Citrus Sinensis ID: 025165
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 257 | ||||||
| 449445515 | 276 | PREDICTED: poly(rC)-binding protein 2-li | 0.926 | 0.862 | 0.763 | 1e-98 | |
| 356530005 | 385 | PREDICTED: KH domain-containing protein | 0.863 | 0.576 | 0.807 | 7e-98 | |
| 255541092 | 363 | conserved hypothetical protein [Ricinus | 0.957 | 0.677 | 0.736 | 2e-94 | |
| 297734587 | 346 | unnamed protein product [Vitis vinifera] | 0.961 | 0.713 | 0.714 | 1e-93 | |
| 359489188 | 343 | PREDICTED: KH domain-containing protein | 0.961 | 0.720 | 0.714 | 1e-93 | |
| 307136423 | 331 | hypothetical protein [Cucumis melo subsp | 0.782 | 0.607 | 0.783 | 4e-82 | |
| 147855522 | 321 | hypothetical protein VITISV_031103 [Viti | 0.844 | 0.676 | 0.724 | 1e-81 | |
| 224137186 | 357 | predicted protein [Populus trichocarpa] | 0.937 | 0.675 | 0.690 | 2e-81 | |
| 357507881 | 275 | Poly(rC)-binding protein [Medicago trunc | 0.778 | 0.727 | 0.722 | 3e-75 | |
| 116784616 | 407 | unknown [Picea sitchensis] | 0.805 | 0.508 | 0.540 | 1e-50 |
| >gi|449445515|ref|XP_004140518.1| PREDICTED: poly(rC)-binding protein 2-like [Cucumis sativus] gi|449529952|ref|XP_004171961.1| PREDICTED: poly(rC)-binding protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 365 bits (936), Expect = 1e-98, Method: Compositional matrix adjust.
Identities = 187/245 (76%), Positives = 209/245 (85%), Gaps = 7/245 (2%)
Query: 20 EPRHDVSGKRRREDGEI----EGSD---PKRRAKAQDVLFRIIVPSRQIGKVIGKEGHRI 72
EP H V+GKRRRED I + SD PKR+AKA DVLFRI+VPS+QIGKVIGK G RI
Sbjct: 32 EPGHTVTGKRRREDDLIVSNSDASDISAPKRQAKAHDVLFRIVVPSKQIGKVIGKVGCRI 91
Query: 73 QKIREETKATIKIADAIARHEERVIIISSKDNDNVVSDAENALQQIAALILKDDDSNSEA 132
QK+REETKATIKIADA+AR+EERVIIISSKDN+N V+DAE ALQQIAALILK+D S+ E
Sbjct: 92 QKVREETKATIKIADAVARYEERVIIISSKDNENSVTDAEKALQQIAALILKEDGSSIEE 151
Query: 133 SKVAAGHVAANTIRLLIAGSQAGCLIGMSGQNIEKLRNSSGATIVILAPNQLPLCASAHE 192
KV GHVAANTIRLLIAGSQAG LIG SGQNIEKLRNSSGA+I ILAPNQLPLCASAHE
Sbjct: 152 LKVGTGHVAANTIRLLIAGSQAGSLIGASGQNIEKLRNSSGASITILAPNQLPLCASAHE 211
Query: 193 SDRVVQISGDVPAVLNALVEIGNQLRENPPRQVISISPAYNYSAIRPAQPFVEPTSGQPL 252
SDRVVQISGD+ AVL AL EIGNQLR NPPRQVIS+SP YNY+ + P Q +++PTSG+P+
Sbjct: 212 SDRVVQISGDILAVLKALEEIGNQLRVNPPRQVISVSPTYNYNTMHPPQSYMDPTSGKPI 271
Query: 253 LQLTM 257
LQL M
Sbjct: 272 LQLIM 276
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356530005|ref|XP_003533576.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255541092|ref|XP_002511610.1| conserved hypothetical protein [Ricinus communis] gi|223548790|gb|EEF50279.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297734587|emb|CBI16638.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489188|ref|XP_002272998.2| PREDICTED: KH domain-containing protein At4g18375-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|307136423|gb|ADN34230.1| hypothetical protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|147855522|emb|CAN83854.1| hypothetical protein VITISV_031103 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224137186|ref|XP_002327061.1| predicted protein [Populus trichocarpa] gi|222835376|gb|EEE73811.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357507881|ref|XP_003624229.1| Poly(rC)-binding protein [Medicago truncatula] gi|355499244|gb|AES80447.1| Poly(rC)-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|116784616|gb|ABK23409.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 257 | ||||||
| TAIR|locus:2150956 | 548 | AT5G15270 "AT5G15270" [Arabido | 0.824 | 0.386 | 0.333 | 9.9e-23 | |
| TAIR|locus:2035807 | 479 | AT1G14170 "AT1G14170" [Arabido | 0.677 | 0.363 | 0.292 | 2.4e-16 | |
| TAIR|locus:2084908 | 577 | FLK "AT3G04610" [Arabidopsis t | 0.758 | 0.337 | 0.282 | 5.9e-16 | |
| TAIR|locus:2120755 | 495 | PEP "AT4G26000" [Arabidopsis t | 0.638 | 0.331 | 0.312 | 1.9e-15 | |
| TAIR|locus:2056951 | 153 | AT2G03110 "AT2G03110" [Arabido | 0.494 | 0.830 | 0.355 | 4.4e-13 | |
| UNIPROTKB|H9L011 | 195 | LOC426023 "Uncharacterized pro | 0.603 | 0.794 | 0.278 | 9.1e-13 | |
| TAIR|locus:2017612 | 621 | AT1G51580 "AT1G51580" [Arabido | 0.622 | 0.257 | 0.294 | 1.8e-12 | |
| TAIR|locus:2161413 | 644 | AT5G46190 "AT5G46190" [Arabido | 0.626 | 0.25 | 0.292 | 3.7e-12 | |
| UNIPROTKB|F1NPL2 | 319 | PCBP3 "Uncharacterized protein | 0.603 | 0.485 | 0.273 | 8.6e-12 | |
| UNIPROTKB|F1NPL4 | 326 | PCBP3 "Uncharacterized protein | 0.603 | 0.475 | 0.273 | 9.4e-12 |
| TAIR|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 270 (100.1 bits), Expect = 9.9e-23, P = 9.9e-23
