Citrus Sinensis ID: 025221

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MVVQQEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAVSSPSSSSSNYSSPSSTVTTVDSMPCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
ccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHcccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHccc
cccHHcccccccccHHHHHHHHHHHHHHccccHHHHHcHcccHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccEEccc
mvvqqeevrkgpwteqeDILLVNFVQLFGDRRWDFIAKVsglnrtgkscrlrwvnylhpglkrgkmtpqEERLVLELHAKWGNRWSRIarklpgrtdneIKNYWRTHMRKKAQErkravsspsssssnysspsstvttvdsmpcpppqgkasfydtggnDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMkqdgngnvnfacpspmaapacwgysswdsiWKMDEADEESKMminlptddqFISSWAATLTG
mvvqqeevrkgpwteqediLLVNFVQLFGDRRWDFIAKVsglnrtgkscrlrWVNYlhpglkrgkmtpqEERLVLELhakwgnrwsriarklpgrtdneiknyWRTHMRKKAqerkravsspsssssnysspsSTVTTVDSMPCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMInlptddqfISSWAATLTG
MVVQQEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAvsspsssssnysspsstvttvdsmpCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
************WTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWR********************************************************TRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMD*****************FI*********
*VVQ*EEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHM************************************************************************DIWKDIELSEEK*M*********F**********CWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
***********PWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHM**********************************PCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
MVVQQEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKR**************************************************************DDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMD**DEESKM*****TDDQFISSW*ATL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVQQEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAVSSPSSSSSNYSSPSSTVTTVDSMPCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q9LX82256 Transcription factor MYB4 yes no 0.925 0.925 0.624 5e-71
Q4JL84235 Transcription factor MYB5 no no 0.816 0.889 0.633 5e-68
Q53NK6237 Myb-related protein MYBAS yes no 0.871 0.940 0.539 2e-59
Q4JL76242 Myb-related protein MYBAS no no 0.453 0.479 0.862 2e-56
P81391205 Myb-related protein 305 O N/A no 0.675 0.843 0.438 2e-41
Q9LK95226 Transcription factor MYB2 no no 0.710 0.805 0.413 1e-40
P81396198 Myb-related protein 340 O N/A no 0.687 0.888 0.446 5e-39
O22264 371 Transcription factor MYB1 no no 0.523 0.361 0.489 4e-33
Q0JIC2 553 Transcription factor GAMY no no 0.402 0.186 0.553 7e-33
Q50EX6294 Protein ODORANT1 OS=Petun N/A no 0.406 0.353 0.586 7e-33
>sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 Back     alignment and function desciption
 Score =  267 bits (683), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 182/250 (72%), Gaps = 13/250 (5%)

Query: 2   VVQQEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGL 61
           ++Q+E  RKGPWTEQEDILLVNFV LFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGL
Sbjct: 1   MMQEEGNRKGPWTEQEDILLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGL 60

Query: 62  KRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAVS- 120
           KRGKMTPQEERLVLELHAKWGNRWS+IARKLPGRTDNEIKNYWRTHMRKKAQE+KR VS 
Sbjct: 61  KRGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKRPVSP 120

Query: 121 SPSSSSSNYSSPSSTVTTVDSMPCPPPQ--GKASFYDTGGNDETRVAAALVEEYETSCYS 178
           + S S+ + SS ++T T      C   +  G+ SFYDTGG+  TR    + +E E   YS
Sbjct: 121 TSSFSNCSSSSVTTTTTNTQDTSCHSRKSSGEVSFYDTGGSRSTR---EMNQENE-DVYS 176

Query: 179 MDDIWKDIELSEEKIMK--QDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKM 236
           +DDIW++I+ S   I+K  +D     +     P  A   W  SS DSIW MD   ++SK+
Sbjct: 177 LDDIWREIDHSAVNIIKPVKDIYSEQSHCLSYPNLASPSWE-SSLDSIWNMDA--DKSKI 233

Query: 237 MINLPTDDQF 246
                 +DQF
Sbjct: 234 SSYF-ANDQF 242
Transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 Back     alignment and function description
>sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 Back     alignment and function description
>sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 Back     alignment and function description
>sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 Back     alignment and function description
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function description
>sp|Q0JIC2|GAM1_ORYSJ Transcription factor GAMYB OS=Oryza sativa subsp. japonica GN=GAM1 PE=2 SV=1 Back     alignment and function description
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
255580592244 r2r3-myb transcription factor, putative 0.945 0.991 0.649 3e-79
225435070258 PREDICTED: transcription factor MYB59-li 0.968 0.961 0.642 2e-77
224054846241 predicted protein [Populus trichocarpa] 0.906 0.962 0.643 2e-72
297746133235 unnamed protein product [Vitis vinifera] 0.878 0.957 0.630 2e-72
224104487228 predicted protein [Populus trichocarpa] 0.882 0.991 0.665 4e-72
297815766258 hypothetical protein ARALYDRAFT_347705 [ 0.933 0.926 0.629 8e-72
449460969267 PREDICTED: transcription factor MYB48-li 0.917 0.880 0.607 7e-70
15231343256 transcription factor MYB48 [Arabidopsis 0.925 0.925 0.624 3e-69
357454091243 Myb-like transcription factor [Medicago 0.902 0.950 0.584 4e-69
449467898241 PREDICTED: transcription factor MYB59-li 0.832 0.883 0.605 6e-67
>gi|255580592|ref|XP_002531120.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223529316|gb|EEF31285.1| r2r3-myb transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 163/251 (64%), Positives = 190/251 (75%), Gaps = 9/251 (3%)

Query: 1   MVVQQEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPG 60
           M + Q+E+RKGPWTEQEDILL+NFV LFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPG
Sbjct: 1   MKMMQDEIRKGPWTEQEDILLINFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPG 60

Query: 61  LKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAVS 120
           LKRGKMTPQEE+LVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA+S
Sbjct: 61  LKRGKMTPQEEKLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAMS 120

Query: 121 SPSSSSSNYSSPSSTVTTVDSMPCPPPQGKASFYDTGGNDETRVAAALVEEYETS--CYS 178
              SSSS+ SS  S +TTV+S    P  G+ASFYDTGG D + +     EE +     YS
Sbjct: 121 --PSSSSSNSSSGSNITTVNSSSPFPETGEASFYDTGGPDSSALGGKSREEVQGGEKGYS 178

Query: 179 MDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMI 238
           MD+IWKDIE +   +         NF+CPS ++ P  W Y   + +W+MD  DEESKM++
Sbjct: 179 MDEIWKDIENTIGPVCDGFSKEGCNFSCPSIVSPP--WDYCP-EPLWRMD--DEESKMLL 233

Query: 239 NLPTDDQFISS 249
           +      F++ 
Sbjct: 234 SYEYGTMFLTG 244

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225435070|ref|XP_002284400.1| PREDICTED: transcription factor MYB59-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224054846|ref|XP_002298375.1| predicted protein [Populus trichocarpa] gi|222845633|gb|EEE83180.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297746133|emb|CBI16189.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224104487|ref|XP_002313452.1| predicted protein [Populus trichocarpa] gi|222849860|gb|EEE87407.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297815766|ref|XP_002875766.1| hypothetical protein ARALYDRAFT_347705 [Arabidopsis lyrata subsp. lyrata] gi|297321604|gb|EFH52025.1| hypothetical protein ARALYDRAFT_347705 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449460969|ref|XP_004148216.1| PREDICTED: transcription factor MYB48-like [Cucumis sativus] gi|449519206|ref|XP_004166626.1| PREDICTED: transcription factor MYB48-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15231343|ref|NP_190199.1| transcription factor MYB48 [Arabidopsis thaliana] gi|75335604|sp|Q9LX82.1|MYB48_ARATH RecName: Full=Transcription factor MYB48; AltName: Full=Myb-related protein 48; Short=AtMYB48 gi|9864079|gb|AAG01294.1|AF272733_1 putative transcription factor [Arabidopsis thaliana] gi|7799001|emb|CAB90940.1| Myb DNA binding protein-like [Arabidopsis thaliana] gi|41619274|gb|AAS10064.1| MYB transcription factor [Arabidopsis thaliana] gi|332644596|gb|AEE78117.1| transcription factor MYB48 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357454091|ref|XP_003597326.1| Myb-like transcription factor [Medicago truncatula] gi|355486374|gb|AES67577.1| Myb-like transcription factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|449467898|ref|XP_004151659.1| PREDICTED: transcription factor MYB59-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
TAIR|locus:2075236256 MYB48 "myb domain protein 48" 0.925 0.925 0.6 4.3e-70
TAIR|locus:2174324235 MYB59 "myb domain protein 59" 0.457 0.497 0.931 6.8e-69
TAIR|locus:2087183269 MYB305 "myb domain protein 305 0.425 0.405 0.688 7.6e-44
TAIR|locus:2140847261 MYB79 "myb domain protein 79" 0.421 0.413 0.697 7.6e-44
TAIR|locus:2089812276 MYB121 "myb domain protein 121 0.445 0.413 0.649 2.5e-43
TAIR|locus:2032975283 MYB116 "myb domain protein 116 0.421 0.381 0.638 8.4e-41
TAIR|locus:2089159226 MYB21 "myb domain protein 21" 0.414 0.469 0.622 1.4e-40
TAIR|locus:2102013238 MYB27 "myb domain protein 27" 0.429 0.462 0.654 4.2e-40
TAIR|locus:2170573214 MYB24 "myb domain protein 24" 0.406 0.485 0.625 7.4e-40
TAIR|locus:2199357286 MYB62 "myb domain protein 62" 0.433 0.388 0.630 1.1e-39
TAIR|locus:2075236 MYB48 "myb domain protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 710 (255.0 bits), Expect = 4.3e-70, P = 4.3e-70
 Identities = 150/250 (60%), Positives = 170/250 (68%)

Query:     2 VVQQEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGL 61
             ++Q+E  RKGPWTEQEDILLVNFV LFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGL
Sbjct:     1 MMQEEGNRKGPWTEQEDILLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGL 60

Query:    62 KRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAXXX 121
             KRGKMTPQEERLVLELHAKWGNRWS+IARKLPGRTDNEIKNYWRTHMRKKAQE+KR    
Sbjct:    61 KRGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKRPVSP 120

Query:   122 XXXXXX-XXXXXXXXXXXXXXXXCPPPQ--GKASFYDTGGNDETRVAAALVEEYETSCYS 178
                                    C   +  G+ SFYDTGG+  TR    + +E E   YS
Sbjct:   121 TSSFSNCSSSSVTTTTTNTQDTSCHSRKSSGEVSFYDTGGSRSTR---EMNQENE-DVYS 176

Query:   179 MDDIWKDIELSEEKIMK--QDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKM 236
             +DDIW++I+ S   I+K  +D     +     P  A   W  SS DSIW MD AD+ SK+
Sbjct:   177 LDDIWREIDHSAVNIIKPVKDIYSEQSHCLSYPNLASPSWE-SSLDSIWNMD-ADK-SKI 233

Query:   237 MINLPTDDQF 246
                   +DQF
Sbjct:   234 SSYF-ANDQF 242
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS;TAS
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
TAIR|locus:2174324 MYB59 "myb domain protein 59" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087183 MYB305 "myb domain protein 305" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140847 MYB79 "myb domain protein 79" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089812 MYB121 "myb domain protein 121" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032975 MYB116 "myb domain protein 116" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102013 MYB27 "myb domain protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170573 MYB24 "myb domain protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199357 MYB62 "myb domain protein 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LX82MYB48_ARATHNo assigned EC number0.6240.92570.9257yesno
Q53NK6MYBA1_ORYSJNo assigned EC number0.53900.87100.9409yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 1e-39
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 1e-37
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-15
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-14
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 5e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 3e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-10
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 7e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-04
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  137 bits (345), Expect = 1e-39
 Identities = 62/104 (59%), Positives = 80/104 (76%)

Query: 8   VRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMT 67
           +++GPWT +ED +LV+F++  G+ RW  + K +GL R GKSCRLRW+NYL P +KRG +T
Sbjct: 23  MKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGIT 82

Query: 68  PQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKK 111
             EE L+L LH   GNRWS IA ++PGRTDNEIKNYW TH+RKK
Sbjct: 83  SDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKK 126

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.8
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.75
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.67
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.58
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.52
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.45
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.41
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.41
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.25
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.22
PLN03212249 Transcription repressor MYB5; Provisional 99.11
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.1
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.09
PLN03091 459 hypothetical protein; Provisional 99.04
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.02
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.02
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.95
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.16
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.96
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.81
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.58
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.35
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.2
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.14
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.07
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.96
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.92
KOG1279506 consensus Chromatin remodeling factor subunit and 96.92
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.88
KOG1279506 consensus Chromatin remodeling factor subunit and 96.79
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.78
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.32
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.16
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.12
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.92
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.77
PRK13923170 putative spore coat protein regulator protein YlbO 95.75
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.66
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.57
PRK13923170 putative spore coat protein regulator protein YlbO 95.12
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.96
KOG4282345 consensus Transcription factor GT-2 and related pr 94.86
KOG2656 445 consensus DNA methyltransferase 1-associated prote 94.03
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 93.99
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 92.16
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.47
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 89.9
KOG4167907 consensus Predicted DNA-binding protein, contains 88.24
KOG1194 534 consensus Predicted DNA-binding protein, contains 87.22
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 87.21
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 86.21
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 85.11
KOG4282345 consensus Transcription factor GT-2 and related pr 81.48
smart0059589 MADF subfamily of SANT domain. 81.02
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=7.3e-35  Score=256.86  Aligned_cols=113  Identities=55%  Similarity=1.027  Sum_probs=107.6

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHhCCCCchhhhhhcccccccccccchhhhccCCCCcCCCCCHHHHHHHHHHHhhcCCc
Q 025221            5 QEEVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNR   84 (256)
Q Consensus         5 ~~~~kkg~WT~EED~~L~~lv~~~g~~~W~~IA~~lgp~Rt~~qcr~Rw~~~L~p~l~k~~WT~EED~~Ll~lv~~~G~~   84 (256)
                      ++++++++||+|||++|+++|++||..+|..||+.++++|+++|||+||.++|+|.+++++||+|||++|++++.+||++
T Consensus        20 K~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLlel~~~~GnK   99 (249)
T PLN03212         20 KMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNR   99 (249)
T ss_pred             cCCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHHHHHHhcccc
Confidence            46799999999999999999999998899999999877999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCCCHHHHHHHHHHHhHHHHHhhhh
Q 025221           85 WSRIARKLPGRTDNEIKNYWRTHMRKKAQERKR  117 (256)
Q Consensus        85 W~~Ia~~l~gRt~~~~knrw~~~lrk~~~~~~~  117 (256)
                      |+.||++|+|||+++|||||+.+++++..+...
T Consensus       100 Ws~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i  132 (249)
T PLN03212        100 WSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGI  132 (249)
T ss_pred             HHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCC
Confidence            999999999999999999999999998766544

>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 4e-24
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 5e-24
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 8e-24
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 9e-24
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 3e-22
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 8e-17
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 2e-13
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 4e-11
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-09
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 4e-09
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 4e-08
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 1e-07
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-07
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure 
Iteration: 1

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 75/107 (70%), Gaps = 3/107 (2%)
Query: 7   EVRKGPWTEQEDILLVNFVQLFGDRRWDFIAK-VSGLNRTGKSCRLRWVNYLHPGLKRGK 65
           E+ KGPWT++ED  ++  VQ +G +RW  IAK + G  R GK CR RW N+L+P +K+  
Sbjct: 55  ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG--RIGKQCRERWHNHLNPEVKKTS 112
Query: 66  MTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKA 112
            T +E+R++ + H + GNRW+ IA+ LPGRTDN IKN+W + MR+K 
Sbjct: 113 WTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 159
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 7e-57
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-56
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-55
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-55
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-52
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-50
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 6e-30
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 8e-06
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 7e-05
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-21
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-05
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-20
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-04
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-18
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 6e-07
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-17
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 4e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-12
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 1e-12
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 2e-12
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-10
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-08
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 3e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-08
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 7e-08
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 7e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 3e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 6e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 3e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 3e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 5e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 2e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 9e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 6e-05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 2e-04
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  177 bits (450), Expect = 7e-57
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 10  KGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQ 69
           KGP+TE ED L+  +V+  G + W  I      NR+ K CR RW N+L P + +   TP+
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLP-NRSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 70  EERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAVSSPSSSSSNY 129
           E+  +   + K G++WS IA+ +PGRTDN IKN W + + K+               S  
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120

Query: 130 SSPSS 134
              + 
Sbjct: 121 RKAAD 125
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.85
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.83
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.79
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.75
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.73
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.72
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.71
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.71
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.7
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.69
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.68
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.68
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.64
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.64
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.63
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.63
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.63
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.61
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.6
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.58
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.58
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.58
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.56
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.56
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.56
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.55
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.31
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.53
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.53
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.53
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.49
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.46
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.46
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.44
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.42
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.39
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.37
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.37
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.36
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.36
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.02
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.33
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.32
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.31
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.31
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.31
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.29
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.26
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.23
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.06
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.03
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.0
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.89
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.81
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.81
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.8
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.73
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.56
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.55
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.48
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.42
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.39
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.36
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.19
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.19
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.14
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.38
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.04
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.03
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.02
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.88
2crg_A70 Metastasis associated protein MTA3; transcription 97.68
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.63
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.62
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.49
2crg_A70 Metastasis associated protein MTA3; transcription 97.31
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.27
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.24
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.1
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.1
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.92
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.88
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.85
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.4
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.55
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 92.89
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 92.71
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 91.03
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 90.04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=3.1e-35  Score=229.45  Aligned_cols=104  Identities=49%  Similarity=0.949  Sum_probs=99.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCchhhhhhcccccccccccchhhhccCCCCcCCCCCHHHHHHHHHHHhhcCCccc
Q 025221            7 EVRKGPWTEQEDILLVNFVQLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWS   86 (256)
Q Consensus         7 ~~kkg~WT~EED~~L~~lv~~~g~~~W~~IA~~lgp~Rt~~qcr~Rw~~~L~p~l~k~~WT~EED~~Ll~lv~~~G~~W~   86 (256)
                      ++++|+||+|||++|+++|.+||..+|..||+.| ++|+++||++||.++|+|.+++++||+|||++|+++|.+||++|+
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l-~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHL-KGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTS-TTCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhh-cCCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            4789999999999999999999988999999999 699999999999999999999999999999999999999999999


Q ss_pred             cccccCCCCCHHHHHHHHHHHhHHH
Q 025221           87 RIARKLPGRTDNEIKNYWRTHMRKK  111 (256)
Q Consensus        87 ~Ia~~l~gRt~~~~knrw~~~lrk~  111 (256)
                      .||++|||||+++|++||+.+++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~  104 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRK  104 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC--
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhcc
Confidence            9999999999999999999999875
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 256
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 4e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-16
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-10
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-16
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-09
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-15
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-11
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-14
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 7e-10
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 5e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-07
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 8e-13
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 8e-08
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-12
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 9e-07
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-11
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-06
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-10
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-10
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 3e-04
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-07
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 8e-04
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-07
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Telomere binding protein TBP1
species: Tobacco (Nicotiana tabacum) [TaxId: 4097]

 Score = 74.3 bits (182), Expect = 4e-18
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 9/82 (10%)

Query: 12 PWTEQEDILLVNFVQLFGDRRWDFIAKV---SGLNRTGKSCRLRWVNYLH-----PGLKR 63
          P++  E   LV  V+  G  RW  +      +  +RT    + +W   +H     P  +R
Sbjct: 2  PFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRR 61

Query: 64 GKMTPQEERL-VLELHAKWGNR 84
          G+  PQ+    VL  HA W  +
Sbjct: 62 GEPVPQDLLDRVLAAHAYWSQQ 83
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.77
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.75
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.7
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.65
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.61
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.57
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.57
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.51
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.51
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.5
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.49
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.48
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.46
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.46
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.4
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.39
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.39
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.34
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.33
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.32
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.28
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.2
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.19
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.17
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.01
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.99
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.75
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.19
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.16
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.09
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.98
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.42
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.93
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.77
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.75
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.82
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 94.07
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.39
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 91.69
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 90.95
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.77  E-value=2.2e-21  Score=144.76  Aligned_cols=72  Identities=28%  Similarity=0.327  Sum_probs=66.0

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCCC-----chhhhhhcccccccccccchhhhccCCCCcCCCCCHHHHHHHHHHHhhcC
Q 025221           10 KGPWTEQEDILLVNFVQLFGDRR-----WDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWG   82 (256)
Q Consensus        10 kg~WT~EED~~L~~lv~~~g~~~-----W~~IA~~lgp~Rt~~qcr~Rw~~~L~p~l~k~~WT~EED~~Ll~lv~~~G   82 (256)
                      |+.||+|||++|+++|.+||..+     |..||+.| |+||++|||+||.++|+|.+++++||++||++|+..+..+.
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~l-pgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~li   77 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYV-PNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLI   77 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTS-TTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCBC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHc-CCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhccc
Confidence            68999999999999999998643     99999999 79999999999999999999999999999999988765543
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure