Citrus Sinensis ID: 025245
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 255 | ||||||
| 255548201 | 261 | peptidyl-prolyl cis-trans isomerase, put | 0.949 | 0.927 | 0.809 | 1e-113 | |
| 224064414 | 266 | predicted protein [Populus trichocarpa] | 0.980 | 0.939 | 0.776 | 1e-111 | |
| 147766520 | 253 | hypothetical protein VITISV_015631 [Viti | 0.854 | 0.861 | 0.839 | 1e-105 | |
| 359480225 | 253 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.854 | 0.861 | 0.834 | 1e-104 | |
| 359806424 | 260 | uncharacterized protein LOC100785805 [Gl | 0.949 | 0.930 | 0.708 | 2e-97 | |
| 356534945 | 263 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.945 | 0.916 | 0.668 | 8e-95 | |
| 388500332 | 262 | unknown [Lotus japonicus] | 0.937 | 0.912 | 0.696 | 2e-94 | |
| 449511931 | 252 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.941 | 0.952 | 0.683 | 1e-92 | |
| 356534947 | 252 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.905 | 0.916 | 0.679 | 4e-92 | |
| 357511613 | 256 | Peptidyl-prolyl cis-trans isomerase [Med | 0.929 | 0.925 | 0.677 | 3e-91 |
| >gi|255548201|ref|XP_002515157.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223545637|gb|EEF47141.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 414 bits (1064), Expect = e-113, Method: Compositional matrix adjust.
Identities = 200/247 (80%), Positives = 219/247 (88%), Gaps = 5/247 (2%)
Query: 8 GSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTSRSHYASSFPIVQLSKAPSV 67
G+ Q V N+ M S++ +S SG TL +GRALTSRS Y+ SFPI QLSKAPSV
Sbjct: 19 GTDGQDVKNLSRTCMISAMRSSASG-----TLSFAGRALTSRSRYSLSFPITQLSKAPSV 73
Query: 68 KYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCT 127
K++RM C+ +MA D+E+QAKVTTKVFFDVDIGG+PAGRIVMGLFGDVVPKTAENFRALCT
Sbjct: 74 KHQRMACIKAMANDLEVQAKVTTKVFFDVDIGGEPAGRIVMGLFGDVVPKTAENFRALCT 133
Query: 128 GEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMA 187
G+KGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGG+SI+GSSFEDESF LKHVGPGVLSMA
Sbjct: 134 GDKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGVSIFGSSFEDESFDLKHVGPGVLSMA 193
Query: 188 NAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRIIN 247
NAGPNTNGSQFFICTVKTPWLDNRHVVFG VIDGMDVVRKLESVETSR+DYP+ PCRIIN
Sbjct: 194 NAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIDGMDVVRKLESVETSRSDYPRKPCRIIN 253
Query: 248 SGELPLD 254
GELPLD
Sbjct: 254 CGELPLD 260
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224064414|ref|XP_002301464.1| predicted protein [Populus trichocarpa] gi|222843190|gb|EEE80737.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147766520|emb|CAN69876.1| hypothetical protein VITISV_015631 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359480225|ref|XP_002273421.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like isoform 1 [Vitis vinifera] gi|297744066|emb|CBI37036.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359806424|ref|NP_001240987.1| uncharacterized protein LOC100785805 [Glycine max] gi|255645203|gb|ACU23099.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356534945|ref|XP_003536011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388500332|gb|AFK38232.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449511931|ref|XP_004164092.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356534947|ref|XP_003536012.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357511613|ref|XP_003626095.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355501110|gb|AES82313.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 255 | ||||||
| TAIR|locus:2079507 | 313 | ROC4 "rotamase CYP 4" [Arabido | 0.831 | 0.677 | 0.680 | 4.1e-72 | |
| TAIR|locus:2179822 | 259 | Pnsl5 "Photosynthetic NDH subc | 0.854 | 0.841 | 0.530 | 2.8e-57 | |
| UNIPROTKB|P30405 | 207 | PPIF "Peptidyl-prolyl cis-tran | 0.545 | 0.671 | 0.697 | 2.2e-50 | |
| ZFIN|ZDB-GENE-040426-1955 | 216 | ppib "peptidylprolyl isomerase | 0.717 | 0.847 | 0.557 | 2.2e-50 | |
| MGI|MGI:97750 | 216 | Ppib "peptidylprolyl isomerase | 0.698 | 0.824 | 0.567 | 4.6e-50 | |
| UNIPROTKB|P45877 | 212 | PPIC "Peptidyl-prolyl cis-tran | 0.643 | 0.773 | 0.628 | 5.8e-50 | |
| UNIPROTKB|F1NV93 | 207 | PPIB "Peptidyl-prolyl cis-tran | 0.698 | 0.859 | 0.567 | 9.5e-50 | |
| UNIPROTKB|F1P4M4 | 223 | PPIB "Peptidyl-prolyl cis-tran | 0.698 | 0.798 | 0.567 | 9.5e-50 | |
