293 519 consensus WD40 repeat-containing protein [Function 98.43
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.42
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.28
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.22
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.17
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.95
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.91
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.9
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.89
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.75
KOG3039303 consensus Uncharacterized conserved protein [Funct 97.74
PHA02929238 N1R/p28-like protein; Provisional 97.71
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.59
PHA02926242 zinc finger-like protein; Provisional 97.48
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.22
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.21
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.07
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.01
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.95
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.89
KOG1477469 consensus SPRY domain-containing proteins [General 96.86
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.76
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.67
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.38
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.27
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.76
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.63
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 95.29
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 95.19
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.16
KOG2979262 consensus Protein involved in DNA repair [General 94.87
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.79
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 94.58
COG5222427 Uncharacterized conserved protein, contains RING Z 94.56
PF0851327 LisH: LisH; InterPro: IPR013720 The LisH motif is 94.01
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 93.95
COG5152259 Uncharacterized conserved protein, contains RING a 93.69
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 93.37
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 93.34
smart0066734 LisH Lissencephaly type-1-like homology motif. Alp 93.11
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 92.8
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.1
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 91.92
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 91.77
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 91.62
smart00531147 TFIIE Transcription initiation factor IIE. 90.58
KOG1002 791 consensus Nucleotide excision repair protein RAD16 89.67
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 89.63
COG439162 Uncharacterized protein conserved in bacteria [Fun 89.53
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 89.25
KOG0883 518 consensus Cyclophilin type, U box-containing pepti 88.91
KOG1940276 consensus Zn-finger protein [General function pred 88.32
KOG1941518 consensus Acetylcholine receptor-associated protei 88.28
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 88.18
PF04494142 TFIID_90kDa: WD40 associated region in TFIID subun 87.93
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 87.75
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 87.74
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 87.69
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.29
PF0396668 Trm112p: Trm112p-like protein; InterPro: IPR005651 87.21
PF14353128 CpXC: CpXC protein 87.02
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 85.86
cd08044133 TAF5_NTD2 TAF5_NTD2 is the second conserved N-term 85.19
KOG149384 consensus Anaphase-promoting complex (APC), subuni 84.88
COG5175 480 MOT2 Transcriptional repressor [Transcription] 82.67
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 82.43
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 81.6
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 81.52
KOG0825 1134 consensus PHD Zn-finger protein [General function 81.5
KOG0297 391 consensus TNF receptor-associated factor [Signal t 80.9
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 80.8
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 80.6
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 80.54
KOG3002 299 consensus Zn finger protein [General function pred 80.37
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.7e-65  Score=451.96  Aligned_cols=262  Identities=29%  Similarity=0.520  Sum_probs=243.5

Q ss_pred             CcccccHHHHHHHHHHcCCCCC--CCHHHHHHHHHHHHHHhcCChHHHHHHHHhhchhhhhCCCceeeechHHHHHHHHh
Q 024742            1 MLRMSYYETAEKLAESSNIQDL--VDIEVFQEAKKVIDALQNKEVAPALAWCSDNKSRLKKSKSKFEFQLRLQEFIELVR   78 (263)
Q Consensus         1 Llr~Gy~~ta~~f~~e~~i~~~--~d~~~~~~~~~I~~~i~~gdi~~Al~w~~~~~~~L~~~~s~LeF~L~~q~fIeLi~   78 (263)
                      ++|+|..|+|+.|.+|+|+...  ...+.|.++++|+++|+.||+++|++|+..|+..|.+.+|.|||.||.++|+++++
T Consensus       127 ~~rqGm~dv~~~l~~Ea~~~~~~~~~~~~F~el~~Iv~~lke~Dl~~aLeWa~~~~~~L~~~~s~LE~~Lh~l~fl~l~~  206 (394)
T KOG2817|consen  127 FYRQGMDDVGECLIKEAGLSEDESKSRTEFVELNQIVEALKERDLEPALEWAESNRQKLKEKSSSLEFKLHSLHFLSLIR  206 (394)
T ss_pred             HHHcCchHHHHHHHHHhcCCCcchhhhhhHHHHHHHHHHHHhccchhHHHHHHHhhhhhccccccHHHHHHHHHHHHHHh
Confidence            4799999999999999999865  34578999999999999999999999999999999999999999999999999999


Q ss_pred             cCChH--HHHHHHHHhCcchhhhhHHHHHHHHHHhhccCC-CCcchhHHhcCcccHHHHHHHHHHHHHHhhCCCCCcHHH
Q 024742           79 GENNL--RAITYARKYLAPWGATHMKELQRVMATLAFKSN-TECTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLEPLLN  155 (263)
Q Consensus        79 ~~~~~--eAi~yar~~l~~~~~~~~~ei~~~~~lL~f~~~-~~~s~y~~l~~~~r~~~la~~f~~~~~~~~~~~~~s~L~  155 (263)
                      .|...  +||.|||+||+||+..+..|||.+|++|.|-.. .+.+||.+++++..|.++...|.++||++.|+|.+|||.
T Consensus       207 ~g~~~~~eAl~Yar~~~~~F~~~~~~eIQklm~sl~~l~~gl~~spy~~~ls~~~w~~~~~~f~r~ycallg~s~eSPL~  286 (394)
T KOG2817|consen  207 GGKSDQREALRYARTHFAPFVADHLREIQKLMGSLLYLRNGLEKSPYSEILSPKLWKELTEEFTREYCALLGISVESPLS  286 (394)
T ss_pred             cCCcCcHHHHHHHHHhcCccccchHHHHHHHHHHHHHHHcCCCCCChHHHhCHHHHHHHHHHHHHHHHHHcCCCccCcHH
Confidence            99766  999999999999999999999999999999766 577999999999999999999999999999999999999


Q ss_pred             HHHHhhhhhccccccccCCCCC-CCCCCchhhhhhcCCCCCCCCcCCeeeecccccccCCCCCCeecCCCceecHHHHHH
Q 024742          156 IYLQAGLSALNTPYCYEDDCTK-EDPLSQESFRKLASPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEE  234 (263)
Q Consensus       156 ~~l~~G~~al~t~~c~~~~~~~-~cp~c~~~~~~l~~~lP~~~~~~s~~~Cpi~~~~~~~~n~p~~l~cGhv~~~~~~~~  234 (263)
                      +++.+|..|||++.++.++... .--|-..+.+|++++||..++|||+|+|||+||+.+++||||+|+||||||++||.+
T Consensus       287 v~v~aG~~Alp~Llk~~~v~~~~~~~W~~~deLPveIeL~~~~~fHSvF~CPVlKeqtsdeNPPm~L~CGHVISkdAlnr  366 (394)
T KOG2817|consen  287 VLVNAGCIALPQLLKYKSVMELKHGEWNTKDELPVEIELGKEYHFHSVFICPVLKEQTSDENPPMMLICGHVISKDALNR  366 (394)
T ss_pred             HHHHhhHHHHHHHHHHHHHHHHhccCccccccCccceeccccccccceeecccchhhccCCCCCeeeeccceecHHHHHH
Confidence            9999999999999999886432 123555678899999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCCceecCCCCcccCcccceeccc
Q 024742          235 MAKKNNGKITCPRTGLVCNYSDLVKAYI  262 (263)
Q Consensus       235 ~~~~~~~~~~CP~c~~~~~~~~~~~v~~  262 (263)
                      |++++.-+|||||||.+...+++++|||
T Consensus       367 LS~ng~~sfKCPYCP~e~~~~~~kql~F  394 (394)
T KOG2817|consen  367 LSKNGSQSFKCPYCPVEQLASDTKQLYF  394 (394)
T ss_pred             HhhCCCeeeeCCCCCcccCHHhcccccC
Confidence            9875545699999999999999999997

>KOG0396 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10607 CLTH: CTLH/CRA C-terminal to LisH motif domain; InterPro: IPR019589 This entry represents the CRA (or CT11-RanBPM) domain, which is a protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi) and which is found in Ran-binding proteins such as Ran-binding protein 9 (RanBP9 or RanBPM) and RanBP10 Back     alignment and domain information
>KOG2659 consensus LisH motif-containing protein [Cytoskeleton] Back     alignment and domain information
>smart00757 CRA CT11-RanBPM Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00668 CTLH C-terminal to LisH motif Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1477 consensus SPRY domain-containing proteins [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF08513 LisH: LisH; InterPro: IPR013720 The LisH motif is found in a large number of eukaryotic proteins, from metazoa, fungi and plants that have a wide range of functions Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00667 LisH Lissencephaly type-1-like homology motif Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04494 TFIID_90kDa: WD40 associated region in TFIID subunit; InterPro: IPR007582 This region, possibly a domain is found in subunits of transcription factor TFIID Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>cd08044 TAF5_NTD2 TAF5_NTD2 is the second conserved N-terminal region of TATA Binding Protein (TBP) Associated Factor 5 (TAF5), involved in forming Transcription Factor IID (TFIID) Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.8 bits (105), Expect = 2e-05
 Identities = 47/320 (14%), Positives = 83/320 (25%), Gaps = 112/320 (35%)

Query: 10  AEKLAESSNIQDLVDIEVF-------QEAKKVIDALQN--KEVAPALAWCSDNKSRLKKS 60
           A  +  S  +Q  +D ++F          + V++ LQ    ++ P     SD+ S +K  
Sbjct: 167 ALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLR 226

Query: 61  KSKFEFQLRLQEFIELVRGENNL---RAITYARKYLAPWGATHMK--ELQ-RVMATLAFK 114
                 Q  L+  ++    EN L     +           A       L  +++ T  FK
Sbjct: 227 IH--SIQAELRRLLKSKPYENCLLVLLNV---------QNAKAWNAFNLSCKILLTTRFK 275

Query: 115 SNTE----CTTYKALFEPKQWDFLVDQFKQEFCKLYGMTLE----------PLL------ 154
             T+     TT     +        D+ K    K      +          P        
Sbjct: 276 QVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAE 335

Query: 155 ---------NIYLQAGLSALNT----------PY----CYED------------------ 173
                    + +       L T          P      ++                   
Sbjct: 336 SIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLI 395

Query: 174 --DCTKEDP------LSQES----------------FRKLASPLPYSKQHHSKLV-CYIT 208
             D  K D       L + S                + +L   L      H  +V  Y  
Sbjct: 396 WFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNI 455

Query: 209 KELMDTENPPQVLPNGYVYS 228
            +  D+++      + Y YS
Sbjct: 456 PKTFDSDDLIPPYLDQYFYS 475
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.21
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.14
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.08
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.08
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.06
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.04
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.02
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.01
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.95
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.91
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.9
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.84
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.84
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.82
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.81
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.81
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.81
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.8
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.79
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.78
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.72
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.69
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.68
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.66
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.66
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.63
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.59
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.58
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.58
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.57
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.56
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.56
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.56
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.53
2ect_A78 Ring finger protein 126; metal binding protein, st 98.51
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.51
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.5
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.45
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.44
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.38
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.37
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.36
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.35
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.35
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.34
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.33
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.32
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.3
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.28
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.28
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.24
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.24
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.19
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.18
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.14
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.12
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.11
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.07
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.02
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.91
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.81
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.77
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 97.63
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.63
2ea5_A68 Cell growth regulator with ring finger domain prot 97.6
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.53
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.35
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.24
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 95.79
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 95.54
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 95.03
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.0
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 93.14
2k5c_A95 Uncharacterized protein PF0385; structural genomic 91.88
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 89.91
2nxp_A156 Transcription initiation factor TFIID subunit 5; t 89.3
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 89.17
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 88.01
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 86.42
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 86.14
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 84.65
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 84.44
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 84.1
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 83.54
2j4b_A138 TAF5, transcription initiation factor TFIID subuni 83.54
2j49_A148 Transcription initiation factor TFIID subunit 5; n 83.09
1vd4_A62 Transcription initiation factor IIE, alpha subunit 82.41
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 81.69
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 81.34
3nw0_A238 Non-structural maintenance of chromosomes element 81.23
2jrr_A67 Uncharacterized protein; solution structure, SIR90 80.55
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 80.01
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
Probab=99.21  E-value=7.5e-12  Score=84.83  Aligned_cols=55  Identities=18%  Similarity=0.334  Sum_probs=49.3

