Citrus Sinensis ID: 024995
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 259 | ||||||
| 225433644 | 390 | PREDICTED: 30S ribosomal protein S1 homo | 0.926 | 0.615 | 0.745 | 1e-99 | |
| 224131510 | 299 | predicted protein [Populus trichocarpa] | 0.926 | 0.802 | 0.742 | 7e-99 | |
| 356569689 | 378 | PREDICTED: 40S ribosomal protein S1-like | 0.926 | 0.634 | 0.725 | 6e-96 | |
| 356538073 | 383 | PREDICTED: 30S ribosomal protein S1 homo | 0.926 | 0.626 | 0.717 | 3e-94 | |
| 147802809 | 418 | hypothetical protein VITISV_006784 [Viti | 0.926 | 0.574 | 0.670 | 5e-94 | |
| 449484641 | 379 | PREDICTED: 30S ribosomal protein S1-like | 0.926 | 0.633 | 0.696 | 2e-90 | |
| 449468800 | 378 | PREDICTED: 30S ribosomal protein S1-like | 0.926 | 0.634 | 0.692 | 6e-90 | |
| 18403854 | 392 | ribosomal protein S1-like RNA-binding do | 0.915 | 0.604 | 0.709 | 7e-89 | |
| 297835412 | 392 | S1 RNA-binding domain-containing protein | 0.926 | 0.612 | 0.700 | 1e-87 | |
| 357462911 | 399 | Polyribonucleotide nucleotidyltransferas | 0.926 | 0.601 | 0.669 | 2e-84 |
| >gi|225433644|ref|XP_002264430.1| PREDICTED: 30S ribosomal protein S1 homolog [Vitis vinifera] gi|296089601|emb|CBI39420.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 368 bits (945), Expect = 1e-99, Method: Compositional matrix adjust.
Identities = 187/251 (74%), Positives = 215/251 (85%), Gaps = 11/251 (4%)
Query: 1 MSPSHSCKEPQKSIHEIAKGLTGSIISVKVIQANEEMKKLVFSEKDAVWNKYSSRVNVED 60
+SPSHSCKEP K+I EIAKGL GS+ISVKVI A+EE +KL+FSEK+A W K+S ++N+ D
Sbjct: 136 LSPSHSCKEPHKTIQEIAKGLIGSLISVKVILADEEKRKLIFSEKEAAWLKFSKQINIGD 195
Query: 61 IF---VG--RDYGAFIHLRFPDGLYHLTGLVHVSEVSWDLIQDIRDILNEGDEVRVKVIK 115
IF VG DYGAF+HLRFPDGLYHLTGLVHVSEVSWDL+QD+RD+LNEGDEVRVK++K
Sbjct: 196 IFEAMVGSVEDYGAFVHLRFPDGLYHLTGLVHVSEVSWDLVQDVRDVLNEGDEVRVKIVK 255
Query: 116 IDREKSRITLSIKQLEEDPLLETLEKVIPQDGSVISDSSSMSSSNSNTIEPLPGLGAIFE 175
+DR KSRITLSIKQLEEDPLLETL+KVIPQDGS D S+ +S+S IEPLPGL IFE
Sbjct: 256 VDRVKSRITLSIKQLEEDPLLETLDKVIPQDGSTGPD--SLRTSDSYDIEPLPGLETIFE 313
Query: 176 ELLQEDGIDDVRITRQGFEKRVVSQDLQLWLSNAPPSGKKFTLLARAGRQVQEIQLSHSL 235
ELLQE+GI DVRI+RQGFEKRVVSQDLQLWLSNAP K+FTLLARAGRQVQEIQL+ SL
Sbjct: 314 ELLQEEGISDVRISRQGFEKRVVSQDLQLWLSNAPAVDKQFTLLARAGRQVQEIQLTTSL 373
Query: 236 ----IRKASKR 242
I+KA +R
Sbjct: 374 DQEGIKKALQR 384
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224131510|ref|XP_002321102.1| predicted protein [Populus trichocarpa] gi|222861875|gb|EEE99417.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356569689|ref|XP_003553029.1| PREDICTED: 40S ribosomal protein S1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538073|ref|XP_003537529.1| PREDICTED: 30S ribosomal protein S1 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147802809|emb|CAN68483.1| hypothetical protein VITISV_006784 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449484641|ref|XP_004156938.1| PREDICTED: 30S ribosomal protein S1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449468800|ref|XP_004152109.1| PREDICTED: 30S ribosomal protein S1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18403854|ref|NP_566737.1| ribosomal protein S1-like RNA-binding domain-containing protein [Arabidopsis thaliana] gi|9293944|dbj|BAB01847.1| unnamed protein product [Arabidopsis thaliana] gi|15146284|gb|AAK83625.1| AT3g23700/MYM9_3 [Arabidopsis thaliana] gi|22655022|gb|AAM98102.1| At3g23700/MYM9_3 [Arabidopsis thaliana] gi|332643282|gb|AEE76803.1| ribosomal protein S1-like RNA-binding domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297835412|ref|XP_002885588.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331428|gb|EFH61847.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357462911|ref|XP_003601737.1| Polyribonucleotide nucleotidyltransferase [Medicago truncatula] gi|355490785|gb|AES71988.1| Polyribonucleotide nucleotidyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 259 | ||||||
| TAIR|locus:2095203 | 392 | AT3G23700 [Arabidopsis thalian | 0.926 | 0.612 | 0.684 | 4.5e-82 | |
| TAIR|locus:2010336 | 767 | AT1G12800 [Arabidopsis thalian | 0.861 | 0.290 | 0.295 | 8.3e-14 | |
| TIGR_CMR|SO_2402 | 555 | SO_2402 "ribosomal protein S1" | 0.374 | 0.174 | 0.390 | 5.8e-13 | |
| TAIR|locus:2145860 | 416 | RPS1 "ribosomal protein S1" [A | 0.451 | 0.281 | 0.333 | 4e-11 | |
| UNIPROTKB|P0AG67 | 557 | rpsA "30S ribosomal subunit pr | 0.455 | 0.211 | 0.328 | 7.1e-11 | |
| UNIPROTKB|Q71X59 | 117 | LMOf2365_2340 "S1 RNA binding | 0.277 | 0.615 | 0.428 | 8.8e-11 | |
| TIGR_CMR|NSE_0408 | 553 | NSE_0408 "ribosomal protein S1 | 0.413 | 0.193 | 0.348 | 9.6e-11 | |
| TIGR_CMR|CBU_0528 | 551 | CBU_0528 "ribosomal protein S1 | 0.277 | 0.130 | 0.443 | 1.9e-10 | |
| TIGR_CMR|CPS_2335 | 553 | CPS_2335 "ribosomal protein S1 | 0.416 | 0.195 | 0.341 | 1.9e-10 | |
| TIGR_CMR|ECH_0402 | 567 | ECH_0402 "putative ribosomal p | 0.416 | 0.190 | 0.339 | 3.7e-10 |
| TAIR|locus:2095203 AT3G23700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 823 (294.8 bits), Expect = 4.5e-82, P = 4.5e-82
Identities = 169/247 (68%), Positives = 192/247 (77%)
Query: 1 MSPSHSCKEPQKSIHEIAKGLTGSIISVKVIQANEEMKKLVFSEKDAVWNKYSSRVNVED 60
+SPS SCKEPQKSIHEIAK L GS + VKV+QA+EE +KL+ SEK A+W KYS VNV D
Sbjct: 138 LSPSRSCKEPQKSIHEIAKTLVGSKLPVKVVQADEENRKLILSEKLALWPKYSQNVNVGD 197
Query: 61 IFVGR-----DYGAFIHLRFPDGLYHLTGLVHVSEVSWDLIQDIRDILNEGDEVRVKVIK 115
+F GR DYGAFIHLRF DGLYHLTGLVHVSEVSWD +QD+RD+L +GDEVRV V
Sbjct: 198 VFNGRVGSVEDYGAFIHLRFDDGLYHLTGLVHVSEVSWDYVQDVRDVLRDGDEVRVIVTN 257
Query: 116 IDREKSRITLSIKQLEEDPLLETLEKVIPQDGXXXXXXXXXXXXXXNTIEPLPGLGAIFE 175
ID+EKSRITLSIKQLE+DPLLETL+KVI +D +TIEPLPGL I E
Sbjct: 258 IDKEKSRITLSIKQLEDDPLLETLDKVILKDSSTGSPSLSSNNG--DTIEPLPGLETILE 315
Query: 176 ELLQEDGIDDVRITRQGFEKRVVSQDLQLWLSNAPPSGKKFTLLARAGRQVQEIQLSHSL 235
ELL+EDGI+ V+I RQGFEKRVVSQDLQLWLSN PPS KF LLARAGRQVQEI L+ SL
Sbjct: 316 ELLKEDGIEAVKINRQGFEKRVVSQDLQLWLSNTPPSDGKFVLLARAGRQVQEIHLTTSL 375
Query: 236 IRKASKR 242
+ K+
Sbjct: 376 EQGGIKK 382
|
|
| TAIR|locus:2010336 AT1G12800 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2402 SO_2402 "ribosomal protein S1" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145860 RPS1 "ribosomal protein S1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AG67 rpsA "30S ribosomal subunit protein S1" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q71X59 LMOf2365_2340 "S1 RNA binding domain protein" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0408 NSE_0408 "ribosomal protein S1" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0528 CBU_0528 "ribosomal protein S1" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2335 CPS_2335 "ribosomal protein S1" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0402 ECH_0402 "putative ribosomal protein S1" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 259 | |||
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 5e-20 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 1e-19 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 1e-18 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-18 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 2e-18 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 4e-18 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 5e-18 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-17 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 5e-17 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-16 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 5e-16 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 1e-15 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 2e-15 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 3e-15 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 4e-15 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 4e-15 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 6e-15 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 1e-14 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 2e-14 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 3e-14 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 9e-14 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 5e-13 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 6e-13 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 7e-13 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 9e-13 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 5e-12 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 8e-12 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 2e-11 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 2e-11 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 3e-11 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 1e-10 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 2e-10 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 5e-10 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 9e-10 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 1e-09 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 1e-09 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 2e-09 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 3e-09 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 4e-09 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 4e-09 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 5e-09 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 1e-08 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 6e-08 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 1e-07 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 2e-07 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 4e-07 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 3e-06 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 5e-06 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 7e-06 | |
| cd05686 | 73 | cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b | 1e-05 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 1e-05 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 3e-05 | |
| cd05687 | 70 | cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec | 6e-05 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 6e-04 |
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
Score = 88.7 bits (221), Expect = 5e-20
Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 18/126 (14%)
Query: 21 LTGSIISVKVIQANEEMKKLVFS-------EKDAVWNKYSSRVNVEDIFVGR-----DYG 68
L G + KVI+ +++ +V S E+ + + + G DYG
Sbjct: 157 LEGKELEFKVIKLDKKRNNIVVSRRAVLEEERAEEREELLENLEEGQVVEGVVKNITDYG 216
Query: 69 AFIHLRFPDGLYHLTGLVHVSEVSWDLIQDIRDILNEGDEVRVKVIKIDREKSRITLSIK 128
AF+ L + GL+H++++SW + +++N GDEV+VKV+K D+EK R++L +K
Sbjct: 217 AFV------DLGGVDGLLHITDISWKRVNHPSEVVNVGDEVKVKVLKFDKEKKRVSLGLK 270
Query: 129 QLEEDP 134
QL EDP
Sbjct: 271 QLGEDP 276
|
Length = 565 |
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240192 cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 259 | |||
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 99.98 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 99.97 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 99.97 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 99.97 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 99.97 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 99.97 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 99.96 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.96 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 99.95 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 99.95 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 99.93 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.85 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.75 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.67 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 99.58 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.55 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.52 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.47 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.47 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.47 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.47 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.46 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 99.45 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.43 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.43 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.42 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 99.42 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.41 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.4 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.4 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.39 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 99.36 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.36 | |
| PRK08059 | 123 | general stress protein 13; Validated | 99.36 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.36 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.35 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.34 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.34 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 99.34 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 99.34 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 99.33 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.33 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 99.3 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 99.29 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.28 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.24 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 99.21 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 99.21 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 99.19 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 99.19 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 99.18 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 99.16 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 99.16 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 99.15 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.14 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 99.12 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 99.12 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 99.1 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 99.06 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 99.03 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 99.02 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.97 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.95 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.91 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.89 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.87 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.86 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 98.85 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.83 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 98.8 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 98.77 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 98.74 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.73 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 98.72 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.71 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.66 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 98.64 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 98.62 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 98.59 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.59 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 98.56 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 98.56 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.55 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 98.54 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 98.51 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 98.5 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 98.45 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 98.43 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 98.43 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 98.42 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 98.41 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 98.4 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.4 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 98.38 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 98.36 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 98.36 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 98.34 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 98.33 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 98.32 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 98.31 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.31 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 98.29 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 98.28 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 98.27 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 98.24 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.23 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 98.23 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 98.23 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 98.22 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 98.19 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.17 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.06 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.02 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.01 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.0 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 97.97 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 97.92 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 97.91 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 97.88 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 97.87 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 97.78 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 97.73 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 97.72 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 97.7 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 97.62 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 97.62 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 97.55 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 97.53 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 97.53 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 97.46 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 97.44 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 97.41 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 97.4 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 97.33 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 97.32 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 97.31 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.25 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 97.24 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 97.23 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.16 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 97.01 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 96.98 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 96.97 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 96.94 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 96.78 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 96.69 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 96.68 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 96.66 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 96.56 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 96.53 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.45 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.19 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 96.17 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.11 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 96.05 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 96.04 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 96.02 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 95.91 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 95.65 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 95.25 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 94.86 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 94.78 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 94.56 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 93.87 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 90.89 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 89.8 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 87.46 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 87.37 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 85.7 | |
| COG4044 | 247 | Uncharacterized protein conserved in archaea [Func | 82.33 | |
| PF09876 | 103 | DUF2103: Predicted metal-binding protein (DUF2103) | 82.06 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 81.48 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 81.42 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 81.2 | |
| COG1530 | 487 | CafA Ribonucleases G and E [Translation, ribosomal | 80.38 |
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-43 Score=335.03 Aligned_cols=206 Identities=26% Similarity=0.524 Sum_probs=187.1
Q ss_pred hhcccCCCCEEEEEEEEEeCCCCEEEEEechhh-------HhhhccCCCCCCEEEEE-----eeeEEEEEccCCCCccEE
Q 024995 16 EIAKGLTGSIISVKVIQANEEMKKLVFSEKDAV-------WNKYSSRVNVEDIFVGR-----DYGAFIHLRFPDGLYHLT 83 (259)
Q Consensus 16 ~~~~~~vG~~v~~~Vl~id~~~~~v~lS~k~~~-------~~~~~~~l~~G~iv~G~-----~~G~fV~l~~~~g~~gi~ 83 (259)
+++..++|+++.++|+++|.+++++++|+|... ++.+++.+++|+++.|+ +|||||+|+ |++
T Consensus 143 ~d~~~~~Gk~~~~kiie~d~~~n~vv~SrR~~~e~~~~~~r~e~~~~l~~G~vV~G~V~~It~~GafVdig------Gvd 216 (541)
T COG0539 143 RDLDPLIGKELEFKILELDKKRNNVVLSRRAVLEEERSEQREELLNKLEVGEVVEGVVKNITDYGAFVDIG------GVD 216 (541)
T ss_pred ccccccCCceEEEEEEEEccccCcEEEEhHHHhhHHHHHHHHHHHhcCCCCceEEEEEEEeecCcEEEEec------Cee
Confidence 445678999999999999999999999999753 45678999999999999 999999998 899
Q ss_pred EEEEceecCcccccChhhhcCCCCeEEEEEEEEeCCCCeeEEEEeccccCcchHhhhhhcCCCCccccCCCCccccceee
Q 024995 84 GLVHVSEVSWDLIQDIRDILNEGDEVRVKVIKIDREKSRITLSIKQLEEDPLLETLEKVIPQDGSVISDSSSMSSSNSNT 163 (259)
Q Consensus 84 glv~isels~~~~~~~~~~~~~Gd~V~vkVl~id~~~~ri~lS~K~~~~~p~~~~~~~~~~~g~~~~~~~g~~v~G~V~~ 163 (259)
||||++||||.++.+|++.|++||+|+|+|+++|.+++||+||+|++.++||.... +.++. |+.+.|+|++
T Consensus 217 GLlHiseiS~~rv~~P~~vvkvGd~VkvkVi~~D~e~~RVsLSlK~l~~dPw~~i~-~~~~~--------g~~v~G~Vt~ 287 (541)
T COG0539 217 GLLHISEISWKRVDHPSEVVKVGDEVKVKVISLDEERGRVSLSLKQLEEDPWEGIE-KKYPV--------GDKVEGKVTN 287 (541)
T ss_pred eEEehhhccccccCCHHHhcccCCEEEEEEEEEccCCCeEEEEehhcccCcHHHHh-hhcCC--------CCEEEEEEEE
Confidence 99999999999999999999999999999999999999999999999999997654 44675 4559999999
Q ss_pred eccCCCccceeeeecccCCeeEEE-EccccccccccchhhhhhcccCCCCCcceeeeccCCCee----EEEecccchhhh
Q 024995 164 IEPLPGLGAIFEELLQEDGIDDVR-ITRQGFEKRVVSQDLQLWLSNAPPSGKKFTLLARAGRQV----QEIQLSHSLIRK 238 (259)
Q Consensus 164 i~~~G~~~~~fv~l~~~~gv~gl~-~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~G~~V----~~v~~~~~~i~l 238 (259)
++||| +|+++ .+||+||+ +|+++ |..... |.. +++.||.| ++||++++||||
T Consensus 288 i~~~G----afVei--~~GvEGlvhvSEis------------w~~~~~-P~e----vv~~Gq~V~V~Vl~id~e~rRIsL 344 (541)
T COG0539 288 LTDYG----AFVEI--EEGVEGLVHVSEIS------------WTKKNV-PSE----VVKVGQEVEVKVLDIDPERRRISL 344 (541)
T ss_pred eecCc----EEEEe--cCCccceeechhhc------------ccccCC-HHH----hcccCCEEEEEEEeeCchhceEEe
Confidence 99999 99999 99999999 89998 665554 554 77999999 899999999999
Q ss_pred hhchhhhhhhHHhhhhcccCC
Q 024995 239 ASKRHCNEYWNVFHETAIVNN 259 (259)
Q Consensus 239 s~k~~~~~p~~~~~~~~~~~~ 259 (259)
||||+.++||+.++++|++|.
T Consensus 345 ~iKq~~~~pw~~~~~~~~~g~ 365 (541)
T COG0539 345 GLKQLKENPWEEFADKHPVGD 365 (541)
T ss_pred eehhhhcChhhhhhhhcCCCC
Confidence 999999999999999999984
|
|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >COG4044 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PF09876 DUF2103: Predicted metal-binding protein (DUF2103); InterPro: IPR018664 This family of various putative metal binding prokaryotic proteins has no known function | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >COG1530 CafA Ribonucleases G and E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 259 | ||||
| 2k4k_A | 130 | Solution Structure Of Gsp13 From Bacillus Subtilis | 8e-10 | ||
| 2aho_B | 266 | Structure Of The Archaeal Initiation Factor Eif2 Al | 4e-06 | ||
| 3aev_A | 275 | Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex | 7e-06 | ||
| 1yz6_A | 274 | Crystal Structure Of Intact Alpha Subunit Of Aif2 F | 8e-06 | ||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 1e-05 | ||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 2e-05 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 2e-05 | ||
| 1sro_A | 76 | S1 Rna Binding Domain, Nmr, 20 Structures Length = | 9e-05 |
| >pdb|2K4K|A Chain A, Solution Structure Of Gsp13 From Bacillus Subtilis Length = 130 | Back alignment and structure |
|
| >pdb|2AHO|B Chain B, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 266 | Back alignment and structure |
| >pdb|3AEV|A Chain A, Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex From Pyrococcus Horikoshii Ot3 Length = 275 | Back alignment and structure |
| >pdb|1YZ6|A Chain A, Crystal Structure Of Intact Alpha Subunit Of Aif2 From Pyrococcus Abyssi Length = 274 | Back alignment and structure |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 259 | |||
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 4e-22 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 8e-22 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 2e-21 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 2e-04 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 4e-21 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 9e-06 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 5e-19 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 1e-18 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 2e-18 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 2e-17 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 1e-16 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 1e-15 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 2e-15 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 2e-15 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 7e-15 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 9e-13 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 8e-12 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 2e-07 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 3e-07 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 4e-07 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 4e-07 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 2e-06 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 4e-05 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 7e-05 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 5e-04 |
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
Score = 87.9 bits (218), Expect = 4e-22
Identities = 35/108 (32%), Positives = 61/108 (56%), Gaps = 10/108 (9%)
Query: 53 SSRVNVEDIFVGR-----DYGAFIHLRFPDGLYHLTGLVHVSEVSWDLIQDIRDILNEGD 107
+++ V ++ G+ YGAF+ L GLVH+SEV+ ++DI + L+ GD
Sbjct: 2 AAKFEVGSVYTGKVTGLQAYGAFVAL-----DEETQGLVHISEVTHGFVKDINEHLSVGD 56
Query: 108 EVRVKVIKIDREKSRITLSIKQLEEDPLLETLEKVIPQDGSVISDSSS 155
EV+VKV+ +D EK +I+LSI+ + P + + P+ V ++S+
Sbjct: 57 EVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEAST 104
|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Length = 187 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A Length = 179 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 172 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 259 | |||
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.92 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 99.84 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 99.74 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.7 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.69 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 99.67 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 99.62 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 99.61 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 99.61 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.61 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.59 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 99.59 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.55 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 99.55 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 99.47 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 99.42 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 99.37 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 99.35 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 99.31 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 99.27 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.26 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 99.23 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 99.17 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 99.16 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 99.13 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 99.12 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 99.1 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 99.08 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 99.03 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 99.03 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 99.03 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 99.02 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 99.01 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 99.0 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.0 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 98.96 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 98.96 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 98.94 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 98.93 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 98.9 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 98.87 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 98.87 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 98.74 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 98.73 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 98.71 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 98.69 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 98.65 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 98.64 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 98.48 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 98.28 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 98.27 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 98.25 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 98.25 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 98.16 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 98.09 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 98.06 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 98.05 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 98.04 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 98.01 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 97.94 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 97.9 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 97.86 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 97.84 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 97.81 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 97.68 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 97.65 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 97.63 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 97.63 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 97.58 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 97.56 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 97.39 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 97.37 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 97.16 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 97.14 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 97.07 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 96.76 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 96.44 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 95.7 | |
| 2nn6_G | 289 | Exosome complex exonuclease RRP40; RNA, exosome, P | 95.57 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 95.43 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 95.23 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 95.21 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 95.05 | |
| 2r7d_A | 469 | Ribonuclease II family protein; structural genomic | 94.93 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 93.64 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 93.41 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 89.33 | |
| 1jjg_A | 102 | M156R; beta barrel, S1 motif, OB fold, MYXV156R, N | 88.56 |
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
Probab=99.92 E-value=1.1e-25 Score=201.54 Aligned_cols=174 Identities=13% Similarity=0.079 Sum_probs=141.9
Q ss_pred CCCCEEEEEEEEEeCCCCEEEEEechhhHhhhccCCCCCCEEEEE------eeeEEEEEccCCCCc-cEEEEEEceecCc
Q 024995 21 LTGSIISVKVIQANEEMKKLVFSEKDAVWNKYSSRVNVEDIFVGR------DYGAFIHLRFPDGLY-HLTGLVHVSEVSW 93 (259)
Q Consensus 21 ~vG~~v~~~Vl~id~~~~~v~lS~k~~~~~~~~~~l~~G~iv~G~------~~G~fV~l~~~~g~~-gi~glv~isels~ 93 (259)
.+||+|+|+|+ .|.+ +++++|.+.+ .+++|+++.|+ +|||||+++ . +.+||||+||++|
T Consensus 41 ~vGdevev~v~-~d~~-~r~iat~~~p-------~~~~G~~~~g~V~~v~~~~GaFVdiG-----~~~~d~lvp~sel~~ 106 (285)
T 3go5_A 41 TVGDTVKGFAY-TDMK-QKLRLTTLEV-------TATQDQFGWGRVTEVRKDLGVFVDTG-----LPDKEIVVSLDILPE 106 (285)
T ss_dssp CTTSEEEEEEE-ECTT-SCEEEECSCC-------CSCSSSCEEEEEEEEETTTEEEEECS-----CTTCCEEEEGGGSCS
T ss_pred ccCCEEEEEEE-ECCC-CCEEEecccc-------cccCCCEEEEEEEEEccCceEEEEEC-----CCCcEEEEEHHHCCc
Confidence 59999999986 5754 6777887654 57899999998 399999997 4 5899999999998
Q ss_pred ccccChhhhcCCCCeEEEEEEEEeCCCCeeEEEEecc-ccCcchHhhhhhcCCCCccccCCCCccccceeeeccCCCccc
Q 024995 94 DLIQDIRDILNEGDEVRVKVIKIDREKSRITLSIKQL-EEDPLLETLEKVIPQDGSVISDSSSMSSSNSNTIEPLPGLGA 172 (259)
Q Consensus 94 ~~~~~~~~~~~~Gd~V~vkVl~id~~~~ri~lS~K~~-~~~p~~~~~~~~~~~g~~~~~~~g~~v~G~V~~i~~~G~~~~ 172 (259)
.+. ..+++||.+.|+ +++|+ ++||.+|+|+. ..+||....++ ++ +|+.++|+|+++++||
T Consensus 107 ~~~----~~~~~Gd~v~v~-l~iD~-~~Ri~ls~k~~~~~~~~~~~~~~-~~--------~G~~V~g~V~~i~~~G---- 167 (285)
T 3go5_A 107 LKE----LWPKKGDQLYIR-LEVDK-KDRIWGLLAYQEDFQRLARPAYN-NM--------QNQNWPAIVYRLKLSG---- 167 (285)
T ss_dssp SGG----GSCCTTCEEEEE-EEECT-TSCEEEEECCHHHHHHHCCCCCS-CC--------TTCEEEEEEEEEETTE----
T ss_pred ccc----cccCCCCEEEEE-EEECC-CCcEEEEehhhhhcchhhhhhhh-CC--------CCCEEEEEEEEEeCCc----
Confidence 653 346899999766 59998 79999999976 46788654333 34 3677999999999999
Q ss_pred eee-eecccCCeeEEE-EccccccccccchhhhhhcccCCCCCcceeeeccCCCee----EEEecccchhhhhhchhhhh
Q 024995 173 IFE-ELLQEDGIDDVR-ITRQGFEKRVVSQDLQLWLSNAPPSGKKFTLLARAGRQV----QEIQLSHSLIRKASKRHCNE 246 (259)
Q Consensus 173 ~fv-~l~~~~gv~gl~-~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~G~~V----~~v~~~~~~i~ls~k~~~~~ 246 (259)
+|+ .+ ++|+.||+ +|+++ . .+++||+| ++|+.+.+||+||+|++...
T Consensus 168 ~fV~~i--~~g~~Glih~SEl~---------------------~----~l~~Gd~v~~~V~~id~~d~kI~LSlk~~~~~ 220 (285)
T 3go5_A 168 TFVYLP--ENNMLGFIHPSERY---------------------A----EPRLGQVLDARVIGFREVDRTLNLSLKPRSFE 220 (285)
T ss_dssp EEEEET--TTTEEEEECGGGCS---------------------S----CCCTTCEEEEEEEEEETTTTEEEEECSCCCCC
T ss_pred EEEEEe--CCCeEEEEEHHHcc---------------------c----cCCCCCEEEEEEEEEECCCCeEEEEeChhhhh
Confidence 998 88 89999999 66654 1 24899998 79999999999999999888
Q ss_pred hhHHhhhh
Q 024995 247 YWNVFHET 254 (259)
Q Consensus 247 p~~~~~~~ 254 (259)
+++..+++
T Consensus 221 ~~~~~a~~ 228 (285)
T 3go5_A 221 MLENDAQM 228 (285)
T ss_dssp CCCHHHHH
T ss_pred ccchHHHH
Confidence 88876654
|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1jjg_A M156R; beta barrel, S1 motif, OB fold, MYXV156R, NESG project, structural genomics, EIF-2A homolog, PSI, protein structure initiative; NMR {Myxoma virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 259 | ||||
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 4e-13 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 1e-11 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 3e-11 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 3e-11 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 1e-10 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 8e-09 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 1e-08 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 3e-08 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 4e-08 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 6e-08 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 1e-07 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 2e-07 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 8e-06 | |
| d2ja9a1 | 90 | b.40.4.5 (A:62-151) S1-domain of exosome component | 8e-04 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 0.001 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 0.001 | |
| d2nn6i1 | 125 | b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {H | 0.002 |
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase species: Escherichia coli [TaxId: 562]
Score = 60.9 bits (148), Expect = 4e-13
Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 11/81 (13%)
Query: 54 SRVNVEDIFVGR-----DYGAFIHLRFPDGLYHLTGLVHVSEVSWDLIQDIRDILNEGDE 108
+ + V ++ G+ D+GAF+ + GLVH+S+++ ++ + D L G E
Sbjct: 1 AEIEVGRVYTGKVTRIVDFGAFVAIG-----GGKEGLVHISQIADKRVEKVTDYLQMGQE 55
Query: 109 VRVKVIKIDREKSRITLSIKQ 129
V VKV+++DR+ RI LSIK+
Sbjct: 56 VPVKVLEVDRQG-RIRLSIKE 75
|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 259 | |||
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.69 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.66 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.65 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.63 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.56 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.51 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.42 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.4 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.38 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 99.18 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.15 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 99.11 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.09 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 99.07 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.06 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.04 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.01 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.9 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 98.86 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.76 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 98.68 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 98.66 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 98.64 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.59 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.57 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 98.3 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 97.93 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 97.87 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 97.84 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.81 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 97.44 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.34 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 97.23 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 96.22 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 95.52 | |
| d1luza_ | 85 | Viral structural mimic of eIF2alpha {Vaccinia viru | 95.37 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 94.61 | |
| d1jjga_ | 102 | Viral structural mimic of eIF2alpha {Myxoma virus, | 94.56 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 92.82 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 92.53 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 89.7 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 86.79 | |
| d1wfqa_ | 89 | Cold shock domain protein E1 (UNR) {Human (Homo sa | 83.6 | |
| d1k3ra1 | 71 | Hypothetical protein MTH1 (MT0001), insert domain | 83.34 | |
| d1h95a_ | 79 | Y-box protein 1 cold shock domain (YB1-CSD) {Human | 82.12 |
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase species: Escherichia coli [TaxId: 562]
Probab=99.69 E-value=6.5e-18 Score=120.66 Aligned_cols=70 Identities=39% Similarity=0.715 Sum_probs=66.0
Q ss_pred CCCCCCEEEEE-----eeeEEEEEccCCCCccEEEEEEceecCcccccChhhhcCCCCeEEEEEEEEeCCCCeeEEEEec
Q 024995 55 RVNVEDIFVGR-----DYGAFIHLRFPDGLYHLTGLVHVSEVSWDLIQDIRDILNEGDEVRVKVIKIDREKSRITLSIKQ 129 (259)
Q Consensus 55 ~l~~G~iv~G~-----~~G~fV~l~~~~g~~gi~glv~isels~~~~~~~~~~~~~Gd~V~vkVl~id~~~~ri~lS~K~ 129 (259)
++++|+++.|+ +||+||+|+ .+++||||+++++|.++.+|++.|++||+|+|+|+++|+ ++||.||+|+
T Consensus 2 d~kvG~iv~G~V~~v~~~G~fV~l~-----~~~~Glv~~sels~~~~~~~~~~~~~G~~v~v~Vi~id~-~~ri~LS~k~ 75 (76)
T d1sroa_ 2 EIEVGRVYTGKVTRIVDFGAFVAIG-----GGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDR-QGRIRLSIKE 75 (76)
T ss_dssp CCCTTSEEEEEEEEEETTEEEEECS-----SSCCCBCCTTSSCSSCCSCHHHHCCTTCEEEEEEEECCT-TCCCEEEECC
T ss_pred CCCCCCEEEEEEEEEeCcEEEEEeC-----CCCEEEEEhHHhCccccCCHHHccCCCCEEEEEEEEECC-CCCEEEEEEc
Confidence 68999999999 999999998 489999999999999999999999999999999999996 6899999997
Q ss_pred c
Q 024995 130 L 130 (259)
Q Consensus 130 ~ 130 (259)
+
T Consensus 76 a 76 (76)
T d1sroa_ 76 A 76 (76)
T ss_dssp C
T ss_pred C
Confidence 4
|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1luza_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ra1 b.40.4.10 (A:93-163) Hypothetical protein MTH1 (MT0001), insert domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|