| UNIPROTKB|F1RVH5 | 211 | LOC100524880 "Peptidyl-prolyl | 0.643 | 0.777 | 0.628 | 9.5e-50 | |
| UNIPROTKB|Q08E11 | 212 | PPIC "Peptidyl-prolyl cis-tran | 0.643 | 0.773 | 0.621 | 1.2e-49 |
| TAIR|locus:2079507 ROC4 "rotamase CYP 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 729 (261.7 bits), Expect = 4.1e-72, P = 4.1e-72
Identities = 149/219 (68%), Positives = 165/219 (75%)
Query: 42 SGRALTSRSHYASSFPIVQLSKA-PSVKYRRMFCVNSMAKD----VELQAKVTTKVFFDV 96
SG AL+SR HYAS PI Q S + K++R CV SMA + +E QAKVT KV+FDV
Sbjct: 97 SGIALSSRLHYAS--PIKQFSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDV 154
Query: 97 DIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXX 156
+IGG+ AGRIVMGLFG+VVPKT ENFRALCTGEK YGYKG SFHRIIKDFMIQ
Sbjct: 155 EIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEG 214
Query: 157 XXXXXISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFG 216
ISIYG+ FEDE+F LKH GPG+LSMANAGPNTNGSQFFICTVKT WLDN+HVVFG
Sbjct: 215 NGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFG 274
Query: 217 HVIDGMDVVRKLESVETSRTDYPKVPCRIINSGELPLDA 255
VI+GM +VR LES ET D PK CRI GELPLDA
Sbjct: 275 QVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPLDA 313
|
|
| TAIR|locus:2179822 Pnsl5 "Photosynthetic NDH subcomplex L 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P30405 PPIF "Peptidyl-prolyl cis-trans isomerase F, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1955 ppib "peptidylprolyl isomerase B (cyclophilin B)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97750 Ppib "peptidylprolyl isomerase B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P45877 PPIC "Peptidyl-prolyl cis-trans isomerase C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NV93 PPIB "Peptidyl-prolyl cis-trans isomerase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4M4 PPIB "Peptidyl-prolyl cis-trans isomerase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RVH5 LOC100524880 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08E11 PPIC "Peptidyl-prolyl cis-trans isomerase C" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 255 | |||
| cd01926 | 164 | cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik | 1e-108 | |
| PLN03149 | 186 | PLN03149, PLN03149, peptidyl-prolyl isomerase H (c | 3e-86 | |
| PTZ00060 | 183 | PTZ00060, PTZ00060, cyclophilin; Provisional | 2e-78 | |
| cd00317 | 146 | cd00317, cyclophilin, cyclophilin: cyclophilin-typ | 2e-66 | |
| COG0652 | 158 | COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase | 5e-64 | |
| pfam00160 | 144 | pfam00160, Pro_isomerase, Cyclophilin type peptidy | 6e-62 | |
| cd01927 | 148 | cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo | 1e-61 | |
| cd01923 | 159 | cd01923, cyclophilin_RING, cyclophilin_RING: cyclo | 6e-50 | |
| cd01928 | 153 | cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 | 5e-49 | |
| cd01922 | 146 | cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY | 7e-49 | |
| cd01925 | 171 | cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC | 5e-37 | |
| cd01921 | 166 | cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph | 1e-29 | |
| PTZ00221 | 249 | PTZ00221, PTZ00221, cyclophilin; Provisional | 1e-29 | |
| cd01920 | 155 | cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP | 2e-21 | |
| PRK10791 | 164 | PRK10791, PRK10791, peptidyl-prolyl cis-trans isom | 3e-16 | |
| cd01924 | 176 | cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 | 9e-13 | |
| PRK10903 | 190 | PRK10903, PRK10903, peptidyl-prolyl cis-trans isom | 7e-11 |
| >gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
Score = 308 bits (791), Expect = e-108
Identities = 116/164 (70%), Positives = 132/164 (80%), Gaps = 6/164 (3%)
Query: 91 KVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKG-----YGYKGCSFHRIIKD 145
KVFFD+ IGG+PAGRIVM LF DVVPKTAENFRALCTGEKG +GYKG +FHR+I D
Sbjct: 2 KVFFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGEKGKGGKPFGYKGSTFHRVIPD 61
Query: 146 FMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKT 205
FMIQGGDFT G+GTGG SIYG F DE+F LKH GPG+LSMANAGPNTNGSQFFI TVKT
Sbjct: 62 FMIQGGDFTRGNGTGGKSIYGEKFPDENFKLKHTGPGLLSMANAGPNTNGSQFFITTVKT 121
Query: 206 PWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRIINSG 249
PWLD +HVVFG V++GMDVV+K+E+V + PK I + G
Sbjct: 122 PWLDGKHVVFGKVVEGMDVVKKIENVGSGN-GKPKKKVVIADCG 164
|
This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164 |
| >gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | Back alignment and domain information |
|---|
| >gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 255 | |||
| KOG0880 | 217 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 100.0 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 100.0 | |
| KOG0879 | 177 | consensus U-snRNP-associated cyclophilin type pept | 100.0 | |
| cd01926 | 164 | cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph | 100.0 | |
| PLN03149 | 186 | peptidyl-prolyl isomerase H (cyclophilin H); Provi | 100.0 | |
| PTZ00060 | 183 | cyclophilin; Provisional | 100.0 | |
| PTZ00221 | 249 | cyclophilin; Provisional | 100.0 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 100.0 | |
| KOG0881 | 164 | consensus Cyclophilin type peptidyl-prolyl cis-tra | 100.0 | |
| COG0652 | 158 | PpiB Peptidyl-prolyl cis-trans isomerase (rotamase | 100.0 | |
| cd01928 | 153 | Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro | 100.0 | |
| cd01923 | 159 | cyclophilin_RING cyclophilin_RING: cyclophilin-typ | 100.0 | |
| cd01927 | 148 | cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ | 100.0 | |
| cd01921 | 166 | cyclophilin_RRM cyclophilin_RRM: cyclophilin-type | 100.0 | |
| cd01922 | 146 | cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c | 100.0 | |
| KOG0883 | 518 | consensus Cyclophilin type, U box-containing pepti | 100.0 | |
| cd01925 | 171 | cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: | 100.0 | |
| PRK10903 | 190 | peptidyl-prolyl cis-trans isomerase A (rotamase A) | 100.0 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 100.0 | |
| PRK10791 | 164 | peptidyl-prolyl cis-trans isomerase B (rotamase B) | 100.0 | |
| KOG0865 | 167 | consensus Cyclophilin type peptidyl-prolyl cis-tra | 100.0 | |
| cd01920 | 155 | cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc | 100.0 | |
| KOG0884 | 161 | consensus Similar to cyclophilin-type peptidyl-pro | 100.0 | |
| PF00160 | 155 | Pro_isomerase: Cyclophilin type peptidyl-prolyl ci | 100.0 | |
| cd00317 | 146 | cyclophilin cyclophilin: cyclophilin-type peptidyl | 100.0 | |
| cd01924 | 176 | cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc | 100.0 | |
| KOG0885 | 439 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 100.0 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 100.0 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 97.5 | |
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 95.94 | |
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 95.86 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 95.78 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 95.69 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 95.0 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 94.34 | |
| PF12903 | 147 | DUF3830: Protein of unknown function (DUF3830); In | 88.13 |
| >KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-58 Score=386.60 Aligned_cols=173 Identities=70% Similarity=1.180 Sum_probs=168.7
Q ss_pred hhccccccceEEEEEEECCeeceeEEEEecCCCChhHHHHHHHHhc-cCCCcccCCCEEEEeecCceeeeCCCcCCCCCC
Q 025245 82 VELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCT-GEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTG 160 (255)
Q Consensus 82 ~~~~~~~~~~v~~di~i~~t~~G~ivIeL~~~~aP~t~~nF~~L~~-g~~g~~Y~g~~f~Rii~~f~iqgGd~~~~~g~g 160 (255)
.+..+++|+++||||+++++..|||+|+||++.+|+||+||++||+ ++++++|.|++||||+|||||||||++.++++|
T Consensus 32 ~~~~p~vT~kV~fdi~~g~~~~grIvigLfG~~vPKTV~NF~~l~~~~~~~~gY~gS~FhRVi~nfmIQGGd~t~g~gtG 111 (217)
T KOG0880|consen 32 YEPGPKVTHKVYFDIEIGGEPVGRIVIGLFGKVVPKTVENFRALATSGEKGYGYKGSKFHRVIPNFMIQGGDFTKGDGTG 111 (217)
T ss_pred cCCCCcceeEEEEEEEECCEeccEEEEEeccccchHHHHHHHHHHccCCCCcccCCceeeeeecCceeecCccccCCCCC
Confidence 3567889999999999999999999999999999999999999999 899999999999999999999999999999999
Q ss_pred CccccCCCCCCCcccccccCCeEEEEeecCCCCCCceeEEEcCCCCCCCCCCeEEEEEEcCHHHHHHhhcCCCCCCCCCC
Q 025245 161 GISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPK 240 (255)
Q Consensus 161 ~~~~~g~~~~~e~~~l~h~~~G~lsma~~g~~s~gSqFfItl~~~~~Ld~~~~VFG~VieGmdvl~~I~~~~~~~~~~P~ 240 (255)
+.++||+.|+||++.++|+++|.|||||.|||+||||||||+...+|||++|+|||+|++|||+|.+|+.++||++++|.
T Consensus 112 g~SIyG~~F~DENf~LkH~rpG~lSMAn~GpDtNGsQFfItT~~t~wLDGkhVVFGqVl~Gmdvv~~Ie~~~TD~~dkP~ 191 (217)
T KOG0880|consen 112 GKSIYGEKFPDENFKLKHDRPGRLSMANAGPDTNGSQFFITTVKTPWLDGKHVVFGQVLEGMDVVRKIENVKTDERDKPL 191 (217)
T ss_pred CeEeecCCCCCccceeecCCCceEeeeccCCCCCCceEEEEecCCccccCceeEEeeehhhHHHHHHHHhcccCCCCCcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCeEEEeeEEecCC
Q 025245 241 VPCRIINSGELPLD 254 (255)
Q Consensus 241 ~~V~I~~cGvL~~~ 254 (255)
++++|.+||+|+.+
T Consensus 192 e~v~I~~~g~l~~~ 205 (217)
T KOG0880|consen 192 EDVVIANCGELPVE 205 (217)
T ss_pred ccEEEeecCccccc
Confidence 99999999999754
|
|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >PTZ00060 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >PTZ00221 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms | Back alignment and domain information |
|---|
| >cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 255 | ||||
| 3r49_A | 166 | Human Cyclophilin D Complexed With Quinolin-8-Amine | 2e-54 | ||
| 2bit_X | 165 | Crystal Structure Of Human Cyclophilin D At 1.7 A R | 2e-54 | ||
| 2z6w_A | 165 | Crystal Structure Of Human Cyclophilin D In Complex | 2e-54 | ||
| 3qyu_A | 164 | Crystal Structure Of Human Cyclophilin D At 1.54 A | 3e-54 | ||
| 2esl_A | 190 | Human Cyclophilin C In Complex With Cyclosporin A L | 2e-53 | ||
| 2rmc_A | 182 | Crystal Structure Of Murine Cyclophilin C Complexed | 2e-52 | ||
| 1h0p_A | 182 | Cyclophilin_5 From C. Elegans Length = 182 | 2e-51 | ||
| 1dyw_A | 173 | Biochemical And Structural Characterization Of A Di | 8e-51 | ||
| 3ich_A | 188 | Crystal Structure Of Cyclophilin B At 1.2 A Resolut | 9e-51 | ||
| 4frv_A | 185 | Crystal Structure Of Mutated Cyclophilin B That Cau | 1e-50 | ||
| 1cyn_A | 178 | Cyclophilin B Complexed With [d-(Cholinylester)ser8 | 1e-50 | ||
| 4fru_A | 185 | Crystal Structure Of Horse Wild-Type Cyclophilin B | 1e-50 | ||
| 3rdd_A | 184 | Human Cyclophilin A Complexed With An Inhibitor Len | 8e-50 | ||
| 2ck1_A | 172 | The Structure Of Oxidised Cyclophilin A From S. Man | 2e-49 | ||
| 2haq_A | 172 | Crystal Structure Of Cyclophilin A From Leishmania | 2e-49 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 3e-49 | ||
| 2wlw_A | 165 | Structure Of The N-Terminal Capsid Domain Of Hiv-2 | 7e-49 | ||
| 1xo7_A | 166 | Crystal Structure Of Cyclophilin From Trypanosoma C | 7e-49 | ||
| 1bck_A | 165 | Human Cyclophilin A Complexed With 2-Thr Cyclospori | 8e-49 | ||
| 5cyh_A | 164 | Cyclophilin A Complexed With Dipeptide Gly-Pro Leng | 8e-49 | ||
| 1m9e_A | 164 | X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- | 8e-49 | ||
| 2rma_A | 165 | Crystal Structures Of Cyclophilin A Complexed With | 8e-49 | ||
| 4dgd_A | 165 | Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 | 9e-49 | ||
| 2alf_A | 164 | Crystal Structure Of Human Cypa Mutant K131a Length | 9e-49 | ||
| 2xgy_B | 173 | Complex Of Rabbit Endogenous Lentivirus (Relik)caps | 1e-48 | ||
| 3bt8_A | 172 | Crystal Structure Of Mutant Cyclophilin (R147a) Fro | 1e-48 | ||
| 3k0o_A | 165 | Room Temperature Structure Of Cypa Mutant Ser99thr | 2e-48 | ||
| 1ist_A | 162 | Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng | 2e-48 | ||
| 3k0r_A | 165 | Cryogenic Structure Of Cypa Mutant Arg55lys Length | 2e-48 | ||
| 2x2c_K | 165 | Acetyl-Cypa:cyclosporine Complex Length = 165 | 2e-48 | ||
| 2x2a_A | 165 | Free Acetyl-Cypa Trigonal Form Length = 165 | 2e-48 | ||
| 2x25_B | 169 | Free Acetyl-Cypa Orthorhombic Form Length = 169 | 3e-48 | ||
| 2x83_B | 163 | Evolutionary Basis Of Hiv Restriction By The Antire | 3e-48 | ||
| 2r99_A | 173 | Crystal Structure Of Cyclophilin Abh-Like Domain Of | 5e-48 | ||
| 2hqj_A | 183 | Cyclophilin From Leishmania Major Length = 183 | 6e-48 | ||
| 1zmf_A | 165 | C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 | 2e-47 | ||
| 2cfe_A | 162 | The 1.5 A Crystal Structure Of The Malassezia Sympo | 2e-47 | ||
| 1aws_A | 164 | Secypa Complexed With Hagpia (Pseudo-Symmetric Mono | 4e-46 | ||
| 3uch_A | 174 | Crystal Structure Of A Hypotherical Peptidyl-Prolyl | 1e-45 | ||
| 1qoi_A | 177 | U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = | 5e-45 | ||
| 2gw2_A | 198 | Crystal Structure Of The Peptidyl-Prolyl Isomerase | 9e-44 | ||
| 2plu_A | 186 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 1e-43 | ||
| 2wfj_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 1e-43 | ||
| 3pmp_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 3e-43 | ||
| 3o7t_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 3e-43 | ||
| 1qng_A | 170 | Plasmodium Falciparum Cyclophilin Complexed With Cy | 6e-43 | ||
| 2wfi_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 2e-42 | ||
| 1qnh_A | 170 | Plasmodium Falciparum Cyclophilin (Double Mutant) C | 9e-42 | ||
| 4i9y_A | 167 | Structure Of The C-terminal Domain Of Nup358 Length | 2e-41 | ||
| 1c5f_A | 177 | Crystal Structure Of The Cyclophilin-Like Domain Fr | 3e-41 | ||
| 3k2c_A | 193 | Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom | 1e-39 | ||
| 1z81_A | 229 | Crystal Structure Of Cyclophilin From Plasmodium Yo | 5e-38 | ||
| 2he9_A | 192 | Structure Of The Peptidylprolyl Isomerase Domain Of | 3e-37 | ||
| 2c3b_A | 172 | The Crystal Structure Of Aspergillus Fumigatus Cycl | 1e-35 | ||
| 2a2n_A | 176 | Crystal Structure Of The Peptidylprolyl Isomerase D | 3e-28 | ||
| 1xwn_A | 174 | Solution Structure Of Cyclophilin Like 1(Ppil1) And | 8e-28 | ||
| 2x7k_A | 166 | The Crystal Structure Of Ppil1 In Complex With Cycl | 8e-28 | ||
| 2k7n_A | 203 | Solution Structure Of The Ppil1 Bound To A Fragment | 9e-28 | ||
| 2fu0_A | 160 | Plasmodium Falciparum Cyclophilin Pfe0505w Putative | 2e-25 | ||
| 1xyh_A | 161 | Crystal Structure Of Recombinant Human Cyclophilin | 3e-25 | ||
| 2oju_A | 167 | X-Ray Structure Of Complex Of Human Cyclophilin J W | 4e-25 | ||
| 1zkc_A | 197 | Crystal Structure Of The Cyclophiln_ring Domain Of | 9e-24 | ||
| 1w74_A | 191 | X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer | 2e-21 | ||
| 2b71_A | 196 | Plasmodium Yoelii Cyclophilin-Like Protein Length = | 3e-21 | ||
| 2poe_A | 185 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 5e-17 | ||
| 3bo7_A | 201 | Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro | 1e-15 | ||
| 2hq6_A | 185 | Structure Of The Cyclophilin_cecyp16-like Domain Of | 5e-13 | ||
| 3t1u_A | 163 | Crystal Structure Of The Complex Of Cyclophilin-a E | 5e-09 | ||
| 2nul_A | 164 | Peptidylprolyl Isomerase From E. Coli Length = 164 | 8e-09 | ||
| 1lop_A | 164 | Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P | 4e-08 | ||
| 3bkp_A | 232 | Crystal Structure Of The Toxoplasma Gondii Cyclophi | 2e-06 | ||
| 1clh_A | 166 | Three-Dimensional Solution Structure Of Escherichia | 1e-05 | ||
| 1j2a_A | 166 | Structure Of E. Coli Cyclophilin B K163t Mutant Len | 1e-05 | ||
| 3s6m_A | 167 | The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer | 2e-05 | ||
| 2ose_A | 234 | Crystal Structure Of The Mimivirus Cyclophilin Leng | 1e-04 |
| >pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 | Back alignment and structure |
|
| >pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 | Back alignment and structure |
| >pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 | Back alignment and structure |
| >pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 | Back alignment and structure |
| >pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 | Back alignment and structure |
| >pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 | Back alignment and structure |
| >pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 | Back alignment and structure |
| >pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 | Back alignment and structure |
| >pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 | Back alignment and structure |
| >pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 | Back alignment and structure |
| >pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 | Back alignment and structure |
| >pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 | Back alignment and structure |
| >pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 | Back alignment and structure |
| >pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 | Back alignment and structure |
| >pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 | Back alignment and structure |
| >pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 | Back alignment and structure |
| >pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 | Back alignment and structure |
| >pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 | Back alignment and structure |
| >pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 | Back alignment and structure |
| >pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 | Back alignment and structure |
| >pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 | Back alignment and structure |
| >pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 | Back alignment and structure |
| >pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 | Back alignment and structure |
| >pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 | Back alignment and structure |
| >pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 | Back alignment and structure |
| >pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 | Back alignment and structure |
| >pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 | Back alignment and structure |
| >pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 | Back alignment and structure |
| >pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 | Back alignment and structure |
| >pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 | Back alignment and structure |
| >pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 | Back alignment and structure |
| >pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 | Back alignment and structure |
| >pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 | Back alignment and structure |
| >pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 | Back alignment and structure |
| >pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 | Back alignment and structure |
| >pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 | Back alignment and structure |
| >pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 | Back alignment and structure |
| >pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 | Back alignment and structure |
| >pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 | Back alignment and structure |
| >pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 | Back alignment and structure |
| >pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 | Back alignment and structure |
| >pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 | Back alignment and structure |
| >pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 | Back alignment and structure |
| >pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 | Back alignment and structure |
| >pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 | Back alignment and structure |
| >pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 | Back alignment and structure |
| >pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 | Back alignment and structure |
| >pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 | Back alignment and structure |
| >pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 | Back alignment and structure |
| >pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 | Back alignment and structure |
| >pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 | Back alignment and structure |
| >pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 | Back alignment and structure |
| >pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 | Back alignment and structure |
| >pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 | Back alignment and structure |
| >pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 | Back alignment and structure |
| >pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 | Back alignment and structure |
| >pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 | Back alignment and structure |
| >pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 | Back alignment and structure |
| >pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 | Back alignment and structure |
| >pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 | Back alignment and structure |
| >pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 | Back alignment and structure |
| >pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 | Back alignment and structure |
| >pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 | Back alignment and structure |
| >pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 | Back alignment and structure |
| >pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 | Back alignment and structure |
| >pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 | Back alignment and structure |
| >pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 | Back alignment and structure |
| >pdb|2OSE|A Chain A, Crystal Structure Of The Mimivirus Cyclophilin Length = 234 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 255 | |||
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 1e-125 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 1e-125 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 1e-124 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 1e-123 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 1e-122 | |
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 1e-122 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 1e-121 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 1e-121 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 1e-120 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 1e-120 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 1e-118 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 1e-118 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 1e-118 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 1e-117 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 1e-117 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 1e-117 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 1e-117 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 1e-114 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 1e-111 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 2e-84 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 4e-84 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 1e-83 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 3e-83 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 1e-80 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 5e-76 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 5e-75 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 3e-73 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 1e-71 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 4e-71 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 3e-65 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 2e-64 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 8e-47 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 1e-46 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 1e-44 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 5e-39 |
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
Score = 352 bits (905), Expect = e-125
Identities = 88/179 (49%), Positives = 118/179 (65%), Gaps = 8/179 (4%)
Query: 83 ELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYG--------Y 134
L + + + FD++I +P GRI+ LF D+ PKT +NF LC+GEKG G Y
Sbjct: 13 GLVPRGSPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCY 72
Query: 135 KGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTN 194
KG +FHR++K+FMIQGGDF+EG+G GG SIYG F+DE+F+LKH +LSMAN G +TN
Sbjct: 73 KGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTN 132
Query: 195 GSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRIINSGELPL 253
GSQFFI T P LD HVVFG VI G +V+ ++E+++T P R+I+ G L
Sbjct: 133 GSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLAT 191
|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 255 | |||
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 100.0 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 100.0 | |
| 4fru_A | 185 | Cyclophilin B, peptidyl-prolyl CIS-trans isomerase | 100.0 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 100.0 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 100.0 | |
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 100.0 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 100.0 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 100.0 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 100.0 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 100.0 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 100.0 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 100.0 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 100.0 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 100.0 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 100.0 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 100.0 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 100.0 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 100.0 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 100.0 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 100.0 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 100.0 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 100.0 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 100.0 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 100.0 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 100.0 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 100.0 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 100.0 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 100.0 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 100.0 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 100.0 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 100.0 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 100.0 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 100.0 | |
| 3kop_A | 188 | Uncharacterized protein; protein with A cyclophili | 91.73 | |
| 2nnz_A | 153 | Hypothetical protein; beta-barrel, structural geno | 90.86 |
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-54 Score=365.56 Aligned_cols=166 Identities=63% Similarity=1.086 Sum_probs=161.1
Q ss_pred cccccceEEEEEEECCeeceeEEEEecCCCChhHHHHHHHHhccCCCcccCCCEEEEeecCceeeeCCCcCCCCCCCccc
Q 025245 85 QAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISI 164 (255)
Q Consensus 85 ~~~~~~~v~~di~i~~t~~G~ivIeL~~~~aP~t~~nF~~L~~g~~g~~Y~g~~f~Rii~~f~iqgGd~~~~~g~g~~~~ 164 (255)
++.+++++||||.+++|+.|+|+||||++.||+||+||++||+|++|++|+|+.||||+|+|||||||+..++++|+.++
T Consensus 7 ~~~~~~~v~~di~i~~t~~G~i~ieL~~~~aP~t~~NF~~L~~g~~g~~Y~g~~FhRvi~~f~iQgGd~~~~~g~gg~si 86 (172)
T 2haq_A 7 EPEVTAKVYFDVMIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIQNFMIQGGDFTNFDGTGGKSI 86 (172)
T ss_dssp CCCCCEEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTSCCSTTCBCCEEETTTEEEECCTTTSSSSCCCCS
T ss_pred CCCCCCeEEEEEEECCEecceEEEEEeCCCCcHHHHHHHHHhccCCCcccCCCEEEEEECCCEEecCCccCCCCCCCccc
Confidence 57789999999999999999999999999999999999999998899999999999999999999999888889999999
Q ss_pred cCCCCCCCcccccccCCeEEEEeecCCCCCCceeEEEcCCCCCCCCCCeEEEEEEcCHHHHHHhhcCCCCCCCCCCCCeE
Q 025245 165 YGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCR 244 (255)
Q Consensus 165 ~g~~~~~e~~~l~h~~~G~lsma~~g~~s~gSqFfItl~~~~~Ld~~~~VFG~VieGmdvl~~I~~~~~~~~~~P~~~V~ 244 (255)
||..|++|++.++|. +|+||||+.+|++++|||||++.++++||++|+|||+|++|||||++|++++++.+++|.++|+
T Consensus 87 ~g~~f~dE~~~l~h~-~G~lsmAn~gp~tngSQFfIt~~~~~~LDg~~~vFG~Vv~G~dvv~~I~~~~t~~~~~P~~~v~ 165 (172)
T 2haq_A 87 YGEKFADENLNVKHF-VGALSMANAGPNTNGSQFFITTAPTPWLDGRHVVFGKVLDGMDVVLRIEKTKTNSHDRPVKPVK 165 (172)
T ss_dssp SSSCBCCCCCCSCCC-TTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCGGGCBSSCEE
T ss_pred cCCcccCcCCCcccC-ceEEEEccCCCCCcccEEEEECCCCCccCCCEeEEEEEeCCHHHHHHHHhCCcCCCCcCCCCeE
Confidence 999999999999998 9999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEeeEEe
Q 025245 245 IINSGEL 251 (255)
Q Consensus 245 I~~cGvL 251 (255)
|.+||+|
T Consensus 166 I~~~g~l 172 (172)
T 2haq_A 166 IVASGEL 172 (172)
T ss_dssp EEEEEEC
T ss_pred EEEeEEC
Confidence 9999997
|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 255 | ||||
| d2cfea1 | 162 | b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s | 9e-63 | |
| d1a33a_ | 174 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( | 1e-62 | |
| d2rmca_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus | 2e-62 | |
| d1h0pa_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd | 3e-61 | |
| d1qnga_ | 170 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium | 2e-58 | |
| d2z6wa1 | 164 | b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c | 3e-57 | |
| d1xo7a_ | 166 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom | 3e-57 | |
| d2igva1 | 172 | b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno | 9e-57 | |
| d1ihga2 | 195 | b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain | 3e-55 | |
| d1qoia_ | 173 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom | 2e-54 | |
| d2c3ba1 | 171 | b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper | 9e-54 | |
| d2r99a1 | 161 | b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl | 4e-53 | |
| d1z81a1 | 186 | b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas | 9e-50 | |
| d1zkca1 | 178 | b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso | 3e-49 | |
| d1xwna1 | 166 | b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome | 1e-47 | |
| d1w74a_ | 171 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-40 | |
| d2ok3a1 | 159 | b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B | 8e-40 | |
| d2a2na1 | 164 | b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma | 3e-37 | |
| d2b71a1 | 169 | b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 | 5e-37 | |
| d2fu0a1 | 155 | b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { | 1e-35 | |
| d1lopa_ | 164 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-30 | |
| d1v9ta_ | 166 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-30 |
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Cyclophilin-like allergen Mal s 6 species: Malassezia sympodialis [TaxId: 76777]
Score = 192 bits (488), Expect = 9e-63
Identities = 101/160 (63%), Positives = 118/160 (73%), Gaps = 1/160 (0%)
Query: 90 TKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQ 149
+ VFFD+ G P G I LF DVVPKTA NFRALCTGEKG+GY G FHR+I DFM+Q
Sbjct: 2 SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFMLQ 61
Query: 150 GGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKTPWLD 209
GGDFT G+GTGG SIYG+ F DE+F LKH PG+LSMANAGPNTNGSQFFI TV T WLD
Sbjct: 62 GGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLD 121
Query: 210 NRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRIINSG 249
+HVVFG VIDGM+VV+ +E+ + + P+ I G
Sbjct: 122 GKHVVFGEVIDGMNVVKAIEAEGS-GSGKPRSRIEIAKCG 160
|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 255 | |||
| d2rmca_ | 182 | Cyclophilin (eukaryotic) {Mouse (Mus musculus), va | 100.0 | |
| d1h0pa_ | 182 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d1xo7a_ | 166 | Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId | 100.0 | |
| d2z6wa1 | 164 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d2r99a1 | 161 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d2igva1 | 172 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d1qnga_ | 170 | Cyclophilin (eukaryotic) {Plasmodium falciparum [T | 100.0 | |
| d2cfea1 | 162 | Cyclophilin-like allergen Mal s 6 {Malassezia symp | 100.0 | |
| d1a33a_ | 174 | Cyclophilin (eukaryotic) {Nematode (Brugia malayi) | 100.0 | |
| d1qoia_ | 173 | Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 | 100.0 | |
| d1ihga2 | 195 | Cyclophilin 40 isomerase domain {Cow (Bos taurus) | 100.0 | |
| d1z81a1 | 186 | Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId | 100.0 | |
| d2c3ba1 | 171 | Cyclophilin (eukaryotic) {Aspergillus fumigatus [T | 100.0 | |
| d2ok3a1 | 159 | Cyclophilin-like protein PPIL3B {Human (Homo sapie | 100.0 | |
| d2fu0a1 | 155 | Putative cyclophilin PFE0505w {Plasmodium falcipar | 100.0 | |
| d1xwna1 | 166 | Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 | 100.0 | |
| d1zkca1 | 178 | Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop | 100.0 | |
| d2b71a1 | 169 | Cyclophilin-like protein PY00693 {Plasmodium yoeli | 100.0 | |
| d1v9ta_ | 166 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d2a2na1 | 164 | Peptidylprolyl isomerase domain and WD repeat-cont | 100.0 | |
| d1w74a_ | 171 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob | 100.0 | |
| d1lopa_ | 164 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 |
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Cyclophilin (eukaryotic) species: Mouse (Mus musculus), variant C [TaxId: 10090]
Probab=100.00 E-value=4.5e-48 Score=326.49 Aligned_cols=169 Identities=66% Similarity=1.100 Sum_probs=160.6
Q ss_pred cccccceEEEEEEECCeeceeEEEEecCCCChhHHHHHHHHhccCCCcccCCCEEEEeecCceeeeCCCcCCCCCCCccc
Q 025245 85 QAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISI 164 (255)
Q Consensus 85 ~~~~~~~v~~di~i~~t~~G~ivIeL~~~~aP~t~~nF~~L~~g~~g~~Y~g~~f~Rii~~f~iqgGd~~~~~g~g~~~~ 164 (255)
.|++|.+|||||+++++++|+|+||||.+.||++|+||++||+++++.+|+|+.|||+++++++|+|++...++.++...
T Consensus 3 ~p~~t~~vy~di~i~~~~~G~ivieL~~d~aP~tv~nF~~l~~~~k~~~Y~g~~f~rv~~~~~iq~G~~~~~~~~~~~~~ 82 (182)
T d2rmca_ 3 GPSVTDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSI 82 (182)
T ss_dssp SCEEEEEEEEEEEETTEEEEEEEEEECTTTSHHHHHHHHHHHHTTTSCSSTTCBEEEEETTTEEEECCCSSSSSSCCCBT
T ss_pred CCccCCeEEEEEEECCEECcEEEEEEcCCCCcHHHHHHHHhhhcCCCccccCceeeeeecCceEEcCCCCCCCCCCCCCC
Confidence 37789999999999999999999999999999999999999987666569999999999999999999988888888888
Q ss_pred cCCCCCCCcccccccCCeEEEEeecCCCCCCceeEEEcCCCCCCCCCCeEEEEEEcCHHHHHHhhcCCCCCCCCCCCCeE
Q 025245 165 YGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCR 244 (255)
Q Consensus 165 ~g~~~~~e~~~l~h~~~G~lsma~~g~~s~gSqFfItl~~~~~Ld~~~~VFG~VieGmdvl~~I~~~~~~~~~~P~~~V~ 244 (255)
++..++++.....|..+|+|+|++.++++++|||||++++.++||++|+|||+|++|||||++|++++++++++|.++|+
T Consensus 83 ~~~~~~~~~~~~~~~~~G~lsma~~~~~s~~sqFfI~~~~~~~ld~~~~vFG~Vi~G~dvl~~I~~~~~~~~~~P~~~v~ 162 (182)
T d2rmca_ 83 YGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCT 162 (182)
T ss_dssp TBSCBCCCCCCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCTTSCBSSCEE
T ss_pred cCCcccccccccccCCCccEehhhcCCCccCccccccccCCchhcccceEEEEEechHHHHHHHHhCCcCCCCcCCCCeE
Confidence 99999999988889899999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEeeEEecC
Q 025245 245 IINSGELPL 253 (255)
Q Consensus 245 I~~cGvL~~ 253 (255)
|.+||+|+.
T Consensus 163 I~~~g~l~~ 171 (182)
T d2rmca_ 163 IVNSGKIDV 171 (182)
T ss_dssp EEEEEEEEE
T ss_pred EEEeeEEeC
Confidence 999999964
|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|