Q ss_pred             eeeecccccccCCCCCCeec-CCCceecHHHHHHHHHhCCCceecCCCCcccCcccceeccc
Q 024742          202 KLVCYITKELMDTENPPQVL-PNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYI  262 (263)
Q Consensus       202 ~~~Cpi~~~~~~~~n~p~~l-~cGhv~~~~~~~~~~~~~~~~~~CP~c~~~~~~~~~~~v~~  262 (263)
                      .|+||||++.|.+   ||++ ++||||++++|++|.+++ +  +||.|++..+.+|++++++
T Consensus         3 ~~~CpIs~~~m~d---PV~~~~sG~~yer~~I~~~l~~~-~--~cP~t~~~L~~~~Lip~~~   58 (61)
T 2bay_A            3 HMLCAISGKVPRR---PVLSPKSRTIFEKSLLEQYVKDT-G--NDPITNEPLSIEEIVEIVP   58 (61)
T ss_dssp             -CCCTTTCSCCSS---EEEETTTTEEEEHHHHHHHHHHH-S--BCTTTCCBCCGGGCEECCC
T ss_pred             eEEecCCCCCCCC---CEEeCCCCcEEcHHHHHHHHHhC-C--CCcCCcCCCChhhcEECcc
Confidence            5899999999997   9998 999999999999999753 2  6999999999999998875
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2nxp_A Transcription initiation factor TFIID subunit 5; transcription factor, TAF5; 2.17A {Homo sapiens} SCOP: d.379.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2j4b_A TAF5, transcription initiation factor TFIID subunit 72/ kDa; WD repeat; 2.5A {Encephalitozoon cuniculi} SCOP: d.379.1.1 Back     alignment and structure
>2j49_A Transcription initiation factor TFIID subunit 5; nuclear protein, transcription regulation, TA TFIID, WD repeat; 2.3A {Saccharomyces cerevisiae} SCOP: d.379.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.23
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.08
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.03
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.98
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.91
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.91
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.69
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.49
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.48
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.45
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.35
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.15
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.05
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.0
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.63
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.49
d2nxpa1149 TAF5 subunit of TFIID {Human (Homo sapiens) [TaxId 88.65
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.0
d2j4ba1131 TAF5 subunit of TFIID {Encephalitozoon cuniculi [T 83.8
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 83.17
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 81.46
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Pre-mRNA splicing factor Prp19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.23  E-value=3.3e-12  Score=83.52  Aligned_cols=53  Identities=19%  Similarity=0.341  Sum_probs=47.6

Q ss_pred             eeecccccccCCCCCCeecC-CCceecHHHHHHHHHhCCCceecCCCCcccCcccceecc
Q 024742          203 LVCYITKELMDTENPPQVLP-NGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAY  261 (263)
Q Consensus       203 ~~Cpi~~~~~~~~n~p~~l~-cGhv~~~~~~~~~~~~~~~~~~CP~c~~~~~~~~~~~v~  261 (263)
                      ++|||+++.+.+   ||+++ |||+|++++|.+|.+++   .+||.|++.++.+|+.++.
T Consensus         1 l~C~Ic~~~~~~---Pv~~~~cGh~fc~~cI~~~l~~~---~~CP~c~~~l~~~dLipik   54 (56)
T d2baya1           1 MLCAISGKVPRR---PVLSPKSRTIFEKSLLEQYVKDT---GNDPITNEPLSIEEIVEIV   54 (56)
T ss_dssp             CCCTTTCSCCSS---EEEETTTTEEEEHHHHHHHHHHH---SBCTTTCCBCCGGGCEECC
T ss_pred             CCCccCCchHHh---cCccCCCCCcccHHHHHHHHhhc---cCCCccCCcCCHHhceeCC
Confidence            589999999988   99875 99999999999999853   3899999999999998875
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2nxpa1 d.379.1.1 (A:195-343) TAF5 subunit of TFIID {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4ba1 d.379.1.1 (A:18-148) TAF5 subunit of TFIID {Encephalitozoon cuniculi [TaxId: 6035]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure