Citrus Sinensis ID: 024836
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 262 | ||||||
| 255542634 | 736 | pentatricopeptide repeat-containing prot | 0.927 | 0.330 | 0.742 | 1e-106 | |
| 224125242 | 266 | predicted protein [Populus trichocarpa] | 0.992 | 0.977 | 0.708 | 1e-102 | |
| 359487742 | 265 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.981 | 0.714 | 1e-102 | |
| 147798217 | 322 | hypothetical protein VITISV_018290 [Viti | 0.977 | 0.795 | 0.709 | 3e-99 | |
| 449482847 | 833 | PREDICTED: putative pentatricopeptide re | 0.900 | 0.283 | 0.670 | 8e-95 | |
| 449442815 | 838 | PREDICTED: pentatricopeptide repeat-cont | 0.900 | 0.281 | 0.670 | 1e-94 | |
| 238479656 | 244 | DnaJ domain-containing protein [Arabidop | 0.866 | 0.930 | 0.719 | 8e-91 | |
| 357512005 | 251 | Chaperone protein dnaJ [Medicago truncat | 0.900 | 0.940 | 0.680 | 7e-90 | |
| 356504050 | 753 | PREDICTED: pentatricopeptide repeat-cont | 0.885 | 0.308 | 0.661 | 6e-88 | |
| 388492320 | 253 | unknown [Lotus japonicus] | 0.828 | 0.857 | 0.707 | 2e-86 |
| >gi|255542634|ref|XP_002512380.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548341|gb|EEF49832.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 390 bits (1002), Expect = e-106, Method: Compositional matrix adjust.
Identities = 187/252 (74%), Positives = 217/252 (86%), Gaps = 9/252 (3%)
Query: 18 KTVISPNCHNFPSNSTTRR--RFPS----KFTVNCTERTGENASTPPSTSSA-YAILGVE 70
K+V PN HN SN +R RFPS KFTVNC+ER G++ TP S+SSA + +LGV+
Sbjct: 487 KSVTYPNGHNLFSNFNSRNPLRFPSHSNSKFTVNCSERIGDD--TPLSSSSAAHMVLGVD 544
Query: 71 PSCSAAELKAAFRAKVKQYHPDVNRDGRDSDALIRRIIQAYEILTEYSRLEIIERECIDP 130
P CSAAELKAAFRAKVKQ+HPDVNRD + D +IRR+IQAYEIL+ +SR EIIE EC+DP
Sbjct: 545 PGCSAAELKAAFRAKVKQFHPDVNRDRKFPDTMIRRVIQAYEILSNFSRSEIIESECLDP 604
Query: 131 FDYPECEALDVFVNEVLCVGKGCPYSCVKTAPNAFSYSSSTGTARAISQGHGQDYRVQLA 190
FD PECEA D+FVNEVLC GKGCPYSCV+TAP+AF+Y+SSTGTARAISQGHG+DY+VQLA
Sbjct: 605 FDNPECEAFDIFVNEVLCAGKGCPYSCVQTAPHAFAYASSTGTARAISQGHGEDYKVQLA 664
Query: 191 VGQCPRSCIHYVTPSQRIILEELLESILDAPYDTSAEAELLYSLIVKARFENNRYQKPKK 250
VGQCPRSCIHYVTPSQRIILEELL+SIL PYD SAEA++LYSLIVKA +ENNRYQKPKK
Sbjct: 665 VGQCPRSCIHYVTPSQRIILEELLDSILGVPYDNSAEADMLYSLIVKATYENNRYQKPKK 724
Query: 251 KPKTSSQHVDWF 262
+PKTS+QHV+WF
Sbjct: 725 QPKTSTQHVEWF 736
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224125242|ref|XP_002319537.1| predicted protein [Populus trichocarpa] gi|222857913|gb|EEE95460.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359487742|ref|XP_002280795.2| PREDICTED: uncharacterized protein LOC100263014 [Vitis vinifera] gi|296088328|emb|CBI36773.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147798217|emb|CAN60541.1| hypothetical protein VITISV_018290 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449482847|ref|XP_004156421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449442815|ref|XP_004139176.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|238479656|ref|NP_001154591.1| DnaJ domain-containing protein [Arabidopsis thaliana] gi|332640701|gb|AEE74222.1| DnaJ domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357512005|ref|XP_003626291.1| Chaperone protein dnaJ [Medicago truncatula] gi|355501306|gb|AES82509.1| Chaperone protein dnaJ [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356504050|ref|XP_003520812.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388492320|gb|AFK34226.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 262 | ||||||
| TAIR|locus:5019474746 | 244 | AT3G05345 "AT3G05345" [Arabido | 0.877 | 0.942 | 0.645 | 4.5e-75 | |
| TAIR|locus:2052426 | 344 | AT2G42750 [Arabidopsis thalian | 0.530 | 0.404 | 0.322 | 6.7e-13 | |
| TAIR|locus:2166968 | 465 | AT5G23240 [Arabidopsis thalian | 0.679 | 0.382 | 0.282 | 1.5e-11 | |
| UNIPROTKB|Q55980 | 133 | sll0662 "Ferredoxin (Bacterial | 0.290 | 0.571 | 0.354 | 4.7e-08 | |
| TIGR_CMR|SPO_0044 | 381 | SPO_0044 "chaperone protein Dn | 0.236 | 0.162 | 0.387 | 1.1e-06 | |
| TAIR|locus:2030352 | 126 | AT1G72070 [Arabidopsis thalian | 0.270 | 0.563 | 0.364 | 4.1e-06 | |
| FB|FBgn0037151 | 128 | CG7130 [Drosophila melanogaste | 0.232 | 0.476 | 0.322 | 1.2e-05 | |
| TAIR|locus:2140035 | 447 | AT4G39960 [Arabidopsis thalian | 0.232 | 0.136 | 0.387 | 1.3e-05 | |
| UNIPROTKB|B0CM59 | 277 | DNAJB2 "DnaJ homolog, subfamil | 0.236 | 0.223 | 0.380 | 2.6e-05 | |
| UNIPROTKB|P25686 | 324 | DNAJB2 "DnaJ homolog subfamily | 0.236 | 0.191 | 0.380 | 3.7e-05 |
| TAIR|locus:5019474746 AT3G05345 "AT3G05345" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 757 (271.5 bits), Expect = 4.5e-75, P = 4.5e-75
Identities = 153/237 (64%), Positives = 174/237 (73%)
Query: 27 NFPSNSTTRRRFPSKFTVNCTERTGENXXXXXXXXXXYAILGVEPSCSAAELKAAFRAKV 86
+F SNS R +F +C G+N Y+ILGVEPSCS++ELKAAFRAKV
Sbjct: 14 SFFSNS--RYSTSQRFIPSCR---GKNREDPLSSSSPYSILGVEPSCSSSELKAAFRAKV 68
Query: 87 KQYHPDVNRDGRDSDALIRRIIQAYEILTEYSRLEIIERECIDPFDYPECEALDVFVNEV 146
KQYHPDVN+DG +SD +IRRIIQAYE+LT YSR EIIE EC+DPFD+PECEALDVFVNEV
Sbjct: 69 KQYHPDVNKDGSNSDIMIRRIIQAYEMLTNYSRSEIIEGECLDPFDHPECEALDVFVNEV 128
Query: 147 LCVGKGCPYSCVKTAPNAFSYSSSTGTARAISQGHGQDYRVQLAVGQCPRSCIHYVTPSQ 206
LCVGK C Y C +TA + FS SS GTARA+SQGHG+DYRVQ AV QCPR+CIHYVTPSQ
Sbjct: 129 LCVGKRCSYPCFETASHVFSCDSS-GTARAMSQGHGEDYRVQSAVNQCPRNCIHYVTPSQ 187
Query: 207 RXXXXXXXXXXXDAPYDTSAEAELLYSLIVKARFENNRYQXXXXXXXTSS-QHVDWF 262
R D PYD SAEAE LY+LIVKA+FENNRYQ SS +HVDWF
Sbjct: 188 RIILEELLDSVVDKPYDCSAEAEFLYALIVKAKFENNRYQKPKKKQPESSGKHVDWF 244
|
|
| TAIR|locus:2052426 AT2G42750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166968 AT5G23240 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q55980 sll0662 "Ferredoxin (Bacterial type ferredoxin family)" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0044 SPO_0044 "chaperone protein DnaJ" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030352 AT1G72070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037151 CG7130 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140035 AT4G39960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B0CM59 DNAJB2 "DnaJ homolog, subfamily B, member 2, isoform 1 (Predicted)" [Papio anubis (taxid:9555)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P25686 DNAJB2 "DnaJ homolog subfamily B member 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00022831001 | SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (265 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 262 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 7e-15 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 1e-14 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 3e-14 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 4e-11 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 3e-10 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 2e-09 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 3e-09 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 1e-08 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 3e-08 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 3e-08 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 4e-08 | |
| pfam13459 | 60 | pfam13459, Fer4_15, 4Fe-4S single cluster domain | 7e-08 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 1e-07 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 2e-07 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 3e-07 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 4e-07 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 4e-07 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-07 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 6e-07 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 7e-07 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 8e-07 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 1e-06 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-06 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 4e-06 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 6e-06 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 1e-05 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 2e-05 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 4e-05 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 5e-05 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 2e-04 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 2e-04 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 8e-04 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 0.002 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 67.2 bits (165), Expect = 7e-15
Identities = 20/52 (38%), Positives = 29/52 (55%)
Query: 64 YAILGVEPSCSAAELKAAFRAKVKQYHPDVNRDGRDSDALIRRIIQAYEILT 115
Y ILGV S E+K A+R +YHPD N ++ + I +AYE+L+
Sbjct: 3 YEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLS 54
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222145 pfam13459, Fer4_15, 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.93 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.89 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.83 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.83 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.82 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.82 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.81 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.8 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.76 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.76 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.76 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.75 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.73 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.73 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.72 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.71 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.71 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.71 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.71 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.7 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.69 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.67 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.66 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.65 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.64 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.63 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.61 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.61 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.58 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.5 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.48 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.47 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.46 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.44 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.41 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.41 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.39 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.34 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.31 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.23 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.18 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.16 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 99.01 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.93 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.84 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.53 | |
| PF13459 | 65 | Fer4_15: 4Fe-4S single cluster domain | 98.46 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.43 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.38 | |
| PF13370 | 58 | Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A | 98.37 | |
| COG1141 | 68 | Fer Ferredoxin [Energy production and conversion] | 98.25 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.59 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 97.0 | |
| PF06902 | 64 | Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: | 96.58 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.38 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 96.11 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 95.83 | |
| COG3592 | 74 | Uncharacterized conserved protein [Function unknow | 93.38 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 89.39 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 83.39 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.93 E-value=6.6e-26 Score=208.51 Aligned_cols=90 Identities=27% Similarity=0.412 Sum_probs=77.6
Q ss_pred CCccchhhhhCCCCCCCHHHHHHHHHHHHHhhCCCCCCCCchHHHHHHHHHHHHHHhcChhHHHHHHhcCCCCCCCc---
Q 024836 58 PSTSSAYAILGVEPSCSAAELKAAFRAKVKQYHPDVNRDGRDSDALIRRIIQAYEILTEYSRLEIIERECIDPFDYP--- 134 (262)
Q Consensus 58 ~~~~~~Y~iLgl~~~as~~eIK~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~f~~~--- 134 (262)
|..+|||+||||+++||.+|||+|||+||++||||+|+++++|+++|++|++||+||+||++|+.||++|.+++...
T Consensus 1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g 80 (371)
T COG0484 1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG 80 (371)
T ss_pred CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence 35678999999999999999999999999999999999878999999999999999999999999999987765311
Q ss_pred -----cc--chhhhhhhccc
Q 024836 135 -----EC--EALDVFVNEVL 147 (262)
Q Consensus 135 -----~~--~~~~iFv~~~~ 147 (262)
.+ +..|||-+.|.
T Consensus 81 g~g~~~fgg~~~DIF~~~Fg 100 (371)
T COG0484 81 GFGFGGFGGDFGDIFEDFFG 100 (371)
T ss_pred CCCcCCCCCCHHHHHHHhhc
Confidence 11 34667766663
|
|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13459 Fer4_15: 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A | Back alignment and domain information |
|---|
| >COG1141 Fer Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06902 Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: IPR010693 This entry represents bacterial ferredoxins such Ferredoxin-1, -2 and -soy from Streptomyces griseolus and Ferredoxin fas2 from Rhodococcus fascians, plus several bacterial hypothetical proteins that contain three highly conserved cysteine residues | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG3592 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 262 | ||||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 6e-07 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 2e-06 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 3e-06 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 6e-06 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 8e-06 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-05 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-05 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-05 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 2e-05 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 5e-05 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 5e-05 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 6e-05 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 6e-04 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 8e-04 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 9e-04 |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
|
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 262 | |||
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 8e-15 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 2e-12 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 3e-12 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 8e-12 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 2e-11 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 2e-11 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 2e-11 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 5e-11 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 6e-11 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 1e-10 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 1e-10 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-10 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 1e-10 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 2e-10 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 2e-10 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 3e-10 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 4e-10 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 1e-09 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 2e-09 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 2e-09 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 3e-09 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 3e-09 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 3e-09 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 6e-09 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 7e-09 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 1e-08 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 2e-08 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 1e-07 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 2e-07 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 7e-07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-06 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 3e-06 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 5e-06 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 7e-05 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 1e-04 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 2e-04 |
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 | Back alignment and structure |
|---|
Score = 66.3 bits (162), Expect = 8e-15
Identities = 18/65 (27%), Positives = 27/65 (41%), Gaps = 3/65 (4%)
Query: 138 ALDVFVNEVLCVGKGCPYSCVKTAPNAFSYSSSTGTARAISQGHGQDYRVQLAVGQCPRS 197
A +V++ C+ C CV+ AP AF+ A V+ A+ CP
Sbjct: 1 ARKFYVDQDECIA--CES-CVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQ 57
Query: 198 CIHYV 202
CIH+
Sbjct: 58 CIHWE 62
|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Length = 59 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Length = 60 | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Length = 66 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.86 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.85 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.85 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.85 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.84 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.83 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.83 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.83 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.83 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.83 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.83 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.82 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.82 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.81 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.8 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.77 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.77 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.75 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.74 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.72 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.72 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.71 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.7 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.7 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.69 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.68 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.67 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.66 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.62 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.62 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.6 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.59 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.57 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 99.11 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.97 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 95.88 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 95.83 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 94.6 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 93.66 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 92.83 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 91.67 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 84.0 |
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.86 E-value=9.4e-22 Score=143.76 Aligned_cols=74 Identities=30% Similarity=0.506 Sum_probs=68.2
Q ss_pred CCCccchhhhhCCCCCCCHHHHHHHHHHHHHhhCCCCCCCCchHHHHHHHHHHHHHHhcChhHHHHHHhcCCCC
Q 024836 57 PPSTSSAYAILGVEPSCSAAELKAAFRAKVKQYHPDVNRDGRDSDALIRRIIQAYEILTEYSRLEIIERECIDP 130 (262)
Q Consensus 57 ~~~~~~~Y~iLgl~~~as~~eIK~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~ 130 (262)
.....++|+||||+++++.++||++||+|++++|||+++..+.+.+.|++|++||++|+||.+|..||.++..+
T Consensus 3 ~~~~~~~y~iLgv~~~a~~~~Ik~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g~~~ 76 (79)
T 2dn9_A 3 SGSSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSGP 76 (79)
T ss_dssp SSCCSCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCSSCTTHHHHHHHHHHHHHHHHSHHHHHHHHHSCCCC
T ss_pred CCCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHhccCcC
Confidence 45567899999999999999999999999999999999877788999999999999999999999999987543
|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 262 | ||||
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 6e-09 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 2e-08 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 2e-08 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 3e-07 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 4e-07 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 6e-07 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 3e-06 | |
| d1fxra_ | 64 | d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte | 2e-05 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 0.002 |
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Auxilin J-domain species: Cow (Bos taurus) [TaxId: 9913]
Score = 49.9 bits (119), Expect = 6e-09
Identities = 8/57 (14%), Positives = 18/57 (31%), Gaps = 3/57 (5%)
Query: 62 SAYAILGVEPSCSAAELKAAFRAKVKQYHPDVNRDGRDSDAL---IRRIIQAYEILT 115
+ + +G+ + ++K +R V HPD + A+
Sbjct: 34 TKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFE 90
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.9 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.83 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.78 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.73 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.71 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.62 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.6 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 98.79 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 97.81 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 97.76 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 97.41 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 97.03 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.90 E-value=5.4e-24 Score=152.78 Aligned_cols=73 Identities=27% Similarity=0.545 Sum_probs=68.7
Q ss_pred ccchhhhhCCCCCCCHHHHHHHHHHHHHhhCCCCCCCCchHHHHHHHHHHHHHHhcChhHHHHHHhcCCCCCC
Q 024836 60 TSSAYAILGVEPSCSAAELKAAFRAKVKQYHPDVNRDGRDSDALIRRIIQAYEILTEYSRLEIIERECIDPFD 132 (262)
Q Consensus 60 ~~~~Y~iLgl~~~as~~eIK~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~f~ 132 (262)
.+|||+||||+++||.+|||+|||+|++++|||++++++.+++.|+.|++||+||+||.+|..||++|..+|.
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e 74 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE 74 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence 4689999999999999999999999999999999998788889999999999999999999999999887663
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|