Identities = 76/228 (33%), Positives = 115/228 (50%)
Query: 17 TEPEPRHDVSG-KRRREDGEIEGSDPKRRAKAQDVLFRIIVPSRQIGKVIGKEGHRIQKI 75
+ P+ +D +G +RR G+ S R D +FR + P ++IG VIG+ G ++++
Sbjct: 19 SRPQSDYDDNGGSKRRYRGDDRDSLVIDR---DDTVFRYLCPVKKIGSVIGRGGDIVKQL 75
Query: 76 REEXXXXXXXXXXXXRHEERVIII-SSKDNDNVVSDAENALQ--QIAALILKD----DDS 128
R + +ERVI I S D N D E L Q A + D DD+
Sbjct: 76 RNDTRSKIRIGEAIPGCDERVITIYSPSDETNAFGDGEKVLSPAQDALFRIHDRVVADDA 135
Query: 129 NSEASKVAAGHVAANTIRLLIAGSQAGCLIGMSGQNIEKLRNSSGATIVILAPNQLPLCA 188
SE S V A +LL+ Q GC++G GQ ++ +R+ +GA I I+ +PLCA
Sbjct: 136 RSEDSPEGEKQVTA---KLLVPSDQIGCILGRGGQIVQNIRSETGAQIRIVKDRNMPLCA 192
Query: 189 SAHESDRVVQISGDVPAVLNALVEIGNQLRENPPRQVISISPAYNYSA 236
SD ++QISG+V V AL++I ++L ENP R +S + Y A
Sbjct: 193 L--NSDELIQISGEVLIVKKALLQIASRLHENPSRSQNLLSSSGGYPA 238
|
|
| TAIR|locus:2035807 AT1G14170 "AT1G14170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084908 FLK "AT3G04610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120755 PEP "AT4G26000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056951 AT2G03110 "AT2G03110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9L011 LOC426023 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPL2 PCBP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPL4 PCBP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00019121001 | SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (343 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 257 | |||
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 1e-15 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 3e-12 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 5e-10 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 8e-09 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 5e-08 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 3e-07 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 3e-07 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 5e-06 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 2e-04 | |
| cd02134 | 61 | cd02134, NusA_KH, NusA_K homology RNA-binding doma | 3e-04 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 4e-04 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 6e-04 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 6e-04 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 8e-04 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 0.001 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
Score = 69.0 bits (170), Expect = 1e-15
Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 6/70 (8%)
Query: 144 TIRLLIAGSQAGCLIGMSGQNIEKLRNSSGATIVILAPNQLPLCASAHESDRVVQISGDV 203
T+RLL+ SQAG +IG G I+++R +GA I + + LP ++RVV ISG
Sbjct: 1 TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVS-KSVLPGS-----TERVVTISGKP 54
Query: 204 PAVLNALVEI 213
AV AL+ I
Sbjct: 55 SAVQKALLLI 64
|
Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|239049 cd02134, NusA_KH, NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 257 | |||
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 100.0 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.96 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.94 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.94 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 99.93 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 99.9 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.82 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.81 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.78 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.78 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.74 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.52 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.46 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.35 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.34 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.31 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.28 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.25 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.24 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.22 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.2 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 99.19 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.15 | |
| PF13014 | 43 | KH_3: KH domain | 99.11 | |
| PF13014 | 43 | KH_3: KH domain | 99.1 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 99.02 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 98.92 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.89 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 98.79 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.62 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.51 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 98.49 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 98.47 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.46 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 98.35 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 98.33 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.3 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 98.13 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 98.12 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.01 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 97.77 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.75 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.74 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.66 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.64 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.59 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.45 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 97.42 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 97.36 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 97.32 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.31 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 97.29 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.25 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 97.23 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 97.23 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.21 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 97.16 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 97.15 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 97.05 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 97.04 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 97.02 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.99 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 96.96 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 96.85 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 96.85 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 96.82 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 96.81 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 96.76 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 96.73 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 96.73 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.6 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 96.6 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 96.34 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 96.33 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 96.18 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 96.08 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 96.06 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 96.02 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 96.0 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 95.87 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 95.86 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 95.85 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 95.82 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 95.74 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 95.58 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 95.4 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 95.38 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 95.37 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 95.34 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 95.32 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 95.04 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 95.0 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 94.97 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 94.17 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 93.75 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 93.25 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 93.1 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 93.04 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 93.01 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 92.99 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 92.82 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 92.69 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 92.52 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 92.41 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 91.76 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 91.72 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 91.29 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 90.99 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 90.74 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 90.46 | |
| PRK13764 | 602 | ATPase; Provisional | 90.4 | |
| PRK13764 | 602 | ATPase; Provisional | 89.68 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 89.31 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 89.16 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 88.87 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 88.68 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 88.63 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 88.58 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 88.46 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 87.15 | |
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 86.93 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 86.69 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 86.38 | |
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 86.31 | |
| cd02411 | 85 | archeal_30S_S3_KH K homology RNA-binding domain (K | 85.34 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 84.74 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 84.68 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 82.79 | |
| COG5166 | 657 | Uncharacterized conserved protein [Function unknow | 82.0 | |
| cd02411 | 85 | archeal_30S_S3_KH K homology RNA-binding domain (K | 80.72 | |
| COG0092 | 233 | RpsC Ribosomal protein S3 [Translation, ribosomal | 80.69 | |
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 80.49 |
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.8e-34 Score=248.92 Aligned_cols=220 Identities=25% Similarity=0.378 Sum_probs=169.7
Q ss_pred CCCCCCCCCCCCccCCCCCCCCCCcccc-CCCCCeEEEEEecCcccccccccCchhHHHHHhhhCceEEEccc---ccCC
Q 025165 17 TEPEPRHDVSGKRRREDGEIEGSDPKRR-AKAQDVLFRIIVPSRQIGKVIGKEGHRIQKIREETKATIKIADA---IARH 92 (257)
Q Consensus 17 ~~~~~~~~~~~kr~~e~~~~~~~~~~~~-~~~~~~~~rilVP~~~vg~IIGkgG~~Ik~I~~~tga~I~i~~~---~~~~ 92 (257)
++-..+..+++||+++...+........ .....+++|||||+..+|.||||||++|.+||++|||+|++++. .|++
T Consensus 5 ~~~d~~~~~s~kr~~~a~pe~~~~k~~n~ge~~~y~ikvLips~AaGsIIGKGG~ti~~lqk~tgariklSks~dfyPGT 84 (402)
T KOG2191|consen 5 VPIDSDAPDSRKRPLEAPPEPGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGARIKLSKSKDFYPGT 84 (402)
T ss_pred CcccCCCCCCccccccCCCCccccccccCCCCCceEEEEEeecccccceeccchHHHHHHHhccCcEEEeccccccCCCc
Confidence 4455667788899999877543322222 22345999999999999999999999999999999999999954 6889
Q ss_pred CccEEEecCCCCCchhhHHHHHHHHHHHHHhcCCCCCchhhhh--ccCCCcceEEEEEeccCccceeecCCChhHHHHHH
Q 025165 93 EERVIIISSKDNDNVVSDAENALQQIAALILKDDDSNSEASKV--AAGHVAANTIRLLIAGSQAGCLIGMSGQNIEKLRN 170 (257)
Q Consensus 93 ~ervv~I~G~~~~~~~~~~~~a~~~I~~~i~~~~~~~~~~~~~--~~~~~~~~~~~l~Vp~~~vG~iIGk~G~~Ik~I~~ 170 (257)
+||+|+|+|+- ..+......|.++|++..........+ .........++++||++.+|.||||+|++||.|++
T Consensus 85 TeRvcli~Gt~-----eai~av~efI~dKire~p~~~~k~v~~~~pqt~~r~kqikivvPNstag~iigkggAtiK~~~E 159 (402)
T KOG2191|consen 85 TERVCLIQGTV-----EALNAVHEFIADKIREKPQAVAKPVDILQPQTPDRIKQIKIVVPNSTAGMIIGKGGATIKAIQE 159 (402)
T ss_pred cceEEEEeccH-----HHHHHHHHHHHHHHHHhHHhhcCCccccCCCCccccceeEEeccCCcccceecCCcchHHHHHH
Confidence 99999999994 356666677778877654322110000 01123345689999999999999999999999999
Q ss_pred HhCCeEEEeCCCCCCcccCCCCCceEEEEEcCHHHHHHHHHHHHHHHhcCCCCCc---ccC----CCCCCCCCCCCCCCC
Q 025165 171 SSGATIVILAPNQLPLCASAHESDRVVQISGDVPAVLNALVEIGNQLRENPPRQV---ISI----SPAYNYSAIRPAQPF 243 (257)
Q Consensus 171 ~tga~I~i~~~~~~p~~~~~~~~~r~V~I~G~~~~v~~A~~~I~~~l~e~~~~~~---~~~----~p~~~~~~~~~~~~~ 243 (257)
++||+|+|++.+ |... ...+|+|++.|++++..+|+.+|+++|.|+|+..+ .+| .|..|+++ +|++|
T Consensus 160 qsga~iqisPqk--pt~~--sLqervvt~sge~e~~~~A~~~IL~Ki~eDpqs~scln~sya~vsGpvaNsnP--tGspy 233 (402)
T KOG2191|consen 160 QSGAWIQISPQK--PTGI--SLQERVVTVSGEPEQNMKAVSLILQKIQEDPQSGSCLNISYANVSGPVANSNP--TGSPY 233 (402)
T ss_pred hhCcceEecccC--CCCc--cceeEEEEecCCHHHHHHHHHHHHHHhhcCCcccceeccchhcccCcccccCC--CCCCC
Confidence 999999998522 2222 36899999999999999999999999999999865 244 58999988 66666
Q ss_pred cCCC
Q 025165 244 VEPT 247 (257)
Q Consensus 244 ~~~~ 247 (257)
.-+.
T Consensus 234 a~~~ 237 (402)
T KOG2191|consen 234 AYQA 237 (402)
T ss_pred CCCC
Confidence 6543
|
|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5166 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein | Back alignment and domain information |
|---|
| >COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 257 | ||||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 4e-08 | ||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 9e-05 | ||
| 3vke_A | 76 | Contribution Of The First K-Homology Domain Of Poly | 2e-04 | ||
| 2axy_A | 73 | Crystal Structure Of Kh1 Domain Of Human Poly(C)-Bi | 3e-04 | ||
| 1ztg_A | 74 | Human Alpha Polyc Binding Protein Kh1 Length = 74 | 3e-04 |
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
|
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
| >pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 | Back alignment and structure |
| >pdb|2AXY|A Chain A, Crystal Structure Of Kh1 Domain Of Human Poly(C)-Binding Protein-2 With C-Rich Strand Of Human Telomeric Dna Length = 73 | Back alignment and structure |
| >pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 257 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-34 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 5e-09 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-08 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 5e-33 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-09 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 4e-09 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-29 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 8e-12 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-08 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 3e-29 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 4e-08 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 2e-26 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 3e-10 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 9e-10 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 6e-14 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-11 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 8e-11 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 2e-09 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 8e-11 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 3e-09 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 4e-10 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 5e-08 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 1e-09 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 2e-08 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 9e-09 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 2e-08 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 1e-08 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-08 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 9e-08 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 2e-08 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 9e-07 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 3e-08 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 3e-07 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 3e-08 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 3e-05 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 6e-08 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 2e-05 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 8e-08 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 4e-07 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-07 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-06 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-06 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-04 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 9e-06 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 2e-05 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-05 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 6e-05 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 8e-05 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 8e-05 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 1e-04 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 2e-04 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 2e-04 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 5e-04 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 6e-04 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 6e-04 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
Score = 121 bits (304), Expect = 2e-34
Identities = 43/180 (23%), Positives = 84/180 (46%), Gaps = 10/180 (5%)
Query: 47 AQDVLFRIIVPSRQIGKVIGKEGHRIQKIREETKATIKIA---DAIARHEERVIIISSKD 103
++++PS G +IGK G I ++++ET ATIK++ D ERV +I
Sbjct: 3 GSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTI 62
Query: 104 N--DNVVSDAENALQQIAALILKDDDSNSEASKVAAGHVAANTIRLLIAGSQAGCLIGMS 161
+ V ++++ + K + + + AN +++++ S AG +IG
Sbjct: 63 EALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIGKG 122
Query: 162 GQNIEKLRNSSGATIVILAPNQLPLCASAHESDRVVQISGDVPAVLNALVEIGNQLRENP 221
G ++ + SGA + + +Q P + RVV +SG+ A+ I +++E+P
Sbjct: 123 GATVKAIMEQSGAWVQL---SQKPDGINLQN--RVVTVSGEPEQNRKAVELIIQKIQEDP 177
|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 257 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.97 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.96 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.96 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.96 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.95 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.86 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.81 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.8 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.7 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.64 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.62 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.61 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.6 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.6 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.6 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.59 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.59 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.57 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.57 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.57 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.56 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.56 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.55 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.55 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.54 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.52 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.52 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.52 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.52 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.52 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.5 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.49 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.47 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.47 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.46 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.46 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.46 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.46 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.44 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.43 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.41 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.41 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.4 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.38 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.38 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.37 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.37 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.36 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.34 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.3 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.28 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.26 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.25 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.24 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.18 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.17 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.95 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 98.94 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 98.85 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.84 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.78 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.71 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.68 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.66 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 98.55 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.49 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.43 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 98.39 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.31 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 98.16 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 98.05 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.86 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.8 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.46 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 97.25 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 97.15 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.06 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 96.7 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 96.64 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 95.98 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 94.59 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 93.48 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 92.69 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 90.96 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 89.38 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 88.43 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 86.94 | |
| 1wh9_A | 92 | 40S ribosomal protein S3; KH domain, structural ge | 81.67 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=2.1e-30 Score=215.04 Aligned_cols=166 Identities=25% Similarity=0.388 Sum_probs=134.4
Q ss_pred CCCeEEEEEecCcccccccccCchhHHHHHhhhCceEEEccc---ccCCCccEEEecCCCCCchhhHHHHHHHHHHHHHh
Q 025165 47 AQDVLFRIIVPSRQIGKVIGKEGHRIQKIREETKATIKIADA---IARHEERVIIISSKDNDNVVSDAENALQQIAALIL 123 (257)
Q Consensus 47 ~~~~~~rilVP~~~vg~IIGkgG~~Ik~I~~~tga~I~i~~~---~~~~~ervv~I~G~~~~~~~~~~~~a~~~I~~~i~ 123 (257)
+++++++|+||.+.+|.||||+|++|++|+++|||+|+|++. .+++.+|+|+|+|..+ ++.+|..+|.+++.
T Consensus 3 ~~~~~~~i~vp~~~ig~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~~~~~er~v~I~G~~~-----~v~~A~~~I~~~~~ 77 (178)
T 2anr_A 3 GSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIE-----ALNAVHGFIAEKIR 77 (178)
T ss_dssp CCCEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHCCEEEECCTTCBCTTSSEEEEEEEECHH-----HHHHHHHHHHHHHT
T ss_pred CCCEEEEEEEChhHeeeeECCCcHHHHHHHHHhCCeEEEecCCCCCCCCCCceEEEEeCHH-----HHHHHHHHHHHHHh
Confidence 467899999999999999999999999999999999999854 3568899999999843 68899999999987
Q ss_pred cCCCCCchhh--hh-----ccCCCcceEEEEEeccCccceeecCCChhHHHHHHHhCCeEEEeCCCCCCcccCCCCCceE
Q 025165 124 KDDDSNSEAS--KV-----AAGHVAANTIRLLIAGSQAGCLIGMSGQNIEKLRNSSGATIVILAPNQLPLCASAHESDRV 196 (257)
Q Consensus 124 ~~~~~~~~~~--~~-----~~~~~~~~~~~l~Vp~~~vG~iIGk~G~~Ik~I~~~tga~I~i~~~~~~p~~~~~~~~~r~ 196 (257)
+......... .. ........+.+++||.+++|+|||++|++||+|+++|||+|+|.+....+. +.++.
T Consensus 78 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~Vp~~~vg~iIGkgG~~Ik~i~~~tga~I~i~~~~~~~~-----~~~~~ 152 (178)
T 2anr_A 78 EMPQNVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGIN-----LQNRV 152 (178)
T ss_dssp CCCCC-----------------CGGGGEEEEEEEHHHHHHHHCGGGHHHHHHHHHSSCEEEECCCC---------CCEEE
T ss_pred ccCCccccCCcccccCCccCCCCCCceEEEEEEchhheeeeECCCcHHHHHHHHHHCCEEEEeCCCCCCC-----CCceE
Confidence 6543211000 00 001123468899999999999999999999999999999999975433332 67899
Q ss_pred EEEEcCHHHHHHHHHHHHHHHhcCCC
Q 025165 197 VQISGDVPAVLNALVEIGNQLRENPP 222 (257)
Q Consensus 197 V~I~G~~~~v~~A~~~I~~~l~e~~~ 222 (257)
|+|+|++++|.+|+++|.++|+++|.
T Consensus 153 v~I~G~~~~v~~A~~~I~~~i~e~p~ 178 (178)
T 2anr_A 153 VTVSGEPEQNRKAVELIIQKIQEDPQ 178 (178)
T ss_dssp EEEESSHHHHHHHHHHHHHHHHSCCC
T ss_pred EEEEcCHHHHHHHHHHHHHHHHhCCC
Confidence 99999999999999999999999874
|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 257 | ||||
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 1e-10 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 1e-08 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 4e-09 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 2e-08 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 6e-09 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-07 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 8e-09 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 9e-08 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 2e-08 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 4e-07 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 2e-08 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 7e-08 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 5e-08 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 5e-08 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 2e-06 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 5e-08 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 8e-07 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 7e-08 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 4e-06 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 8e-08 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 0.001 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 4e-07 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 9e-05 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 6e-07 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 6e-05 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 8e-07 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 4e-05 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-06 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 2e-05 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 4e-05 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 1e-04 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 2e-04 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 3e-04 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 6e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 9e-04 |
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 54.0 bits (130), Expect = 1e-10
Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 9/76 (11%)
Query: 144 TIRLLIAGSQAGCLIGMSGQNIEKLRNSSGATIVILAPNQLPLCASAHESDRVVQISGDV 203
TIRLL+ G + G +IG G++++K+R SGA I I N +R++ ++G
Sbjct: 5 TIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGN---------CPERIITLAGPT 55
Query: 204 PAVLNALVEIGNQLRE 219
A+ A I ++L E
Sbjct: 56 NAIFKAFAMIIDKLEE 71
|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 257 | |||
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.67 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.67 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.67 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.66 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.66 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.65 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.62 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.6 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.6 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.6 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.6 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.56 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.55 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.53 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.52 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.45 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.41 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.28 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.16 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.11 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 99.07 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 99.02 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 99.0 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.98 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.87 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.8 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.77 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.75 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.68 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.32 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.29 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.13 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 98.05 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.91 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 96.36 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 96.33 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 96.19 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 95.92 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 93.28 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 90.37 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 86.11 | |
| d2uubc1 | 105 | Ribosomal protein S3 N-terminal domain {Thermus th | 85.01 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 85.0 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 82.79 |
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.67 E-value=4.1e-17 Score=113.55 Aligned_cols=69 Identities=35% Similarity=0.615 Sum_probs=63.1
Q ss_pred ceEEEEEeccCccceeecCCChhHHHHHHHhCCeEEEeCCCCCCcccCCCCCceEEEEEcCHHHHHHHHHHHHHHHhc
Q 025165 142 ANTIRLLIAGSQAGCLIGMSGQNIEKLRNSSGATIVILAPNQLPLCASAHESDRVVQISGDVPAVLNALVEIGNQLRE 219 (257)
Q Consensus 142 ~~~~~l~Vp~~~vG~iIGk~G~~Ik~I~~~tga~I~i~~~~~~p~~~~~~~~~r~V~I~G~~~~v~~A~~~I~~~l~e 219 (257)
.++++++||++++|+|||++|++|++|+++|||+|++++. +..+|+|+|+|++++|.+|..+|.++|+|
T Consensus 3 ~vt~~i~vp~~~~g~IIGk~G~~I~~I~~~tga~I~i~~~---------~~~er~v~I~G~~~~v~~A~~~I~~~l~E 71 (71)
T d2axya1 3 TLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEG---------NCPERIITLAGPTNAIFKAFAMIIDKLEE 71 (71)
T ss_dssp CEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHCCEEEECSS---------CCSEEEEEEEECHHHHHHHHHHHHHHHHC
T ss_pred cEEEEEEECHHHcCeEECCCChhHHHHHHHhCCEEEEcCC---------CCCcceEEEEECHHHHHHHHHHHHHHhcC
Confidence 4689999999999999999999999999999999999642 15689999999999999999999999986
|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|