Citrus Sinensis ID: 024936

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260

MLKKRNQLRSILGQIYYQNRNRNQNQNLMSCAIRSDPICKGFHSNVTNNSSDINIINSSSNGFLRFKGKVNNGSLILRGCFDSTNRVNAGADQKVGAFAPPQRVPHLEIAAAEGCTDARLVNGRGSSERGNPLGFFDSHLHGKIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALHKLSRYCLGNMLSRTIPLNGLRSIIRDYFRRSTLATTLP

cccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHccccccccc

ccHHHccHHHccccccccccccccccccHHHHccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEEccccccccccccccccccccEEcccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccHHHHHHHHHHHHccHHHHcccccccHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHcccc

MLKKRNQLRSILGQIYYQNrnrnqnqnlmscairsdpickgfhsnvtnnssdiniinsssngflrfkgkvnngslilrgcfdstnrvnagadqkvgafappqrvphlEIAAaegctdarlvngrgssergnplgffdshlhgkIVVAVDVDEVLGNFVSALNRFIADryslnhsvseyHVYEFFKIwncsrdeadlrvheffktpyfktgihplpgaQKALHKLSRYCLGNmlsrtiplnglRSIIRDYFrrstlattlp

MLKKRNQLRSILGQIYYqnrnrnqnqnLMSCAIRSDPICKGFHsnvtnnssdiniinsssnGFLRFKGKVNNGSLILRGCFDSTNRVNAGADQKVGAFAPPQRVPHLEIAAAEGCTDARLVNGRGSSERGNPLGFFDSHLHGKIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALHKLSRYCLGNMLSRTIPLNGLRSIIRDYFRRSTLATTLP

*********SILGQIYYQNRNRNQNQNLMSCAIRSDPICKGFHSNVTNNSSDINIINSSSNGFLRFKGKVNNGSLILRGCFDSTNRVNAGADQKVGAFAPPQRVPHLEIAAAEGCTDARLVN********NPLGFFDSHLHGKIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALHKLSRYCLGNMLSRTIPLNGLRSIIRDYFRRST******

**********ILGQIYY*************CAIRSDPICKGFHS***********INSSSNGFLRFKGKVNNGSLILRGCFD***************************************************GFFDSHLHGKIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALHKLSRYCLGNMLSRTIPLNGLRSIIRDYFRRSTLATTLP

ML***NQLRSILGQIYYQNRNRNQNQNLMSCAIRSDPICKGFHSNVTNNSSDINIINSSSNGFLRFKGKVNNGSLILRGCFDSTNRVNAGADQKVGAFAPPQRVPHLEIAAAEGCTDARLVNGRGSSERGNPLGFFDSHLHGKIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALHKLSRYCLGNMLSRTIPLNGLRSIIRDYFRRSTLA****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		260
297738494		364	unnamed protein product [Vitis vinifera]	0.6	0.428	0.634	2e-47
225444574		349	PREDICTED: uncharacterized protein LOC10	0.6	0.446	0.634	3e-47
224092021		270	predicted protein [Populus trichocarpa]	0.573	0.551	0.654	2e-46
255550267		231	conserved hypothetical protein [Ricinus	0.434	0.489	0.787	4e-46
18418156		353	5' nucleotidase, deoxy (Pyrimidine), cyt	0.546	0.402	0.631	3e-44
297802676		352	predicted protein [Arabidopsis lyrata su	0.6	0.443	0.602	5e-44
356545798		341	PREDICTED: uncharacterized protein LOC10	0.573	0.436	0.598	3e-42
356564702		342	PREDICTED: uncharacterized protein LOC10	0.434	0.330	0.741	6e-41
356530481		306	PREDICTED: uncharacterized protein LOC10	0.584	0.496	0.570	4e-40
338808451		374	Tac7077 [Sorghum propinquum]	0.603	0.419	0.502	1e-39

>gi\|297738494\|emb\|CBI27739.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 121/175 (69%), Gaps = 19/175 (10%)

Query: 58  SSSNGFLRFKGKVNNGSLILRGCFDSTNR-VNAGADQKVGAFA---PPQRVPHLEIAAAE 113
           S+SNGF           L +RGC DS  R V+       GAFA     Q +   EI    
Sbjct: 87  STSNGF--------RIGLSMRGCSDSNKRRVDRNGH---GAFAHSYQQQVLRDFEI---- 131

Query: 114 GCTDARLVNGRGSSERGNPLGFFDSHLHGKIVVAVDVDEVLGNFVSALNRFIADRYSLNH 173
           G  DA +  G G+S  G  LGF    L  KIVVAVDVDEVLGNFVSALNRFIADRYSL H
Sbjct: 132 GLPDAGIPTGHGASHHGKLLGFPLRPLPEKIVVAVDVDEVLGNFVSALNRFIADRYSLKH 191

Query: 174 SVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALHKLSRYC 228
           SVSEYHVYEFFKIWNCSRDEAD+RVHEFFKT YFKTGIHP+PGAQ+ALHKLSR+C
Sbjct: 192 SVSEYHVYEFFKIWNCSRDEADIRVHEFFKTSYFKTGIHPIPGAQQALHKLSRFC 246

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225444574\|ref\|XP_002277240.1\| PREDICTED: uncharacterized protein LOC100261032 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224092021\|ref\|XP_002309442.1\| predicted protein [Populus trichocarpa] gi\|222855418\|gb\|EEE92965.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255550267\|ref\|XP_002516184.1\| conserved hypothetical protein [Ricinus communis] gi\|223544670\|gb\|EEF46186.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi|18418156|ref|NP_567913.1| 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein domain containing protein-like protein [Arabidopsis thaliana] gi|15982925|gb|AAL09809.1| AT4g33140/F4I10_70 [Arabidopsis thaliana] gi|22137262|gb|AAM91476.1| AT4g33140/F4I10_70 [Arabidopsis thaliana] gi|332660780|gb|AEE86180.1| 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein domain containing protein-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297802676\|ref\|XP_002869222.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297315058\|gb\|EFH45481.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356545798\|ref\|XP_003541321.1\| PREDICTED: uncharacterized protein LOC100793947 [Glycine max]	Back alignment and taxonomy information

>gi\|356564702\|ref\|XP_003550588.1\| PREDICTED: uncharacterized protein LOC100783615 [Glycine max]	Back alignment and taxonomy information

>gi\|356530481\|ref\|XP_003533809.1\| PREDICTED: uncharacterized protein LOC100810501 [Glycine max]	Back alignment and taxonomy information

>gi\|338808451\|gb\|AEJ07951.1\| Tac7077 [Sorghum propinquum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		260
TAIR\|locus:2125954		353	AT4G33140 [Arabidopsis thalian	0.580	0.427	0.610	2.8e-43

TAIR\|locus:2125954 AT4G33140 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 457 (165.9 bits), Expect = 2.8e-43, P = 2.8e-43
 Identities = 105/172 (61%), Positives = 113/172 (65%)

Query:    66 FKGKVNNGS---LILRGCFDSTNRVNAGADQKVGAFAPPQRVPH------LEIAAAEGCT 116
             FK K   G      LR CFDS  +     DQK  A    +R  H       E  AA G T
Sbjct:    74 FKVKGGGGKPKGFTLRSCFDSHKK----PDQKARALTQHRRFLHDLGSGPSEERAAAGTT 129

Query:   117 DARLVNGRGSSERGNPLGFFDSHLHGKIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVS 176
             D  L +GRG+  R    G      + KIVVAVD+DEVLGNFVSALNRFIADRY  NHSVS
Sbjct:   130 D--LADGRGAYLRTRFQG------NDKIVVAVDIDEVLGNFVSALNRFIADRYLSNHSVS 181

Query:   177 EYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALHKLSRYC 228
             EYHVYEFFKIWNCSR+EADLRVHEFFKT YFK GIHPLPGA K LHKLS+YC
Sbjct:   182 EYHVYEFFKIWNCSRNEADLRVHEFFKTSYFKKGIHPLPGAHKTLHKLSKYC 233


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.325   0.141   0.433    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      260       232   0.00085  113 3  11 22  0.49    32
                                                     32  0.42    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  599 (64 KB)
  Total size of DFA:  179 KB (2104 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  18.72u 0.12s 18.84t   Elapsed:  00:00:01
  Total cpu time:  18.72u 0.12s 18.84t   Elapsed:  00:00:01
  Start:  Sat May 11 08:25:47 2013   End:  Sat May 11 08:25:48 2013

GO:0016791 "phosphatase activity" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00016353001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (319 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		260
pfam06941		191	pfam06941, NT5C, 5' nucleotidase, deoxy (Pyrimidin	4e-05

>gnl\|CDD\|219235 pfam06941, NT5C, 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)	Back alignment and domain information

 Score = 42.8 bits (101), Expect = 4e-05
 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 143 KIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFF--KIWNCSRDEADLRVHE 200
            I V VD+D VL +F   + +    R+     +       F+  + +     E   ++H 
Sbjct: 2   PIRVLVDMDGVLADFYGGMLQIFNRRFPDEPHLLPEQRRGFWVWEQYGALNPELYEKLHS 61

Query: 201 FFKTPYFKTGIHPLPGAQKALHKLSRYC 228
           F+++P F   + P+PGA++AL +L+   
Sbjct: 62  FYESPGFFLDLEPIPGAREALRELADEG 89

This family consists of several 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C (NT5C) proteins. 5'(3')-Deoxyribonucleotidase is a ubiquitous enzyme in mammalian cells whose physiological function is not known. Length = 191

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		260
PF06941		191	NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol	99.92
COG4502		180	5'(3')-deoxyribonucleotidase [Nucleotide transport	99.82
COG5663		194	Uncharacterized conserved protein [Function unknow	99.24
PHA02597		197	30.2 hypothetical protein; Provisional	98.88
PRK11009		237	aphA acid phosphatase/phosphotransferase; Provisio	98.7
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	98.03
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	98.0
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	97.96
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	97.95
PRK13225		273	phosphoglycolate phosphatase; Provisional	97.95
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	97.94
TIGR01675		229	plant-AP plant acid phosphatase. This model explic	97.92
PRK11590		211	hypothetical protein; Provisional	97.91
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	97.91
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	97.86
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	97.84
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	97.82
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	97.81
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	97.81
PF03767		229	Acid_phosphat_B: HAD superfamily, subfamily IIIB (	97.78
COG0546		220	Gph Predicted phosphatases [General function predi	97.77
PRK13288		214	pyrophosphatase PpaX; Provisional	97.76
PRK09449		224	dUMP phosphatase; Provisional	97.75
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	97.74
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	97.73
TIGR01680		275	Veg_Stor_Prot vegetative storage protein. The prot	97.72
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	97.71
PRK13223		272	phosphoglycolate phosphatase; Provisional	97.67
PRK11587		218	putative phosphatase; Provisional	97.65
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	97.65
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	97.64
PLN02940		382	riboflavin kinase	97.6
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	97.59
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	97.53
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	97.51
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	97.51
PRK13226		229	phosphoglycolate phosphatase; Provisional	97.49
PRK13222		226	phosphoglycolate phosphatase; Provisional	97.39
TIGR01545		210	YfhB_g-proteo haloacid dehalogenase superfamily, s	97.38
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	97.37
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	97.36
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	97.35
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	97.33
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	97.32
PLN02575		381	haloacid dehalogenase-like hydrolase	97.31
PRK13582		205	thrH phosphoserine phosphatase; Provisional	97.3
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	97.25
PRK10563		221	6-phosphogluconate phosphatase; Provisional	97.25
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	97.25
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	97.24
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	97.24
smart00775		157	LNS2 LNS2 domain. This domain is found in Saccharo	97.23
PRK14988		224	GMP/IMP nucleotidase; Provisional	97.2
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	97.19
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	97.16
PRK10748		238	flavin mononucleotide phosphatase; Provisional	97.16
PLN02954		224	phosphoserine phosphatase	97.09
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	97.05
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	97.05
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	96.85
TIGR01689		126	EcbF-BcbF capsule biosynthesis phosphatase. Due to	96.81
COG2503		274	Predicted secreted acid phosphatase [General funct	96.81
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	96.81
PLN02811		220	hydrolase	96.8
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	96.68
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	96.59
PRK11133		322	serB phosphoserine phosphatase; Provisional	96.47
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	96.18
KOG2914		222	consensus Predicted haloacid-halidohydrolase and r	96.17
TIGR02250		156	FCP1_euk FCP1-like phosphatase, phosphatase domain	95.52
PHA02530		300	pseT polynucleotide kinase; Provisional	95.43
smart00577		148	CPDc catalytic domain of ctd-like phosphatases.	95.36
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	95.28
PF12710		192	HAD: haloacid dehalogenase-like hydrolase; PDB: 3P	94.87
KOG3120		256	consensus Predicted haloacid dehalogenase-like hyd	94.57
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	94.49
PF08235		157	LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209	94.4
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	94.03
PRK08942		181	D,D-heptose 1,7-bisphosphate phosphatase; Validate	93.44
PF06888		234	Put_Phosphatase: Putative Phosphatase; InterPro: I	93.14
PRK08238		479	hypothetical protein; Validated	92.0
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	91.64
PF08282		254	Hydrolase_3: haloacid dehalogenase-like hydrolase;	90.72
TIGR01544		277	HAD-SF-IE haloacid dehalogenase superfamily, subfa	90.38
PRK00192		273	mannosyl-3-phosphoglycerate phosphatase; Reviewed	89.83
TIGR02245		195	HAD_IIID1 HAD-superfamily subfamily IIID hydrolase	89.81
PRK10187		266	trehalose-6-phosphate phosphatase; Provisional	88.43
TIGR00685		244	T6PP trehalose-phosphatase. At least 18 distinct s	87.42
PF13344		101	Hydrolase_6: Haloacid dehalogenase-like hydrolase;	86.02
PLN02580		384	trehalose-phosphatase	85.99
PLN02177		497	glycerol-3-phosphate acyltransferase	85.88
PLN03017		366	trehalose-phosphatase	84.57
PLN02151		354	trehalose-phosphatase	83.73
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	80.57

>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins	Back alignment and domain information

Probab=99.92  E-value=6.6e-26  Score=193.72  Aligned_cols=113  Identities=24%  Similarity=0.382  Sum_probs=94.2

Q ss_pred             CeEEEEeccchhHhHHHHHHHHHHHHhCCC--cccccceeeeeeeecCCCHHHHHHHHHHHhcCcCCCCCCCCcccHHHH
Q 024936          143 KIVVAVDVDEVLGNFVSALNRFIADRYSLN--HSVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKA  220 (260)
Q Consensus       143 KmrIaIDIDGVLADfi~~fnk~~Ne~yG~n--ltveD~~~Yd~~kv~gvs~EE~~~~l~ef~e~~~Ff~~LpPIPGAqEv  220 (260)
                      |++|||||||||||+++.+++++|+.||.+  ++.++++.|...+.||+++++..+.+.+++.+++|+.+++|+|||+|+
T Consensus         2 ~i~I~iDiDgVLad~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~~g~~~~e~~~~~~~~~~~~~~f~~l~p~~gA~e~   81 (191)
T PF06941_consen    2 KIRIAIDIDGVLADFNSAFIEWFNEEFGKNPELTPEDITGYWDWEKWGITEPEFYEKLWRFYEEPGFFSNLPPIPGAVEA   81 (191)
T ss_dssp             -EEEEEESBTTTB-HHHHHHHHHHHHTTTS----GGGGTSSSHHHHHHHHSTTHHHHHHHHHTSTTTTTT--B-TTHHHH
T ss_pred             CcEEEEECCCCCcccHHHHHHHHHHHcCCCCCCCHHHhhhhhHHHHhCCCCHHHHHHHHHHHhChhhhcCCCccHHHHHH
Confidence            568999999999999999999999999999  889999887777888877777778888999999999999999999999


Q ss_pred             HHHHhhC-CcEEEEeCCC------CchhHHHHHHHhCCCCcc
Q 024936          221 LHKLSRY-CLGNMLSRTI------PLNGLRSIIRDYFRRSTL  255 (260)
Q Consensus       221 L~kLse~-yEIyIVTAR~------~~e~T~~WL~eHFPfi~~  255 (260)
                      |++|.+. ++++|||||.      ..++|++||++|||++..
T Consensus        82 l~~L~~~g~~~~~Itar~~~~~~~~~~~k~~Wl~~hf~~i~~  123 (191)
T PF06941_consen   82 LKKLRDKGHEIVIITARPPEFPDHSAEEKREWLERHFPFIPY  123 (191)
T ss_dssp             HHHHHTSTTEEEEEEE-SSSSGCCCHHHHHHHHHHHHTHHHH
T ss_pred             HHHHHHcCCcEEEEEecCccccchHHHHHHHHHHHHcCCCch
Confidence            9999885 6999999992      358999999999998763

5'(3')-deoxyribonucleotidase is a ubiquitous enzyme in mammalian cells whose physiological function is not known [].; GO: 0016791 phosphatase activity; PDB: 1Z4M_A 1Q92_A 1Q91_A 1Z4J_A 1Z4I_A 1Z4Q_A 1Z4K_A 2JAW_A 1MH9_A 1Z4L_A ....

>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG5663 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>TIGR01675 plant-AP plant acid phosphatase	Back alignment and domain information

>PRK11590 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25)	Back alignment and domain information

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>TIGR01680 Veg_Stor_Prot vegetative storage protein	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>smart00775 LNS2 LNS2 domain	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase	Back alignment and domain information

>COG2503 Predicted secreted acid phosphatase [General function prediction only]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]	Back alignment and domain information

>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>smart00577 CPDc catalytic domain of ctd-like phosphatases	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B	Back alignment and domain information

>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins []	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 []	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []	Back alignment and domain information

>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544	Back alignment and domain information

>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245	Back alignment and domain information

>PRK10187 trehalose-6-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR00685 T6PP trehalose-phosphatase	Back alignment and domain information

>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A	Back alignment and domain information

>PLN02580 trehalose-phosphatase	Back alignment and domain information

>PLN02177 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>PLN03017 trehalose-phosphatase	Back alignment and domain information

>PLN02151 trehalose-phosphatase	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		260
2i7d_A		193	5'(3')-deoxyribonucleotidase, cytosolic type; hydr	1e-16
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	2e-16
3bwv_A		180	Putative 5'(3')-deoxyribonucleotidase; NP_764060.1	2e-14

>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Length = 193	Back alignment and structure

 Score = 74.7 bits (183), Expect = 1e-16
 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 143 KIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFF--KIWNCSRDEADLRVHE 200
            + V VD+D VL +F + L R    R+     V       F   + +   R +   +V  
Sbjct: 2   SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVAS 61

Query: 201 FFKTPYFKTGIHPLPGAQKALHKLSRYCLGNM 232
            ++ P F   + P+PGA  A+ +++      +
Sbjct: 62  VYEAPGFFLDLEPIPGALDAVREMNDLPDTQV 93

PyMOL of 2i7d

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Length = 197	Back alignment and structure

>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Length = 180	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		260
3bwv_A		180	Putative 5'(3')-deoxyribonucleotidase; NP_764060.1	99.5
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	99.13
2i7d_A		193	5'(3')-deoxyribonucleotidase, cytosolic type; hydr	98.8
3ocu_A		262	Lipoprotein E; hydrolase, outer membrane; HET: NMN	98.18
3pct_A		260	Class C acid phosphatase; hydrolase, outer membran	98.18
2hdo_A		209	Phosphoglycolate phosphatase; NP_784602.1, structu	97.98
3e58_A		214	Putative beta-phosphoglucomutase; structu genomics	97.9
2gfh_A		260	Haloacid dehalogenase-like hydrolase domain conta;	97.83
3qnm_A		240	Haloacid dehalogenase-like hydrolase; structural g	97.83
2nyv_A		222	Pgpase, PGP, phosphoglycolate phosphatase; structu	97.82
3sd7_A		240	Putative phosphatase; structural genomics, haloaci	97.8
3fvv_A		232	Uncharacterized protein; unknown function, structu	97.79
2hcf_A		234	Hydrolase, haloacid dehalogenase-like family; NP_6	97.73
2i33_A		258	Acid phosphatase; HAD superfamily, hydrolase; 1.57	97.72
2i6x_A		211	Hydrolase, haloacid dehalogenase-like family; HAD	97.71
3qxg_A		243	Inorganic pyrophosphatase; hydrolase, magnesium bi	97.67
3mc1_A		226	Predicted phosphatase, HAD family; PSI2, NYSGXRC,	97.67
2ah5_A		210	COG0546: predicted phosphatases; MCSG, structural	97.64
3nuq_A		282	Protein SSM1, putative nucleotide phosphatase; sup	97.63
3l5k_A		250	Protein GS1, haloacid dehalogenase-like hydrolase	97.61
2fi1_A		190	Hydrolase, haloacid dehalogenase-like family; stru	97.61
3dv9_A		247	Beta-phosphoglucomutase; structural genomics, APC6	97.6
3kzx_A		231	HAD-superfamily hydrolase, subfamily IA, variant;	97.6
2pke_A		251	Haloacid delahogenase-like family hydrolase; NP_63	97.59
2go7_A		207	Hydrolase, haloacid dehalogenase-like family; stru	97.59
2zg6_A		220	Putative uncharacterized protein ST2620, probable	97.57
1nnl_A		225	L-3-phosphoserine phosphatase; PSP, HPSP, phospho-	97.57
1rku_A		206	Homoserine kinase; phosphoserine phosphatase, phos	97.56
2b82_A		211	APHA, class B acid phosphatase; DDDD acid phosphat	97.56
2obb_A		142	Hypothetical protein; structural genomics, PSI-2,	97.55
2pib_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	97.55
4g9b_A		243	Beta-PGM, beta-phosphoglucomutase; HAD, putative p	97.55
3kbb_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	97.54
3k1z_A		263	Haloacid dehalogenase-like hydrolase domain-conta	97.5
3s6j_A		233	Hydrolase, haloacid dehalogenase-like family; stru	97.5
3smv_A		240	S-(-)-azetidine-2-carboxylate hydrolase; haloacid	97.5
2hi0_A		240	Putative phosphoglycolate phosphatase; YP_619066.1	97.48
2p11_A		231	Hypothetical protein; putative haloacid dehalogena	97.48
3m9l_A		205	Hydrolase, haloacid dehalogenase-like family; HAD	97.48
3ed5_A		238	YFNB; APC60080, bacillus subtilis subsp. subtilis	97.46
3iru_A		277	Phoshonoacetaldehyde hydrolase like protein; phosp	97.45
4eek_A		259	Beta-phosphoglucomutase-related protein; hydrolase	97.42
4dcc_A		229	Putative haloacid dehalogenase-like hydrolase; mag	97.42
3nas_A		233	Beta-PGM, beta-phosphoglucomutase; PSI, structural	97.4
3vay_A		230	HAD-superfamily hydrolase; rossmann fold, haloacid	97.35
2om6_A		235	Probable phosphoserine phosphatase; rossmann fold,	97.33
2hoq_A		241	Putative HAD-hydrolase PH1655; haloacid dehalogena	97.3
3m1y_A		217	Phosphoserine phosphatase (SERB); NYSGXRC, PSI II,	97.3
4gib_A		250	Beta-phosphoglucomutase; rossmann fold, HAD-like,	97.29
2hsz_A		243	Novel predicted phosphatase; structural genomics,	97.21
3cnh_A		200	Hydrolase family protein; NP_295428.1, predicted h	97.19
4ap9_A		201	Phosphoserine phosphatase; hydrolase, haloacid deh	97.18
1te2_A		226	Putative phosphatase; structural genomics, phospha	97.18
4ex6_A		237	ALNB; modified rossman fold, phosphatase, magnesiu	97.16
3umg_A		254	Haloacid dehalogenase; defluorinase, hydrolase; 2.	97.13
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	97.12
2wf7_A		221	Beta-PGM, beta-phosphoglucomutase; transition stat	97.1
4eze_A		317	Haloacid dehalogenase-like hydrolase; magnesium bi	97.09
1swv_A		267	Phosphonoacetaldehyde hydrolase; HAD enzyme superf	97.08
3um9_A		230	Haloacid dehalogenase, type II; haloacid dehalogen	97.06
3ddh_A		234	Putative haloacid dehalogenase-like family hydrol;	97.02
2wm8_A		187	MDP-1, magnesium-dependent phosphatase 1; haloacid	97.02
2b0c_A		206	Putative phosphatase; alpha-D-glucose-1-phosphate,	97.02
2no4_A		240	(S)-2-haloacid dehalogenase IVA; HAD superfamily,	96.95
2oda_A		196	Hypothetical protein pspto_2114; haloacid dehaloge	96.95
1zrn_A		232	L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud	96.92
3umc_A		254	Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru	96.91
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	96.89
3kd3_A		219	Phosphoserine phosphohydrolase-like protein; csgid	96.88
2fdr_A		229	Conserved hypothetical protein; SAD, structural ge	96.84
1qq5_A		253	Protein (L-2-haloacid dehalogenase); hydrolase; 1.	96.79
2w43_A		201	Hypothetical 2-haloalkanoic acid dehalogenase; hyd	96.77
3d6j_A		225	Putative haloacid dehalogenase-like hydrolase; str	96.69
3u26_A		234	PF00702 domain protein; structural genomics, PSI-b	96.67
3umb_A		233	Dehalogenase-like hydrolase; 2.20A {Ralstonia sola	96.66
3skx_A		280	Copper-exporting P-type ATPase B; P1B-ATPase, ATP	96.66
2g80_A		253	Protein UTR4; YEL038W, UTR4 protein (unknown trans	96.66
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	96.59
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	96.53
2gmw_A		211	D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi	96.51
1xpj_A		126	Hypothetical protein; structural genomics, MCSG, p	96.39
3l8h_A		179	Putative haloacid dehalogenase-like hydrolase; HAD	96.29
1yns_A		261	E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo	96.21
2qlt_A		275	(DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac	96.18
3qgm_A		268	P-nitrophenyl phosphatase (PHO2); structural genom	95.95
3ib6_A		189	Uncharacterized protein; structural genomics, unkn	95.89
3ef0_A		372	RNA polymerase II subunit A C-terminal domain phos	95.76
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	95.71
3pdw_A		266	Uncharacterized hydrolase YUTF; structural genomic	95.48
4as2_A		327	Phosphorylcholine phosphatase; hydrolase, HAD supe	95.47
3n28_A		335	Phosphoserine phosphatase; HAD family hydrolase, s	95.3
3kc2_A		352	Uncharacterized protein YKR070W; HAD-like, mitocho	95.23
1zjj_A		263	Hypothetical protein PH1952; alpha/beta hydrolase	95.17
3epr_A		264	Hydrolase, haloacid dehalogenase-like family; stru	95.09
4gxt_A		385	A conserved functionally unknown protein; structur	94.95
1yv9_A		264	Hydrolase, haloacid dehalogenase family; hypotheti	94.68
2ho4_A		259	Haloacid dehalogenase-like hydrolase domain contai	94.39
2hx1_A		284	Predicted sugar phosphatases of the HAD superfamil	94.35
3ef1_A		442	RNA polymerase II subunit A C-terminal domain phos	92.68
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	92.66
3dao_A		283	Putative phosphatse; structural genomics, joint ce	92.5
2c4n_A		250	Protein NAGD; nucleotide phosphatase, HAD superfam	92.25
3mpo_A		279	Predicted hydrolase of the HAD superfamily; SGX, P	92.24
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	92.23
2oyc_A		306	PLP phosphatase, pyridoxal phosphate phosphatase;	92.09
3gyg_A		289	NTD biosynthesis operon putative hydrolase NTDB; P	91.94
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	91.89
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	91.78
4dw8_A		279	Haloacid dehalogenase-like hydrolase; HAD, putativ	91.59
3fzq_A		274	Putative hydrolase; YP_001086940.1, putative haloa	91.0
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	90.27
1y8a_A		332	Hypothetical protein AF1437; structural genomics,	89.91
3pgv_A		285	Haloacid dehalogenase-like hydrolase; structural g	89.52
2b30_A		301	Pvivax hypothetical protein; SGPP, structural geno	89.51
2x4d_A		271	HLHPP, phospholysine phosphohistidine inorganic py	88.48
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	88.31
3mmz_A		176	Putative HAD family hydrolase; structural genomics	88.22
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	87.35
3l7y_A		304	Putative uncharacterized protein SMU.1108C; hydrol	87.07
1qyi_A		384	ZR25, hypothetical protein; structural genomics, P	85.11
3mn1_A		189	Probable YRBI family phosphatase; structural genom	84.7
4fe3_A		297	Cytosolic 5'-nucleotidase 3; substrate complex, HA	83.41
3shq_A		320	UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila	82.96
3dnp_A		290	Stress response protein YHAX; structural PSI-2, pr	82.75
2yj3_A		263	Copper-transporting ATPase; hydrolase, P-type ATPa	83.24
3ij5_A		211	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	81.3
2fpr_A		176	Histidine biosynthesis bifunctional protein HISB;	80.6

>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis}	Back alignment and structure

Probab=99.50  E-value=6e-14  Score=114.16  Aligned_cols=108  Identities=19%  Similarity=0.287  Sum_probs=79.3

Q ss_pred             CeEEEEeccchhHhHHHHHHHHHHHHhCCCcccccceeeeeeeecCCCHHHHHHHHHHHhcCcCCCCCCCCcccHHHHHH
Q 024936          143 KIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQKALH  222 (260)
Q Consensus       143 KmrIaIDIDGVLADfi~~fnk~~Ne~yG~nltveD~~~Yd~~kv~gvs~EE~~~~l~ef~e~~~Ff~~LpPIPGAqEvL~  222 (260)
                      ++.|.+||||||.|+.+.+.+.+++.+|.+++.+++..+.+.+.++.+.++.    .+++....+...++|+||+.|.|+
T Consensus         4 ~~~viFD~DGtL~Ds~~~~~~~~~~~~g~~~~~~~~~g~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~pg~~e~L~   79 (180)
T 3bwv_A            4 RQRIAIDMDEVLADTLGAVVKAVNERADLNIKMESLNGKKLKHMIPEHEGLV----MDILKEPGFFRNLDVMPHAQEVVK   79 (180)
T ss_dssp             CCEEEEETBTTTBCHHHHHHHHHHHHSCCCCCGGGCTTCCC--------CHH----HHHHHSTTGGGSCCBCTTHHHHHH
T ss_pred             ccEEEEeCCCcccccHHHHHHHHHHHhCCCCCHHHHcCccHHHHCCchHHHH----HHHHhCcchhccCCCCcCHHHHHH
Confidence            4579999999999999999999999999988877766666666555433333    333333334457899999999999


Q ss_pred             HHhhCCcEEEEeCCC--C--chhHHHHHHHhCCCCc
Q 024936          223 KLSRYCLGNMLSRTI--P--LNGLRSIIRDYFRRST  254 (260)
Q Consensus       223 kLse~yEIyIVTAR~--~--~e~T~~WL~eHFPfi~  254 (260)
                      +|++++.+.|||++.  .  ...+..||.+||+.+.
T Consensus        80 ~L~~~~~~~i~T~~~~~~~~~~~~~~~l~~~f~~~~  115 (180)
T 3bwv_A           80 QLNEHYDIYIATAAMDVPTSFHDKYEWLLEYFPFLD  115 (180)
T ss_dssp             HHTTTSEEEEEECC--CCSHHHHHHHHHHHHCTTSC
T ss_pred             HHHhcCCEEEEeCCCCcchHHHHHHHHHHHHcCCCC
Confidence            998889999999982  2  4567999999997654

PyMOL of 3bwv

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A*	Back alignment and structure

>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A	Back alignment and structure

>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida}	Back alignment and structure

>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6	Back alignment and structure

>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311}	Back alignment and structure

>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A	Back alignment and structure

>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A	Back alignment and structure

>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile}	Back alignment and structure

>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis}	Back alignment and structure

>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6	Back alignment and structure

>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A	Back alignment and structure

>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis}	Back alignment and structure

>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A	Back alignment and structure

>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0	Back alignment and structure

>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A*	Back alignment and structure

>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens}	Back alignment and structure

>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3	Back alignment and structure

>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus}	Back alignment and structure

>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV}	Back alignment and structure

>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii}	Back alignment and structure

>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A	Back alignment and structure

>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A	Back alignment and structure

>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A	Back alignment and structure

>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25	Back alignment and structure

>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli}	Back alignment and structure

>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8}	Back alignment and structure

>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens}	Back alignment and structure

>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas}	Back alignment and structure

>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii}	Back alignment and structure

>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans}	Back alignment and structure

>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A*	Back alignment and structure

>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A	Back alignment and structure

>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0	Back alignment and structure

>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A	Back alignment and structure

>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A	Back alignment and structure

>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis}	Back alignment and structure

>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV}	Back alignment and structure

>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii}	Back alignment and structure

>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0	Back alignment and structure

>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile}	Back alignment and structure

>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6	Back alignment and structure

>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1}	Back alignment and structure

>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A	Back alignment and structure

>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6	Back alignment and structure

>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A	Back alignment and structure

>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii}	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20	Back alignment and structure

>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A	Back alignment and structure

>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp}	Back alignment and structure

>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A	Back alignment and structure

>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP}	Back alignment and structure

>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A	Back alignment and structure

>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2	Back alignment and structure

>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A*	Back alignment and structure

>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV}	Back alignment and structure

>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A	Back alignment and structure

>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa}	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp}	Back alignment and structure

>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6	Back alignment and structure

>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A	Back alignment and structure

>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A	Back alignment and structure

>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A	Back alignment and structure

>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum}	Back alignment and structure

>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A*	Back alignment and structure

>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A*	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A*	Back alignment and structure

>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18	Back alignment and structure

>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica}	Back alignment and structure

>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A	Back alignment and structure

>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0	Back alignment and structure

>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes}	Back alignment and structure

>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe}	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A*	Back alignment and structure

>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae}	Back alignment and structure

>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A*	Back alignment and structure

>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii}	Back alignment and structure

>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A	Back alignment and structure

>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii}	Back alignment and structure

>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14	Back alignment and structure

>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A	Back alignment and structure

>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii}	Back alignment and structure

>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe}	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale}	Back alignment and structure

>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14	Back alignment and structure

>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A*	Back alignment and structure

>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A*	Back alignment and structure

>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp}	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A*	Back alignment and structure

>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A	Back alignment and structure

>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24	Back alignment and structure

>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10	Back alignment and structure

>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens}	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A	Back alignment and structure

>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis}	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10	Back alignment and structure

>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13	Back alignment and structure

>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A	Back alignment and structure

>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A	Back alignment and structure

>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster}	Back alignment and structure

>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A*	Back alignment and structure

>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis}	Back alignment and structure

>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		260
d1q92a_		195	c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2	7e-14

>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 195	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: 5'(3')-deoxyribonucleotidase (dNT-2)
domain: 5'(3')-deoxyribonucleotidase (dNT-2)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.4 bits (161), Expect = 7e-14
 Identities = 20/111 (18%), Positives = 44/111 (39%), Gaps = 2/111 (1%)

Query: 143 KIVVAVDVDEVLGNFVSALNRFIADRYSLNHSVSEYHVYEF--FKIWNCSRDEADLRVHE 200
            + V VD+D VL +F     R    R+     ++      F   + +   R     +   
Sbjct: 3   ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAIS 62

Query: 201 FFKTPYFKTGIHPLPGAQKALHKLSRYCLGNMLSRTIPLNGLRSIIRDYFR 251
            +++  F   + PLPGA +A+ +++     ++   T P+   +    + + 
Sbjct: 63  IWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYA 113

PyMOL of d1q92a_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		260
d1q92a_		195	5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo	99.87
d2obba1		122	Hypothetical protein BT0820 {Bacteroides thetaiota	99.0
d1ltqa1		149	Polynucleotide kinase, phosphatase domain {Bacteri	98.63
d1xpja_		124	Hypothetical protein VC0232 {Vibrio cholerae [TaxI	98.28
d2b82a1		209	Class B acid phosphatase, AphA {Escherichia coli [	98.14
d2hdoa1		207	Phosphoglycolate phosphatase {Lactobacillus planta	98.02
d2hcfa1		228	Hypothetical protein CT1708 {Chlorobium tepidum [T	97.97
d2go7a1		204	Hypothetical protein SP2064 {Streptococcus pneumon	97.92
d2fi1a1		187	Putative hydrolase SP0805 {Streptococcus pneumonia	97.85
d1te2a_		218	Phosphatase YniC {Escherichia coli [TaxId: 562]}	97.8
d2feaa1		226	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	97.69
d1swva_		257	Phosphonoacetaldehyde hydrolase {Bacillus cereus [	97.68
d1o08a_		221	beta-Phosphoglucomutase {Lactococcus lactis [TaxId	97.44
d1nnla_		217	Phosphoserine phosphatase {Human (Homo sapiens) [T	97.4
d2hsza1		224	Phosphoglycolate phosphatase Gph {Haemophilus somn	97.38
d1zs9a1		253	E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	97.21
d2ah5a1		210	predicted phosphatase SP0104 {Streptococcus pneumo	97.21
d2fdra1		222	Hypothetical protein Atu0790 {Agrobacterium tumefa	97.07
d1u7pa_		164	Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu	97.07
d2gfha1		247	N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m	96.8
d1x42a1		230	Hypothetical protein PH0459 {Archaeon Pyrococcus h	96.45
d1j97a_		210	Phosphoserine phosphatase {Archaeon Methanococcus	96.35
d2b0ca1		197	Putative phosphatase YihX {Escherichia coli [TaxId	96.28
d1rkua_		206	Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta	95.57
d2fpwa1		161	Histidine biosynthesis bifunctional protein HisB,	94.93
d2gmwa1		182	D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc	94.87
d1cr6a1		222	Epoxide hydrolase, N-terminal domain {Mouse (Mus m	94.23
d1zd3a1		225	Epoxide hydrolase, N-terminal domain {Human (Homo	94.09
d1l6ra_		225	Phosphoglycolate phosphatase, PGPase {Archaeon The	94.06
d1ta0a_		181	Carboxy-terminal domain RNA polymerase II polypept	93.97
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	93.49
d1qq5a_		245	L-2-Haloacid dehalogenase, HAD {Xanthobacter autot	92.58
d2amya1		243	Phosphomannomutase 2 {Human (Homo sapiens) [TaxId:	92.44
d2bdua1		291	Cytosolic 5'-nucleotidase III {Mouse (Mus musculus	91.34
d1nf2a_		267	Hypothetical protein TM0651 {Thermotoga maritima [	91.0
d1zrna_		220	L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s	90.28
d1wr8a_		230	Phosphoglycolate phosphatase, PGPase {Pyrococcus h	89.87
d2g80a1		225	Protein UTR4 {Baker's yeast (Saccharomyces cerevis	85.0

>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: 5'(3')-deoxyribonucleotidase (dNT-2)
domain: 5'(3')-deoxyribonucleotidase (dNT-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=1.4e-23  Score=174.02  Aligned_cols=115  Identities=18%  Similarity=0.244  Sum_probs=98.3

Q ss_pred             CCCeEEEEeccchhHhHHHHHHHHHHHHhCCCc--ccccceeeeeeeecCCCHHHHHHHHHHHhcCcCCCCCCCCcccHH
Q 024936          141 HGKIVVAVDVDEVLGNFVSALNRFIADRYSLNH--SVSEYHVYEFFKIWNCSRDEADLRVHEFFKTPYFKTGIHPLPGAQ  218 (260)
Q Consensus       141 ~~KmrIaIDIDGVLADfi~~fnk~~Ne~yG~nl--tveD~~~Yd~~kv~gvs~EE~~~~l~ef~e~~~Ff~~LpPIPGAq  218 (260)
                      +++|+|+|||||||+||..+|.+++++.|+...  ..++...|.+.+.++.+.++..+.+.++++.+.|++++||+|||+
T Consensus         1 g~~mrI~iDmDGVL~Df~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~ff~~L~p~~gA~   80 (195)
T d1q92a_           1 GRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAV   80 (195)
T ss_dssp             CCCEEEEECSBTTTBCHHHHHHHHHHHHCTTSCCCCGGGCCSSCHHHHHHHHSTTHHHHHHHHHTSTTTTTTCCBCTTHH
T ss_pred             CCccEEEEECCCccccCHHHHHHHHHHHcCCccccChhhhccchhHHHhCCCcHHHHHHHHHHhhhhhHHhhCCcccCHH
Confidence            368999999999999999999999999998764  345666777777787777777778888899999998999999999


Q ss_pred             HHHHHHhh--CCcEEEEeCCC-----CchhHHHHHHHhCCCCcc
Q 024936          219 KALHKLSR--YCLGNMLSRTI-----PLNGLRSIIRDYFRRSTL  255 (260)
Q Consensus       219 EvL~kLse--~yEIyIVTAR~-----~~e~T~~WL~eHFPfi~~  255 (260)
                      |+|++|++  +++|+|+||+.     ....|.+||++|||.+..
T Consensus        81 e~l~~L~~~~~~~v~i~t~~~~~~~~~~~~k~~Wl~~~~~~~~~  124 (195)
T d1q92a_          81 EAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFL  124 (195)
T ss_dssp             HHHHHHHHSTTEEEEEEECCCSCCSSHHHHHHHHHHHHHCGGGG
T ss_pred             HHHHHHhhccCccceEEccccccCcchHHHHHHHHHHhcCCCCc
Confidence            99999976  46899999993     236799999999998753

PyMOL of d1q92a_

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}	Back information, alignment and structure

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure