Citrus Sinensis ID: 024834

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNTHSSATKNRKGEA
ccccccccccHHHHcccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccEEccccHcccccccccccccHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEcEEEccccccccccccccccccccccEEEcccccccccccEcccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccc
mddgevdfsnqEMLSanigdfpscsmdsfFEDILkdthacththtcnppgpdsshthtcfhvhtkivaptsedkvstddtaestekktkkrplgnrEAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGriegeigsfpyqksvnnmnlpnphsagayvvnpcnmrcddqvyclhpgmedksgegielngqgfsgcefenlqcvgnqssgvrelpgcgdgnvatnthssatknrkgea
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTkivaptsedkvstddtaestekktkkrplgnreavrkyrekkkartasledevvRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCgdgnvatnthssatknrkgea
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNTHSSATKNRKGEA
*****************IGDFPSCSMDSFFEDILKDTHACTHTHTC*********THTCFHVHTKIV*************************************************VVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGM******GIELNGQGFSGCEFENLQCVG*********************************
******DFSNQE****************FFEDILKDTHACTH******************************************************************RTASLED*VV****************AALEAEVARLKCLLV*************************************CNMRCDDQVYC*****************************************************************
********SNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPT************************NREAVR************LEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNT************
******DF*NQEMLSAN*G*FPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAP*************************NREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIEL****FSGCEFENLQCVGNQSSGVRELPGC*D*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARxxxxxxxxxxxxxxxxxxxxxLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNTHSSATKNRKGEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query262 2.2.26 [Sep-21-2011]
Q41558 476 Transcription factor HBP- N/A no 0.389 0.214 0.333 0.0003
>sp|Q41558|HBP1C_WHEAT Transcription factor HBP-1b(c1) (Fragment) OS=Triticum aestivum PE=1 SV=2 Back     alignment and function desciption
 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 27  DSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEK 86
           D++ E  + DT   T T T   P  D    +  F    ++ APT+ D  S+D + +  + 
Sbjct: 136 DNWGESSMADTSPRTDTST--DPDIDIDERNQMFE-QGQLAAPTASD--SSDKSRDKLDH 190

Query: 87  KTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLK-RLQG 133
           K+ +R   NREA RK R +KKA   +LE   ++L  + Q+L + R QG
Sbjct: 191 KSLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQG 238
Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.
Triticum aestivum (taxid: 4565)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
255587127284 DNA binding protein, putative [Ricinus c 0.996 0.919 0.760 1e-118
225428029273 PREDICTED: uncharacterized protein LOC10 0.992 0.952 0.740 1e-112
398806220270 bZIP transcription factor family protein 0.984 0.955 0.748 1e-111
147768431264 hypothetical protein VITISV_026643 [Viti 0.984 0.977 0.742 1e-111
224078323265 predicted protein [Populus trichocarpa] 0.984 0.973 0.725 1e-105
449458616273 PREDICTED: uncharacterized protein LOC10 0.988 0.948 0.702 1e-104
449454205270 PREDICTED: uncharacterized protein LOC10 0.988 0.959 0.753 1e-104
224105159264 predicted protein [Populus trichocarpa] 0.984 0.977 0.714 1e-104
449515738262 PREDICTED: uncharacterized protein LOC10 0.980 0.980 0.755 1e-103
398806218270 bZIP transcription factor family protein 0.984 0.955 0.687 1e-99
>gi|255587127|ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis] gi|223525783|gb|EEF28231.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 203/267 (76%), Positives = 237/267 (88%), Gaps = 6/267 (2%)

Query: 1   MDDGEVDFSNQEMLSA-NIGDFPS-CSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHT 58
           MDDGE+DFS+QE+ S  N+G+ P+ CSMDSFF+++LKDTHACTHTHTCNPPGPD SHTHT
Sbjct: 1   MDDGELDFSHQEVFSGTNMGEMPNNCSMDSFFDELLKDTHACTHTHTCNPPGPDYSHTHT 60

Query: 59  CFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVV 118
           CFHVHTKIV+  S+DK  TDDTAESTEKK+KKRPLGNREAVRKYREKKKAR ASLEDEVV
Sbjct: 61  CFHVHTKIVSAPSDDKTGTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDEVV 120

Query: 119 RLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHS 178
           +LRA+NQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKS N++N PNP+ 
Sbjct: 121 KLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSANDVNFPNPNY 180

Query: 179 AGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVREL 238
           +GAYV+NPCNM+C+DQVYCLHPG++ +S +GI LNGQGF+GC+F+NLQC+ NQ+S  +EL
Sbjct: 181 SGAYVMNPCNMQCNDQVYCLHPGVDGRSDDGIALNGQGFNGCDFDNLQCLANQNSAAKEL 240

Query: 239 PGCGDGNVATNT----HSSATKNRKGE 261
           P CG GNV TN     +SS+T  RKG+
Sbjct: 241 PSCGLGNVLTNDNGNGNSSSTNKRKGK 267

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225428029|ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera] Back     alignment and taxonomy information
>gi|398806220|gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis] Back     alignment and taxonomy information
>gi|147768431|emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224078323|ref|XP_002305521.1| predicted protein [Populus trichocarpa] gi|222848485|gb|EEE86032.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449458616|ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus] gi|449489648|ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454205|ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224105159|ref|XP_002313707.1| predicted protein [Populus trichocarpa] gi|222850115|gb|EEE87662.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449515738|ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus] Back     alignment and taxonomy information
>gi|398806218|gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
TAIR|locus:2059851249 bZIP23 "AT2G16770" [Arabidopsi 0.916 0.963 0.631 1.2e-83
TAIR|locus:2131626261 bZIP19 "AT4G35040" [Arabidopsi 0.950 0.954 0.621 2.4e-83
TAIR|locus:2083760228 BZIP24 "AT3G51960" [Arabidopsi 0.583 0.671 0.496 5.7e-36
UNIPROTKB|F1NAC0262 XBP1 "Uncharacterized protein" 0.244 0.244 0.426 0.00047
TAIR|locus:2059851 bZIP23 "AT2G16770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 838 (300.0 bits), Expect = 1.2e-83, P = 1.2e-83
 Identities = 166/263 (63%), Positives = 204/263 (77%)

Query:     1 MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCF 60
             MDDGE++FSN  M     G+ PSCSMDSFF+++L+D+HACTHTHTCNPPGP+++HTHTC 
Sbjct:     1 MDDGELEFSNSNMG----GELPSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCL 56

Query:    61 HVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRL 120
             HVHTKI+ P   DKVSTDDT+ES+ KK   RPLGNREAVRKYREKKKA+ ASLEDEV+RL
Sbjct:    57 HVHTKIL-P---DKVSTDDTSESSGKK---RPLGNREAVRKYREKKKAKAASLEDEVMRL 109

Query:   121 RAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQK-SVNNMNLPNPHSA 179
             +AVN QLLKRLQGQAALEAEV RLKCLLVDIRGRI+GEIG+FPYQK +V N+    P+S 
Sbjct:   110 KAVNNQLLKRLQGQAALEAEVTRLKCLLVDIRGRIDGEIGAFPYQKPAVTNV----PYS- 164

Query:   180 GAYVVNPCNMRCD-DQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVREL 238
               Y+++PCNM+CD D +YCL  G    +GEG  +N QG +GCEF+ L+C+ NQ+   +E+
Sbjct:   165 --YMMHPCNMQCDVDNLYCLQNG---NNGEGASMNEQGLNGCEFDQLECLANQNLAGKEI 219

Query:   239 PGCGDGNVATNTHSSATKNRKGE 261
             P C +G      + S    RKGE
Sbjct:   220 PVCSNGIGTFTVNGSGVNKRKGE 242
GO:0003677 "DNA binding" evidence=ISS;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0010043 "response to zinc ion" evidence=IEP
GO:0071294 "cellular response to zinc ion" evidence=IGI
TAIR|locus:2131626 bZIP19 "AT4G35040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083760 BZIP24 "AT3G51960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAC0 XBP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036120001
SubName- Full=Putative uncharacterized protein (Chromosome chr3 scaffold_8, whole genome shotgun sequence); (264 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
smart0033865 smart00338, BRLZ, basic region leucin zipper 6e-14
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 3e-12
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 4e-08
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 64.5 bits (158), Expect = 6e-14
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 82  ESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEV 141
           E  EK+ ++R   NREA R+ RE+KKA    LE +V +L A N++L K ++    L  E+
Sbjct: 1   EEDEKRRRRR-ERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIE---RLRREL 56

Query: 142 ARLKCLL 148
            +LK  L
Sbjct: 57  EKLKSEL 63

Length = 65
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 262
smart0033865 BRLZ basic region leucin zipper. 99.48
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.36
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.14
KOG0837279 consensus Transcriptional activator of the JUN fam 98.77
KOG4571294 consensus Activating transcription factor 4 [Trans 98.63
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 98.62
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 98.56
KOG3584348 consensus cAMP response element binding protein an 98.54
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.36
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 97.86
KOG3119269 consensus Basic region leucine zipper transcriptio 97.46
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 97.1
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.71
TIGR0244965 conserved hypothetical protein TIGR02449. Members 96.0
PRK13922276 rod shape-determining protein MreC; Provisional 94.93
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.77
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 94.15
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 93.77
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 92.28
PRK13169110 DNA replication intiation control protein YabA; Re 92.08
PRK10884206 SH3 domain-containing protein; Provisional 91.9
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 91.65
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 91.38
PRK10884206 SH3 domain-containing protein; Provisional 91.05
PRK0029568 hypothetical protein; Provisional 90.93
PRK1542279 septal ring assembly protein ZapB; Provisional 90.54
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 90.42
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 90.33
PHA03155115 hypothetical protein; Provisional 90.29
PRK0432574 hypothetical protein; Provisional 90.17
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.17
PRK0440675 hypothetical protein; Provisional 89.87
COG307479 Uncharacterized protein conserved in bacteria [Fun 89.84
PF05812118 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: 89.77
PRK0279372 phi X174 lysis protein; Provisional 89.75
PHA03162135 hypothetical protein; Provisional 89.54
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 89.37
KOG3119269 consensus Basic region leucine zipper transcriptio 89.25
COG1792284 MreC Cell shape-determining protein [Cell envelope 89.23
PRK0211973 hypothetical protein; Provisional 89.13
PRK00888105 ftsB cell division protein FtsB; Reviewed 89.04
PRK0073668 hypothetical protein; Provisional 88.33
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 88.26
PRK13169110 DNA replication intiation control protein YabA; Re 87.91
PF15058200 Speriolin_N: Speriolin N terminus 87.43
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 87.36
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 86.97
PF0399377 DUF349: Domain of Unknown Function (DUF349); Inter 86.73
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 86.28
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 85.96
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 85.7
COG4467114 Regulator of replication initiation timing [Replic 85.66
PRK0084677 hypothetical protein; Provisional 85.37
KOG1318411 consensus Helix loop helix transcription factor EB 85.04
COG2433652 Uncharacterized conserved protein [Function unknow 85.04
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 84.68
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 84.2
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 83.89
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 83.55
COG4026290 Uncharacterized protein containing TOPRIM domain, 83.32
PRK14872 337 rod shape-determining protein MreC; Provisional 83.26
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 82.97
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 82.84
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 82.5
PRK00888105 ftsB cell division protein FtsB; Reviewed 82.32
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 82.02
COG4942 420 Membrane-bound metallopeptidase [Cell division and 81.81
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 81.68
KOG4797123 consensus Transcriptional regulator [Transcription 81.56
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 81.53
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 81.46
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 81.43
PRK11637 428 AmiB activator; Provisional 80.92
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 80.85
PF1374789 DUF4164: Domain of unknown function (DUF4164) 80.83
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 80.68
PRK09039343 hypothetical protein; Validated 80.57
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 80.48
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.48  E-value=1.2e-13  Score=100.39  Aligned_cols=62  Identities=40%  Similarity=0.548  Sum_probs=57.1

Q ss_pred             HHHhhccCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 024834           85 EKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLV  149 (262)
Q Consensus        85 d~RK~KRmlsNRESARRSR~RKQaHleeLE~QV~qLraeNqqLl~rLq~~a~LEaEn~rLRaqL~  149 (262)
                      ++|+.||+++||+||++||+||++++.+||.+|..|..+|..|..++   ..|+.|+..|+.++.
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~---~~l~~e~~~lk~~~~   64 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEI---ERLRRELEKLKSELE   64 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHhc
Confidence            56899999999999999999999999999999999999999999886   668899999988764

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PHA03155 hypothetical protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05812 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: IPR008642 This family consists of several herpes virus BLRF2 tegument proteins Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF03993 DUF349: Domain of Unknown Function (DUF349); InterPro: IPR007139 This motif is found singly or as up to five tandem repeats in a small set of bacterial proteins Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PRK14872 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG4797 consensus Transcriptional regulator [Transcription] Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 3e-13
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 3e-11
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 3e-11
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 9e-10
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 1e-09
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 5e-09
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 1e-08
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 2e-08
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 9e-08
2wt7_B90 Transcription factor MAFB; transcription, transcri 1e-06
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
 Score = 62.0 bits (151), Expect = 3e-13
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 86  KKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLK 145
           KK KK    N+ A  +YR+KK+A   +L  E   L   N+ L +R     +L  E+  LK
Sbjct: 2   KKLKKM-EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERAD---SLAKEIQYLK 57

Query: 146 CLLVDI 151
            L+ ++
Sbjct: 58  DLIEEV 63
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.51
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.47
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.4
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.39
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.37
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.36
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.09
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 99.05
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.93
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.32
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.13
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 96.9
3m48_A33 General control protein GCN4; leucine zipper, synt 95.94
1deb_A54 APC protein, adenomatous polyposis coli protein; c 95.7
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 95.62
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.5
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 95.44
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 95.33
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 95.17
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 95.07
1uo4_A34 General control protein GCN4; four helix bundle, c 94.65
2bni_A34 General control protein GCN4; four helix bundle, a 94.38
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 94.28
2hy6_A34 General control protein GCN4; protein design, para 94.27
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.98
2j5u_A255 MREC protein; bacterial cell shape determining pro 93.35
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 93.28
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 92.56
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 92.46
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 91.63
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 90.12
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 89.61
2xv5_A74 Lamin-A/C; structural protein, intermediate filame 89.43
2oa5_A110 Hypothetical protein BQLF2; MHR28B, NESG, structur 89.39
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 88.65
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 88.34
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 87.82
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 86.96
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 86.66
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 86.46
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 85.76
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 85.27
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 85.12
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 84.21
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 83.88
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 83.64
1fmh_A33 General control protein GCN4; coiled coil, leucine 83.55
1gk6_A59 Vimentin; intermediate filament, dimer, parallel c 82.93
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 80.66
1x8y_A86 Lamin A/C; structural protein, intermediate filame 80.24
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.51  E-value=1.1e-14  Score=104.31  Aligned_cols=46  Identities=41%  Similarity=0.533  Sum_probs=42.2

Q ss_pred             HhhccCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 024834           87 KTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQ  132 (262)
Q Consensus        87 RK~KRmlsNRESARRSR~RKQaHleeLE~QV~qLraeNqqLl~rLq  132 (262)
                      |+.+||++|||||++||+|||+|+++||.+|.+|+.+|..|..++.
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~   46 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELK   46 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5789999999999999999999999999999999999988876653
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} Back     alignment and structure
>2oa5_A Hypothetical protein BQLF2; MHR28B, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: PE5; 2.10A {Murid herpesvirus 4} SCOP: d.362.1.1 PDB: 2h3r_A* Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
d2oa5a196 Uncharacterized protein BQLF2 {Murid herpesvirus 4 89.16
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 85.85
>d2oa5a1 d.362.1.1 (A:7-102) Uncharacterized protein BQLF2 {Murid herpesvirus 4 [TaxId: 33708]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: BLRF2-like
superfamily: BLRF2-like
family: BLRF2-like
domain: Uncharacterized protein BQLF2
species: Murid herpesvirus 4 [TaxId: 33708]

Probab=89.16  E-value=0.43  Score=36.03  Aligned_cols=49  Identities=16%  Similarity=0.324  Sum_probs=34.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH----------------HHHHHHHHHHHHHHHHH-HHhhhhhh
Q 024834          110 TASLEDEVVRLRAVNQQLLKRLQG----------------QAALEAEVARLKCLLVD-IRGRIEGE  158 (262)
Q Consensus       110 leeLE~QV~qLraeNqqLl~rLq~----------------~a~LEaEn~rLRaqL~e-lrgri~~~  158 (262)
                      +++|..|+.+|+.||..|.++|..                .+.+-+-+.+|-++.++ |+.||...
T Consensus         4 ~EeLaaeL~rL~~ENk~LKkkl~~~~~~~~~d~~LT~~qke~~I~s~~~~lts~A~kKIe~kV~~~   69 (96)
T d2oa5a1           4 YEEMVKEVERLKLENKTLKQKVKSSGAVSSDDSILTAAKRESIIVSSSRALGAVAMRKIEAKVRSR   69 (96)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTC---------CCBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            689999999999999999999963                33444555666555544 56666643
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure