Citrus Sinensis ID: 025159

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MDQGSEMGSISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVLI
ccccccccccccccEEEcccccccccccEEccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHccccccccc
ccccccccHcccccEEEEccccEccEEEcccccccccccHHHHHHHHHHHHccccEEEccHHHccHHHHHHHHcccEcccccEcHHHcEEEEEEcHHHccHHHHHHHHHHHHHHHccccEcEEEEcccccEccccccccEccccEEcccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHccccccEEEEEcEccEccHHHHHHHHHcccEEEEEcccccHHHHcccccHcccHHHHHHHHHccccccEEEc
mdqgsemgsisipdvplkssnrrmpvlglgtaaspfsgsetTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVihwpvsskpgsyefpikkedflpmdFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDIlatakippaanqvemnplwqqNKLREFCKAKDIQLaayaplgargtiwgsnrVMECEVLKEIAEAKGKTVAQVLI
mdqgsemgsisipdvplkssnRRMPVLGLgtaaspfsgseTTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPlgargtiwgsNRVMECEVLKEiaeakgktvaqvli
MDQGSEMGSISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVLI
****************************************TTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEA**********
***********IPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVLI
**********SIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAK*********
**********SIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQGSEMGSISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query257 2.2.26 [Sep-21-2011]
Q9SQ64321 Non-functional NADPH-depe N/A no 0.945 0.757 0.643 5e-93
Q9SQ67321 NADPH-dependent codeinone N/A no 0.964 0.772 0.618 5e-87
Q9SQ69321 NADPH-dependent codeinone N/A no 0.964 0.772 0.622 8e-87
Q9SQ68321 NADPH-dependent codeinone N/A no 0.964 0.772 0.610 1e-79
Q9SQ70321 NADPH-dependent codeinone N/A no 0.964 0.772 0.602 2e-79
B9VRJ2321 NADPH-dependent codeinone N/A no 0.964 0.772 0.602 1e-78
Q7G764321 Probable NAD(P)H-dependen no no 0.961 0.769 0.544 2e-78
P26690315 NAD(P)H-dependent 6'-deox no no 0.953 0.777 0.576 4e-78
Q7G765322 Probable NAD(P)H-dependen no no 0.976 0.779 0.531 6e-78
Q84TF0314 Aldo-keto reductase famil no no 0.891 0.729 0.472 9e-57
>sp|Q9SQ64|COR2_PAPSO Non-functional NADPH-dependent codeinone reductase 2 OS=Papaver somniferum GN=COR2 PE=1 SV=1 Back     alignment and function desciption
 Score =  340 bits (873), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 200/244 (81%), Gaps = 1/244 (0%)

Query: 12  IPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGD 71
           +P V L SS R MP+LG+GTA +   GSE  KLAIL+A+++GYRHFDTA +YQTE  LG+
Sbjct: 6   VPVVTL-SSGRGMPILGMGTAENNLQGSERVKLAILKAIEVGYRHFDTAFVYQTEGSLGE 64

Query: 72  AIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSS 131
           A+AEAL  G+IKSRDELFI SKLWC+DA+ + V+PALQ SL NL+LEY+DLY+IHWPVS 
Sbjct: 65  AVAEALQNGLIKSRDELFITSKLWCADAYPDHVLPALQNSLRNLKLEYLDLYLIHWPVSL 124

Query: 132 KPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPA 191
           KPG +  PI K++  P+D+KSVW AME+CQ LG TK+IGVSNFSCKKL  ++ATA IPPA
Sbjct: 125 KPGKFVHPIPKDEIFPIDYKSVWAAMEKCQMLGLTKSIGVSNFSCKKLHYLMATANIPPA 184

Query: 192 ANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKT 251
            NQVEMNP+WQQ KLR++CK  +I + AY+PLGA+GT+WGS+ VM+ EVL +I++ +GK+
Sbjct: 185 VNQVEMNPIWQQQKLRDYCKTNNIMVTAYSPLGAKGTMWGSSGVMDSEVLNQISQVRGKS 244

Query: 252 VAQV 255
           VAQV
Sbjct: 245 VAQV 248

Papaver somniferum (taxid: 3469)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9SQ67|COR14_PAPSO NADPH-dependent codeinone reductase 1-4 OS=Papaver somniferum GN=COR1.4 PE=1 SV=2 Back     alignment and function description
>sp|Q9SQ69|COR12_PAPSO NADPH-dependent codeinone reductase 1-2 OS=Papaver somniferum GN=COR1.2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ68|COR13_PAPSO NADPH-dependent codeinone reductase 1-3 OS=Papaver somniferum GN=COR1.3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ70|COR11_PAPSO NADPH-dependent codeinone reductase 1-1 OS=Papaver somniferum GN=COR1.1 PE=1 SV=1 Back     alignment and function description
>sp|B9VRJ2|COR15_PAPSO NADPH-dependent codeinone reductase 1-5 OS=Papaver somniferum GN=COR1.5 PE=1 SV=1 Back     alignment and function description
>sp|Q7G764|NADO1_ORYSJ Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1 Back     alignment and function description
>sp|P26690|6DCS_SOYBN NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|Q7G765|NADO2_ORYSJ Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1 Back     alignment and function description
>sp|Q84TF0|AKRCA_ARATH Aldo-keto reductase family 4 member C10 OS=Arabidopsis thaliana GN=AKR4C10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
224102497305 predicted protein [Populus trichocarpa] 0.910 0.767 0.777 1e-106
255558364325 aldo-keto reductase, putative [Ricinus c 0.968 0.766 0.739 1e-105
40781598321 reductase 2 [Hydrangea macrophylla] gi|4 0.968 0.775 0.722 1e-104
255558366320 aldo-keto reductase, putative [Ricinus c 0.945 0.759 0.705 4e-98
297737569 363 unnamed protein product [Vitis vinifera] 0.992 0.702 0.647 3e-96
225424496320 PREDICTED: probable NAD(P)H-dependent ox 0.941 0.756 0.669 1e-95
255561785325 aldo-keto reductase, putative [Ricinus c 0.957 0.756 0.668 2e-95
225424498318 PREDICTED: probable NAD(P)H-dependent ox 0.953 0.770 0.663 4e-95
297737568 642 unnamed protein product [Vitis vinifera] 0.968 0.387 0.657 5e-95
75266185321 RecName: Full=Non-functional NADPH-depen 0.945 0.757 0.643 3e-91
>gi|224102497|ref|XP_002312700.1| predicted protein [Populus trichocarpa] gi|222852520|gb|EEE90067.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/234 (77%), Positives = 209/234 (89%)

Query: 24  MPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIK 83
           MPVLG+GT+ASP  GS+ TK AIL+A+++G+RHFDTATLY TE+PLG+AI+EALS G+IK
Sbjct: 1   MPVLGMGTSASPLEGSDETKTAILQAIEIGHRHFDTATLYLTEEPLGEAISEALSRGLIK 60

Query: 84  SRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKE 143
           SRDELFI SKLWCSDAH +LV+PAL+KSL NLQLEY+DLY+IHWPVSS+ G+YEFPI K 
Sbjct: 61  SRDELFITSKLWCSDAHGDLVLPALKKSLRNLQLEYLDLYLIHWPVSSRSGTYEFPINKG 120

Query: 144 DFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQ 203
           D LPMDFKSVWEAM+ECQ+LG TK+IGVSNFSCKKL DILA AKIPPA NQVE+NPLWQQ
Sbjct: 121 DLLPMDFKSVWEAMQECQDLGLTKSIGVSNFSCKKLSDILAFAKIPPAVNQVEINPLWQQ 180

Query: 204 NKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVLI 257
           NKLREFC+A  I L AYAPLG RGTIWGSNRVME EVL+EIA AKGK+VAQV +
Sbjct: 181 NKLREFCEANGIVLTAYAPLGTRGTIWGSNRVMENEVLREIATAKGKSVAQVCL 234

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255558364|ref|XP_002520209.1| aldo-keto reductase, putative [Ricinus communis] gi|223540701|gb|EEF42264.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|40781598|gb|AAR89808.1| reductase 2 [Hydrangea macrophylla] gi|40781601|gb|AAR89810.1| reductase 2 [Hydrangea macrophylla] Back     alignment and taxonomy information
>gi|255558366|ref|XP_002520210.1| aldo-keto reductase, putative [Ricinus communis] gi|223540702|gb|EEF42265.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297737569|emb|CBI26770.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424496|ref|XP_002285198.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561785|ref|XP_002521902.1| aldo-keto reductase, putative [Ricinus communis] gi|223538940|gb|EEF40538.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225424498|ref|XP_002285202.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737568|emb|CBI26769.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|75266185|sp|Q9SQ64.1|COR2_PAPSO RecName: Full=Non-functional NADPH-dependent codeinone reductase 2 gi|6478216|gb|AAF13742.1|AF108438_1 putative NADPH-dependent oxidoreductase [Papaver somniferum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
TAIR|locus:2025926320 AT1G59950 [Arabidopsis thalian 0.933 0.75 0.662 7.7e-87
UNIPROTKB|Q9SQ64321 COR2 "Non-functional NADPH-dep 0.961 0.769 0.636 1.4e-85
TAIR|locus:2025936326 AT1G59960 [Arabidopsis thalian 0.968 0.763 0.599 5.6e-84
UNIPROTKB|Q9SQ67321 COR1.4 "NADPH-dependent codein 0.964 0.772 0.618 1.2e-79
UNIPROTKB|Q9SQ69321 COR1.2 "NADPH-dependent codein 0.964 0.772 0.622 2.6e-79
UNIPROTKB|Q9SQ68321 COR1.3 "NADPH-dependent codein 0.964 0.772 0.610 3.8e-78
UNIPROTKB|Q9SQ70321 COR1.1 "NADPH-dependent codein 0.964 0.772 0.602 1e-77
UNIPROTKB|B9VRJ2321 COR1.5 "NADPH-dependent codein 0.964 0.772 0.602 2.7e-77
UNIPROTKB|E7C196327 E7C196 "2-carbomethoxy-3-tropi 0.953 0.749 0.529 5.6e-68
TAIR|locus:2065639314 AKR4C10 "Aldo-keto reductase f 0.898 0.735 0.468 5.5e-54
TAIR|locus:2025926 AT1G59950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 868 (310.6 bits), Expect = 7.7e-87, P = 7.7e-87
 Identities = 159/240 (66%), Positives = 198/240 (82%)

Query:    16 PLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAE 75
             P+ S +  MPVL LGTAASP       K  +LEA+KLGYRHFDT+  YQTE+PLG+A+AE
Sbjct:     7 PIGSVHHLMPVLALGTAASPPPEPIVLKRTVLEAIKLGYRHFDTSPRYQTEEPLGEALAE 66

Query:    76 ALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGS 135
             A+S G+I+SR ELF+ SKLWC+DAH  LVVPA+Q+SLE L+L+Y+DLY+IHWPVSSKPG 
Sbjct:    67 AVSLGLIQSRSELFVTSKLWCADAHGGLVVPAIQRSLETLKLDYLDLYLIHWPVSSKPGK 126

Query:   136 YEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQV 195
             Y+FPI+++DFLPMD+++VW  MEECQ LG  K IGVSNFSCKKL  IL+ AKIPP+ NQV
Sbjct:   127 YKFPIEEDDFLPMDYETVWSEMEECQRLGVAKCIGVSNFSCKKLQHILSIAKIPPSVNQV 186

Query:   196 EMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQV 255
             EM+P+WQQ KLRE CK+K I + AY+ LG+RG  WG++++ME +VLKEIAEAKGKTVAQV
Sbjct:   187 EMSPVWQQRKLRELCKSKGIVVTAYSVLGSRGAFWGTHKIMESDVLKEIAEAKGKTVAQV 246
GO:0009507 "chloroplast" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
UNIPROTKB|Q9SQ64 COR2 "Non-functional NADPH-dependent codeinone reductase 2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
TAIR|locus:2025936 AT1G59960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ67 COR1.4 "NADPH-dependent codeinone reductase 1-4" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ69 COR1.2 "NADPH-dependent codeinone reductase 1-2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ68 COR1.3 "NADPH-dependent codeinone reductase 1-3" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ70 COR1.1 "NADPH-dependent codeinone reductase 1-1" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|B9VRJ2 COR1.5 "NADPH-dependent codeinone reductase 1-5" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|E7C196 E7C196 "2-carbomethoxy-3-tropinone reductase" [Erythroxylum coca (taxid:289672)] Back     alignment and assigned GO terms
TAIR|locus:2065639 AKR4C10 "Aldo-keto reductase family 4 member C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VIII001733
hypothetical protein (305 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 1e-80
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 2e-66
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 5e-48
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 8e-48
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 4e-43
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 5e-30
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 3e-13
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 9e-12
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 4e-08
PRK09912346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 4e-07
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 1e-06
PLN02587314 PLN02587, PLN02587, L-galactose dehydrogenase 9e-04
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 0.001
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score =  243 bits (622), Expect = 1e-80
 Identities = 91/239 (38%), Positives = 137/239 (57%), Gaps = 27/239 (11%)

Query: 19  SSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALS 78
           ++   +P +GLGT        E    A+  A++LGYR  DTA +Y  E+ +G+AI E+  
Sbjct: 9   NNGVEIPAIGLGTW--QIGDDEWAVRAVRAALELGYRLIDTAEIYGNEEEVGEAIKES-- 64

Query: 79  TGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEF 138
            G+   R+ELFI +K+W SD   +  + AL+ SL+ L L+Y+DLY+IHWPV +K    E 
Sbjct: 65  -GVP--REELFITTKVWPSDLGYDETLKALEASLKRLGLDYVDLYLIHWPVPNKYVVIE- 120

Query: 139 PIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMN 198
                          W+A+EE  + G  +AIGVSNF  + L ++L+ AK+ PA NQ+E +
Sbjct: 121 -------------ETWKALEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYH 167

Query: 199 PLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVLI 257
           P  +Q +L  FC+   I + AY+PL   G      ++++  VL EIA+  GKT AQV +
Sbjct: 168 PYLRQPELLPFCQRHGIAVEAYSPLAKGG------KLLDNPVLAEIAKKYGKTPAQVAL 220

Length = 280
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 257
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
PLN02587314 L-galactose dehydrogenase 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
KOG1576342 consensus Predicted oxidoreductase [Energy product 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 99.07
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 93.19
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 92.77
TIGR00381 389 cdhD CO dehydrogenase/acetyl-CoA synthase, delta s 92.22
PRK08392215 hypothetical protein; Provisional 90.08
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 89.64
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 89.54
cd00423258 Pterin_binding Pterin binding enzymes. This family 88.21
PRK04452 319 acetyl-CoA decarbonylase/synthase complex subunit 86.13
PRK07535 261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 85.48
cd01973 454 Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -li 85.41
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 85.19
COG2069 403 CdhD CO dehydrogenase/acetyl-CoA synthase delta su 84.29
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 82.83
cd01965 428 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_l 81.7
TIGR00190 423 thiC thiamine biosynthesis protein ThiC. The thiC 81.46
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 80.38
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=7e-58  Score=387.56  Aligned_cols=217  Identities=41%  Similarity=0.717  Sum_probs=199.3

Q ss_pred             CCceecCCCCCcCCccceeCCcCCCCChhH-HHHHHHHHHHcCCceeeCCCCCCChHHHHHHHHHHHhCCCCCCCCcEEE
Q 025159           12 IPDVPLKSSNRRMPVLGLGTAASPFSGSET-TKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFI   90 (257)
Q Consensus        12 m~~~~l~~~~~~vs~lglG~~~~~~~~~~~-~~~~l~~Al~~Gi~~~DtA~~Yg~e~~lg~~l~~~~~~~~~~~R~~l~i   90 (257)
                      +.+.+|++| .+||.||||||+++.   ++ +.+.+..|++.|+|+||||..||||+.+|+++++.   ++  +|+++||
T Consensus         3 ~~~~~l~~g-~~iP~iGlGt~~~~~---~~~~~~av~~Al~~Gyr~IDTA~~YgnE~~VG~aI~~s---~v--~ReelFi   73 (280)
T COG0656           3 KTKVTLNNG-VEIPAIGLGTWQIGD---DEWAVRAVRAALELGYRLIDTAEIYGNEEEVGEAIKES---GV--PREELFI   73 (280)
T ss_pred             CceeecCCC-CcccCcceEeeecCC---chhHHHHHHHHHHhCcceEecHhHhcCHHHHHHHHHhc---CC--CHHHeEE
Confidence            566788898 889999999999643   44 99999999999999999999999999999999995   77  8999999


Q ss_pred             EeccCCCCCChhhHHHHHHHHHHhhCCCcccEEEeecCCCCCCCCCCCCCcccCCCCccHHHHHHHHHHHHHcCCeeEEE
Q 025159           91 ASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIG  170 (257)
Q Consensus        91 ~tK~~~~~~~~~~i~~~l~~sL~~Lg~d~lDl~~lh~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~G~ir~iG  170 (257)
                      +||+|..+.+++.+.+++++||++||+||+|+|+||||... .             .....++|++|++++++|+||+||
T Consensus        74 ttKvw~~~~~~~~~~~a~e~Sl~rLg~dyvDLyLiHwP~~~-~-------------~~~~~etw~alE~l~~~G~ir~IG  139 (280)
T COG0656          74 TTKVWPSDLGYDETLKALEASLKRLGLDYVDLYLIHWPVPN-K-------------YVVIEETWKALEELVDEGLIRAIG  139 (280)
T ss_pred             EeecCCccCCcchHHHHHHHHHHHhCCCceeEEEECCCCCc-c-------------CccHHHHHHHHHHHHhcCCccEEE
Confidence            99999999999999999999999999999999999999653 1             011689999999999999999999


Q ss_pred             ecCCCHHHHHHHHHhCCCCCceeccccCCCCCcHHHHHHHHHCCceEEEecCCCCCCCCCCCCCccChHHHHHHHHHhCC
Q 025159          171 VSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGK  250 (257)
Q Consensus       171 vs~~~~~~l~~~~~~~~~~p~~~q~~~~~~~~~~~~~~~~~~~gi~v~~~~pl~~~G~l~~~~~~~~~~~~~~ia~~~~~  250 (257)
                      ||||+.++++++++...+.|++||++||+++++.++++||+++||.+++||||+. |..     ++..+.+.+||++||.
T Consensus       140 VSNF~~~~L~~l~~~~~~~p~~NQIe~hp~~~q~el~~~~~~~gI~v~AysPL~~-g~~-----l~~~~~l~~Ia~k~g~  213 (280)
T COG0656         140 VSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRHGIAVEAYSPLAK-GGK-----LLDNPVLAEIAKKYGK  213 (280)
T ss_pred             eeCCCHHHHHHHHHhcCCCCceEEEEeccCCCcHHHHHHHHHcCCEEEEECCccc-ccc-----cccChHHHHHHHHhCC
Confidence            9999999999999999999999999999999998999999999999999999995 421     6788999999999999


Q ss_pred             CcccccC
Q 025159          251 TVAQVLI  257 (257)
Q Consensus       251 s~~qval  257 (257)
                      ||+||+|
T Consensus       214 t~AQv~L  220 (280)
T COG0656         214 TPAQVAL  220 (280)
T ss_pred             CHHHHHH
Confidence            9999986

>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>TIGR00381 cdhD CO dehydrogenase/acetyl-CoA synthase, delta subunit Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>cd01973 Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -like: Nitrogenase VFe protein, beta subunit like Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG2069 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) [Energy production and conversion] Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like Back     alignment and domain information
>TIGR00190 thiC thiamine biosynthesis protein ThiC Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 4e-71
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 7e-57
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 5e-51
3c3u_A323 Crystal Structure Of Akr1c1 In Complex With Nadp An 2e-46
3gug_A323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 2e-46
1mrq_A323 Crystal Structure Of Human 20alpha-hsd In Ternary C 2e-46
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 2e-45
2ipj_A321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 2e-45
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 4e-45
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 4e-45
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 5e-45
3cv6_A323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 5e-45
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 6e-45
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 6e-45
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 6e-45
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 6e-45
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 7e-45
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 7e-45
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 8e-45
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 9e-45
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 2e-44
2fvl_A324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 3e-44
2alr_A324 Aldehyde Reductase Length = 324 4e-44
3uzw_A346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 9e-43
3uwe_A331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 1e-42
1q13_A323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 1e-42
1q5m_A322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 1e-42
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 2e-42
1ry0_A323 Structure Of Prostaglandin F Synthase With Prostagl 2e-42
3r43_A331 Akr1c3 Complexed With Mefenamic Acid Length = 331 2e-42
1s1p_A331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 2e-42
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 3e-42
1ral_A308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 6e-42
1afs_A323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 6e-42
1lwi_A322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 6e-42
3cmf_A346 Crystal Structure Of Human Liver 5beta-Reductase (A 1e-41
3bur_A326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 2e-41
1dla_A314 Novel Nadph-Binding Domain Revealed By The Crystal 2e-41
1eko_A315 Pig Aldose Reductase Complexed With Idd384 Inhibito 2e-41
1ah0_A316 Pig Aldose Reductase Complexed With Sorbinil Length 2e-41
3lz5_A316 Human Aldose Reductase Mutant T113v Complexed With 2e-39
2pdb_A316 Human Aldose Reductase Mutant F121p Complexed With 4e-39
3q67_A316 Human Aldose Reductase C298s Mutant In Complex With 6e-39
1abn_A315 The Crystal Structure Of The Aldose Reductase Nadph 6e-39
2pdq_A316 Human Aldose Reductase Mutant C303d Complexed With 6e-39
2pd5_A316 Human Aldose Reductase Mutant V47i Complexed With Z 6e-39
2pdx_A316 Human Aldose Reductase Double Mutant S302r-C303d Co 6e-39
3rx2_A336 Crystal Structure Of Human Aldose Reductase Complex 6e-39
2agt_A319 Aldose Reductase Mutant Leu 300 Pro Complexed With 6e-39
1pwl_A316 Crystal Structure Of Human Aldose Reductase Complex 6e-39
2pdf_A316 Human Aldose Reductase Mutant L300p Complexed With 7e-39
2pdk_A316 Human Aldose Reductase Mutant L301m Complexed With 7e-39
1z3n_A319 Human Aldose Reductase In Complex With Nadp+ And Th 7e-39
1ef3_A315 Fidarestat Bound To Human Aldose Reductase Length = 7e-39
2pdm_A316 Human Aldose Reductase Mutant S302r Complexed With 7e-39
3lbo_A316 Human Aldose Reductase Mutant T113c Complexed With 7e-39
1el3_A316 Human Aldose Reductase Complexed With Idd384 Inhibi 7e-39
2r24_A316 Human Aldose Reductase Structure Length = 316 7e-39
1xgd_A315 Apo R268a Human Aldose Reductase Length = 315 7e-39
2pdi_A316 Human Aldose Reductase Mutant L300a Complexed With 7e-39
3lqg_A316 Human Aldose Reductase Mutant T113a Complexed With 8e-39
3onb_A315 Bond Breakage And Relocation Of A Covalently Bound 8e-39
2is7_A315 Crystal Structure Of Aldose Reductase Complexed Wit 9e-39
3ld5_A316 Human Aldose Reductase Mutant T113s Complexed With 1e-38
3ln3_A324 Crystal Structure Of Putative Reductase (Np_038806. 2e-38
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 2e-38
2acu_A315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 2e-38
2ipw_A315 Crystal Structure Of C298a W219y Aldose Reductase C 6e-38
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 7e-37
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 6e-36
1c9w_A315 Cho Reductase With Nadp+ Length = 315 2e-35
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 6e-35
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 1e-34
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 1e-34
3f7j_A276 B.Subtilis Yvgn Length = 276 5e-34
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 5e-34
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 7e-34
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 1e-32
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 1e-32
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 1e-32
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 1e-32
1frb_A315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 2e-32
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 5e-32
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 2e-31
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 8e-31
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 4e-30
3b3d_A314 B.Subtilis Ytbe Length = 314 8e-30
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 3e-29
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 3e-29
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 5e-29
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 4e-24
1pz1_A333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 8e-11
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 3e-09
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 4e-07
3eb4_A327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 6e-07
4aub_A366 The Complex Structure Of The Bacterial Aldo-Keto Re 7e-07
3eau_A327 Voltage-Dependent K+ Channel Beta Subunit In Comple 7e-07
1qrq_A325 Structure Of A Voltage-Dependent K+ Channel Beta Su 7e-07
3lut_A367 A Structural Model For The Full-Length Shaker Potas 7e-07
1exb_A332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 7e-07
2a79_A333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 7e-07
3n6q_A346 Crystal Structure Of Yghz From E. Coli Length = 346 8e-07
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 8e-07
3eb3_A327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 1e-06
1zsx_A347 Crystal Structure Of Human Potassium Channel Kv Bet 2e-06
1ynp_A317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 6e-06
3n2t_A348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 9e-06
1og6_A298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 3e-05
3v0t_A337 Crystal Structure Of Perakine Reductase, Founder Me 7e-05
3v0u_A338 Crystal Structure Of Perakine Reductase, Founder Me 7e-05
1ur3_M319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 1e-04
3v0s_A337 Crystal Structure Of Perakine Reductase, Founder Me 5e-04
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure 
Iteration: 1

 Score =  264 bits (674), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 184/251 (73%), Gaps = 5/251 (1%)
Query: 7   MGSISIPDVPLK--SSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQ 64
           MGS+ IP   L   SS  +MPV+G+G+A   F+  + TK AI+EA+K GYRHFDTA  Y 
Sbjct: 1   MGSVEIPTKVLTNTSSQLKMPVVGMGSAPD-FTCKKDTKDAIIEAIKQGYRHFDTAAAYG 59
Query: 65  TEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYV 124
           +EQ LG+A+ EA+  G++ +RD+LF+ SKLW ++ H  LV+PALQKSL+ LQL+Y+DLY+
Sbjct: 60  SEQALGEALKEAIELGLV-TRDDLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYL 118
Query: 125 IHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILA 184
           IHWP+SS+PG + FPI   D LP D K VWE+MEE   LG TKAIGVSNFS KKL ++L+
Sbjct: 119 IHWPLSSQPGKFSFPIDVADLLPFDVKGVWESMEESLKLGLTKAIGVSNFSVKKLENLLS 178
Query: 185 TAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEI 244
            A + PA NQVEMN  WQQ KLREFC A  I L A++P+  +G   G N VME ++LKEI
Sbjct: 179 VATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPV-RKGASRGPNEVMENDMLKEI 237
Query: 245 AEAKGKTVAQV 255
           A+A GK+VAQ+
Sbjct: 238 ADAHGKSVAQI 248
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 Back     alignment and structure
>pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 1e-134
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 1e-131
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 1e-128
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 1e-124
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 1e-120
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 1e-119
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 1e-113
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 1e-112
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 1e-109
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 1e-109
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-107
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 1e-106
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 1e-106
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 3e-88
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 4e-86
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-84
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 9e-84
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-83
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 2e-83
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 4e-83
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 5e-83
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 7e-83
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 7e-83
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 1e-80
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 1e-80
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 2e-30
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 6e-25
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 5e-24
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 6e-24
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 2e-23
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 7e-19
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 3e-18
3erp_A353 Putative oxidoreductase; funded by the national in 3e-18
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 3e-17
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 4e-17
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 2e-16
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 7e-15
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 8e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
 Score =  381 bits (980), Expect = e-134
 Identities = 138/253 (54%), Positives = 182/253 (71%), Gaps = 5/253 (1%)

Query: 7   MGSISIPDVPLKSSN--RRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQ 64
           MGS+ IP   L +++   +MPV+G+G+A       +T   AI+EA+K GYRHFDTA  Y 
Sbjct: 1   MGSVEIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKD-AIIEAIKQGYRHFDTAAAYG 59

Query: 65  TEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYV 124
           +EQ LG+A+ EA+  G++  RD+LF+ SKLW ++ H  LV+PALQKSL+ LQL+Y+DLY+
Sbjct: 60  SEQALGEALKEAIELGLVT-RDDLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYL 118

Query: 125 IHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILA 184
           IHWP+SS+PG + FPI   D LP D K VWE+MEE   LG TKAIGVSNFS KKL ++L+
Sbjct: 119 IHWPLSSQPGKFSFPIDVADLLPFDVKGVWESMEESLKLGLTKAIGVSNFSVKKLENLLS 178

Query: 185 TAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEI 244
            A + PA NQVEMN  WQQ KLREFC A  I L A++P+  +G   G N VME ++LKEI
Sbjct: 179 VATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPVR-KGASRGPNEVMENDMLKEI 237

Query: 245 AEAKGKTVAQVLI 257
           A+A GK+VAQ+ +
Sbjct: 238 ADAHGKSVAQISL 250
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.38
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 92.82
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 91.95
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 91.35
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 90.99
2yci_X 271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 90.61
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 90.51
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 90.18
2oz8_A389 MLL7089 protein; structural genomics, unknown func 89.8
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 89.74
2gl5_A410 Putative dehydratase protein; structural genomics, 89.58
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 89.18
4djd_D 323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 89.16
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 89.16
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 88.9
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 88.81
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 88.65
2poz_A392 Putative dehydratase; octamer, structural genomics 88.05
2o56_A407 Putative mandelate racemase; dehydratase, structur 88.01
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 88.01
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 87.76
2qgy_A391 Enolase from the environmental genome shotgun sequ 87.6
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 87.44
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 87.39
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 87.31
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 87.27
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 86.81
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 86.66
1tzz_A392 Hypothetical protein L1841; structural genomics, m 86.03
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 86.02
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 85.92
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 85.68
3eez_A378 Putative mandelate racemase/muconate lactonizing e 84.83
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 84.51
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 84.37
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 84.23
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 84.18
2h9a_B 310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 84.07
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 83.58
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 83.49
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 82.73
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 82.65
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 82.33
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 82.02
3r0u_A379 Enzyme of enolase superfamily; structural genomics 81.61
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 81.56
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 81.56
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 81.2
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 80.92
1eye_A 280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 80.62
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 80.62
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 80.6
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 80.54
1f6y_A 262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 80.13
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
Probab=100.00  E-value=5.6e-57  Score=394.74  Aligned_cols=248  Identities=56%  Similarity=0.961  Sum_probs=212.1

Q ss_pred             CCCCCCCcee-cCC-CCCcCCccceeCCcCCCCChhHHHHHHHHHHHcCCceeeCCCCCCChHHHHHHHHHHHhCCCCCC
Q 025159            7 MGSISIPDVP-LKS-SNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKS   84 (257)
Q Consensus         7 ~~~~~m~~~~-l~~-~~~~vs~lglG~~~~~~~~~~~~~~~l~~Al~~Gi~~~DtA~~Yg~e~~lg~~l~~~~~~~~~~~   84 (257)
                      |.+.+|++++ |++ +|++||+|||||+.|+ .+.+++.++|+.|++.|||+||||+.||+|+.+|++|++.++.+.+ +
T Consensus         1 ~~~~~m~~~~~l~~~tg~~v~~lglGt~~~~-~~~~~~~~~v~~Al~~G~~~iDTA~~YgsE~~vG~al~~~~~~g~~-~   78 (312)
T 1zgd_A            1 MGSVEIPTKVLTNTSSQLKMPVVGMGSAPDF-TCKKDTKDAIIEAIKQGYRHFDTAAAYGSEQALGEALKEAIELGLV-T   78 (312)
T ss_dssp             ----CCCEEECTTSTTCCEEESBCBCCSCCT-TCCSCHHHHHHHHHHHTCCEEECCGGGTCHHHHHHHHHHHHHTTSC-C
T ss_pred             CCCCCCchhhhcCCCCCCCCCceeEcCcccC-CCHHHHHHHHHHHHHcCCCEEECccccCCHHHHHHHHHHHHhcCCC-c
Confidence            6777899999 998 5699999999994433 3567899999999999999999999999999999999987666632 7


Q ss_pred             CCcEEEEeccCCCCCChhhHHHHHHHHHHhhCCCcccEEEeecCCCCCCCCCCCCCcccCCCCccHHHHHHHHHHHHHcC
Q 025159           85 RDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLG  164 (257)
Q Consensus        85 R~~l~i~tK~~~~~~~~~~i~~~l~~sL~~Lg~d~lDl~~lh~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~G  164 (257)
                      |+++||+||+|..+.+++.+++++++||++||+||||+|+||||+...+++...|...+.......+++|++|++|+++|
T Consensus        79 R~~~~i~TK~~~~~~~~~~v~~~~~~SL~rL~~dyiDl~llH~p~~~~~~~~~~~~~~~~~~~~~~~e~~~ale~l~~~G  158 (312)
T 1zgd_A           79 RDDLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYLIHWPLSSQPGKFSFPIDVADLLPFDVKGVWESMEESLKLG  158 (312)
T ss_dssp             GGGCEEEEEECGGGCSGGGHHHHHHHHHHHHTCSCBSEEEECCSCEECTTCCCSSEEGGGEECCCHHHHHHHHHHHHHTT
T ss_pred             chheEEEeccCCCCCCHHHHHHHHHHHHHHhCCCceeEEEEeccCcccCccccccccccccccccHHHHHHHHHHHHHcC
Confidence            99999999999888889999999999999999999999999999754332222221111111345789999999999999


Q ss_pred             CeeEEEecCCCHHHHHHHHHhCCCCCceeccccCCCCCcHHHHHHHHHCCceEEEecCCCCCCCCCCCCCccChHHHHHH
Q 025159          165 YTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEI  244 (257)
Q Consensus       165 ~ir~iGvs~~~~~~l~~~~~~~~~~p~~~q~~~~~~~~~~~~~~~~~~~gi~v~~~~pl~~~G~l~~~~~~~~~~~~~~i  244 (257)
                      |||+||||||++++++++++.+.++|.++|++||+++++.+++++|+++||++++|+||+. |.+++....+..+.+.++
T Consensus       159 kir~iGvSn~~~~~l~~~~~~~~~~p~~~Q~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~-G~~~~~~~~~~~~~l~~i  237 (312)
T 1zgd_A          159 LTKAIGVSNFSVKKLENLLSVATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPVRK-GASRGPNEVMENDMLKEI  237 (312)
T ss_dssp             SBSCEEEESCCHHHHHHHHTTCSSCCSEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTTT-TTTTSSCTTTTCHHHHHH
T ss_pred             CCCEEEEeCCCHHHHHHHHHhCCCCceEEeeecCcccCCHHHHHHHHHcCCEEEEecCCCC-CCCCCCccccccHHHHHH
Confidence            9999999999999999999999899999999999999988999999999999999999997 877665556678999999


Q ss_pred             HHHhCCCcccccC
Q 025159          245 AEAKGKTVAQVLI  257 (257)
Q Consensus       245 a~~~~~s~~qval  257 (257)
                      |++||+|++|+||
T Consensus       238 a~~~g~s~aqvaL  250 (312)
T 1zgd_A          238 ADAHGKSVAQISL  250 (312)
T ss_dssp             HHHHTSCHHHHHH
T ss_pred             HHHcCCCHHHHHH
Confidence            9999999999985
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 257
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-45
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 1e-43
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-39
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 3e-39
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 1e-38
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 4e-33
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-31
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-29
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 1e-29
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 3e-27
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-22
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 1e-18
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 8e-18
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 9e-12
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 2e-10
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 3e-10
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Aldose reductase (aldehyde reductase)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  152 bits (384), Expect = 3e-45
 Identities = 103/247 (41%), Positives = 146/247 (59%), Gaps = 12/247 (4%)

Query: 19  SSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALS 78
           ++  +MP+LGLGT  SP    + T+ A+  A+ +GYRH D A +YQ E  +G AI E L 
Sbjct: 8   NNGAKMPILGLGTWKSP--PGQVTE-AVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLR 64

Query: 79  TGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEF 138
             ++K R+ELFI SKLWC+   + LV  A QK+L +L+L+Y+DLY+IHWP   KPG   F
Sbjct: 65  EQVVK-REELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFF 123

Query: 139 PIKKEDFLP---MDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATA--KIPPAAN 193
           P+ +   +     +    W AMEE  + G  KAIG+SNF+  ++  IL     K  PA N
Sbjct: 124 PLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVN 183

Query: 194 QVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSN---RVMECEVLKEIAEAKGK 250
           Q+E +P   Q KL ++C++K I + AY+PLG+    W       ++E   +K IA    K
Sbjct: 184 QIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNK 243

Query: 251 TVAQVLI 257
           T AQVLI
Sbjct: 244 TTAQVLI 250
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 94.44
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 91.03
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 91.01
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 90.14
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 85.66
d1f6ya_ 262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 83.7
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 80.27
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 80.24
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: 3-alpha-hydroxysteroid dehydrogenase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.6e-48  Score=338.61  Aligned_cols=246  Identities=37%  Similarity=0.615  Sum_probs=209.7

Q ss_pred             CCCCceecCCCCCcCCccceeCCcCCCCChhHHHHHHHHHHHcCCceeeCCCCCCChHHHHHHHHHHHhCCCCCCCCcEE
Q 025159           10 ISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELF   89 (257)
Q Consensus        10 ~~m~~~~l~~~~~~vs~lglG~~~~~~~~~~~~~~~l~~Al~~Gi~~~DtA~~Yg~e~~lg~~l~~~~~~~~~~~R~~l~   89 (257)
                      ..|++|-..++|.+||.||||||.++..+.+++.++|+.|++.|||+||||+.||||+.+|++|++...+..+ .|+.++
T Consensus         2 ~~~~~r~~~~~G~~ip~iGlGt~~~~~~~~~~~~~~i~~A~d~Gin~~DTA~~YgsE~~lG~~l~~~~~~~~~-~~~~~~   80 (319)
T d1afsa_           2 DSISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTV-KREDIF   80 (319)
T ss_dssp             CGGGCEEECTTSCEEESSEEECCCCTTSCTTHHHHHHHHHHHTTCCEEECCTTTTCHHHHHHHHHHHHHTTSC-CGGGCE
T ss_pred             CccCceEECCCcCEEcCEeeECCCCCCCCHHHHHHHHHHHHHcCCCEEECcccccCHHHHHHHHHhhhhhccc-cceeee
Confidence            4455554434449999999999998888899999999999999999999999999999999999988766554 899999


Q ss_pred             EEeccCCCCCChhhHHHHHHHHHHhhCCCcccEEEeecCCCCCCCCCCCCCcc---cCCCCccHHHHHHHHHHHHHcCCe
Q 025159           90 IASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKK---EDFLPMDFKSVWEAMEECQNLGYT  166 (257)
Q Consensus        90 i~tK~~~~~~~~~~i~~~l~~sL~~Lg~d~lDl~~lh~p~~~~~~~~~~~~~~---~~~~~~~~~~~~~~l~~l~~~G~i  166 (257)
                      +.+|.+....+++.++.++++||++||+||+|+|++|||+...+....+....   ......+.+++|++|++|+++|||
T Consensus        81 ~~~~~~~~~~~~~~~~~s~e~SL~rL~~d~iDl~~lH~p~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~l~~l~~~Gki  160 (319)
T d1afsa_          81 YTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLA  160 (319)
T ss_dssp             EEEEECGGGCSTTTHHHHHHHHHHHHCCSSEEEEEESCSCEECSSSSSSCBCTTCCBCEECCCHHHHHHHHHHHHHTTSE
T ss_pred             ecccccccccchhhHHHHHHHHHhhcCCcccceeEeccccCCCCCccccCccccccccccCCCHHHHHHHHHHHHHcCCE
Confidence            99999998889999999999999999999999999999987655443332211   112345689999999999999999


Q ss_pred             eEEEecCCCHHHHHHHHHhCC--CCCceeccccCCCCCcHHHHHHHHHCCceEEEecCCCCCCCCCCCC-----CccChH
Q 025159          167 KAIGVSNFSCKKLGDILATAK--IPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSN-----RVMECE  239 (257)
Q Consensus       167 r~iGvs~~~~~~l~~~~~~~~--~~p~~~q~~~~~~~~~~~~~~~~~~~gi~v~~~~pl~~~G~l~~~~-----~~~~~~  239 (257)
                      |+||+|||+.++++++++.+.  +.+..+|+++++...+.+++++|+++||++++|+||++ |.+....     .....+
T Consensus       161 r~iGvSn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~i~i~a~spl~~-G~~~~~~~~~~~~~~~~~  239 (319)
T d1afsa_         161 KSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGS-SRDKTWVDQKSPVLLDDP  239 (319)
T ss_dssp             EEEEEESCCHHHHHHHHTCTTCCSCCSEEEEECBTTBCCHHHHHHHHHHTCEEEEESTTSC-CCCTTTSCTTSCCGGGCH
T ss_pred             EEEeeccccHHHHHHHHHhhcccccccccccchhhccchHHHhHHHHHcCceecccccccc-ccccCccCcCCchhhhHH
Confidence            999999999999999988775  44678888888887788999999999999999999998 9876432     244568


Q ss_pred             HHHHHHHHhCCCcccccC
Q 025159          240 VLKEIAEAKGKTVAQVLI  257 (257)
Q Consensus       240 ~~~~ia~~~~~s~~qval  257 (257)
                      .+.++|++||+|++||||
T Consensus       240 ~~~~la~~~g~s~aqlAL  257 (319)
T d1afsa_         240 VLCAIAKKYKQTPALVAL  257 (319)
T ss_dssp             HHHHHHHHTTCCHHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHH
Confidence            999999999999999985
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure