Citrus Sinensis ID: 025287


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MGEKKVTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGSIKSIAILEPEKPKPPPPKPKEPEKPKAPEKPKEPEKPKQPEKPKEPEKPKQPEKPKEPEKPKEPEKPKEPEKPKEPAKPKEPEKPKEPPKPSPPPPAPAPAPAPAPAPAPVPCHPPVGVCCRECYEGRGGGPCYDLGYGQTRHYDGYCGRPVYEGWAGGCDTRDYYRSRCSDYICEENPTAPCTIM
ccccEEEEEEEEEcccHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEEEEEEccccHHHHHHHHHHHHccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccEccccccccccccccccccHcEcccccccccEcc
MGEKKVTTMVLKVDLQCSKCYKKVKKVlckfpqiqdqifdektntvrikvvccspekirdklcckgegsiksiailepekpkppppkpkepekpkapekpkepekpkqpekpkepekpkqpekpkepekpkepekpkepekpkepakpkepekpkeppkpsppppapapapapapapapvpchppvgvccrecyegrgggpcydlgygqtrhydgycgrpvyegwaggcdtrdyyrsrcsdyiceenptapctim
mgekkvttmvlkvdlqcsKCYKKVKKVLCKfpqiqdqifdektntvrikvvccspekirdklcckGEGSIksiailepekpkppppkpkepekpkapekpkepekpkqpekpkepekpkqpekpkepekpkepekpkepekpkepakpkepekpkepPKPSPPPPAPAPAPAPAPAPAPVPCHPPVGVCCRECYEGRGGGPCYDLGYGQTRHYDGYCGRPVYEGWAGGCDTRDYYRSRCsdyiceenptapctim
MGEKKVTTMVLKVDLQCSkcykkvkkvlckFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGSIKSIAILepekpkppppkpkepekpkapekpkepekpkqpekpkepekpkqpekpkepekpkepekpkepekpkepakpkepekpkeppkpsppppapapapapapapapVPCHPPVGVccrecyegrgggpcyDLGYGQTRHYDGYCGRPVYEGWAGGCDTRDYYRSRCSDYICEENPTAPCTIM
******TTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGSIKSIAI************************************************************************************************************PPVGVCCRECYEGRGGGPCYDLGYGQTRHYDGYCGRPVYEGWAGGCDTRDYYRSRCSDYICE**********
******T*MVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKI********************************************************************************************************************************************************RHYDGYCGRPVYEGWAGGCDTRDYYRSRCSDYICEENPTAPCTIM
********MVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGSIKSIAILEPEK************************************************************************************************PAPVPCHPPVGVCCRECYEGRGGGPCYDLGYGQTRHYDGYCGRPVYEGWAGGCDTRDYYRSRCSDYICEENPTAPCTIM
**EKKVTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPE***************************************************************************************************************************VPCHPPVGVCCRECYEGRGGGPCYDLGYGQTRHYDGYCGRPVYEGWAGGCDTRDYYRSRCSDYICEENPTAPCTI*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEKKVTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGSIKSIAILEPEKPKPPPPKPKEPEKPKAPEKPKEPEKPKQPEKPKEPEKPKQPEKPKEPEKPKEPEKPKEPEKPKEPAKPKEPEKPKEPPKPSPPPPAPAPAPAPAPAPAPVPCHPPVGVCCRECYEGRGGGPCYDLGYGQTRHYDGYCGRPVYEGWAGGCDTRDYYRSRCSDYICEENPTAPCTIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query255 2.2.26 [Sep-21-2011]
P16053858 Neurofilament medium poly yes no 0.317 0.094 0.609 2e-13
Q01443 827 Sporozoite surface protei N/A no 0.298 0.091 0.467 3e-12
Q8CQD91469 Accumulation-associated p yes no 0.345 0.059 0.561 1e-11
P21979 1528 Cell surface antigen I/II N/A no 0.447 0.074 0.376 1e-10
P27951 1164 IgA FC receptor OS=Strept yes no 0.345 0.075 0.511 2e-09
Q4U9M9 893 104 kDa microneme/rhoptry yes no 0.313 0.089 0.439 3e-08
Q9LBG3 1653 Probable cell-surface ant N/A no 0.411 0.063 0.356 8e-06
P06914367 Circumsporozoite protein N/A no 0.270 0.188 0.357 0.0005
>sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 Back     alignment and function desciption
 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/82 (60%), Positives = 55/82 (67%), Gaps = 1/82 (1%)

Query: 78  PEKPKPPPPKPKEPEKPKAPEKPKEPEKPKQPEKPKEPEKPKQPEKPKEPEKPKEPEKPK 137
           PEKP P P K   PEK ++PEKP  PEK   PEKP  PEKP+ PEKP  PEKP  PEKP+
Sbjct: 641 PEKP-PTPEKAITPEKVRSPEKPTTPEKVVSPEKPASPEKPRTPEKPASPEKPATPEKPR 699

Query: 138 EPEKPKEPAKPKEPEKPKEPPK 159
            PEKP  P KP+ PEKP  P K
Sbjct: 700 TPEKPATPEKPRSPEKPSSPLK 721




Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
Gallus gallus (taxid: 9031)
>sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 OS=Plasmodium yoelii yoelii GN=SSP2 PE=1 SV=2 Back     alignment and function description
>sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=4 SV=1 Back     alignment and function description
>sp|P21979|SPAA_STRDO Cell surface antigen I/II OS=Streptococcus downei GN=spaA PE=3 SV=2 Back     alignment and function description
>sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 Back     alignment and function description
>sp|Q4U9M9|104K_THEAN 104 kDa microneme/rhoptry antigen OS=Theileria annulata GN=TA08425 PE=3 SV=1 Back     alignment and function description
>sp|Q9LBG3|PAA_STRCG Probable cell-surface antigen I/II OS=Streptococcus criceti GN=paaA PE=3 SV=1 Back     alignment and function description
>sp|P06914|CSP_PLAYO Circumsporozoite protein OS=Plasmodium yoelii yoelii PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query255
240255932254 metal ion binding protein [Arabidopsis t 0.941 0.944 0.496 9e-36
194466241232 putative metal ion-binding protein [Arac 0.854 0.939 0.493 3e-31
359496103233 PREDICTED: uncharacterized protein LOC10 0.870 0.952 0.457 9e-28
359496105233 PREDICTED: uncharacterized protein LOC10 0.870 0.952 0.457 2e-27
118486749207 unknown [Populus trichocarpa] 0.788 0.971 0.406 4e-27
315659650 2202 serine-aspartate repeat-containing prote 0.423 0.049 0.522 6e-26
418636420 2190 putative serine-aspartate repeat protein 0.423 0.049 0.522 2e-25
297804556244 hypothetical protein ARALYDRAFT_493247 [ 0.298 0.311 0.776 8e-25
388494848261 unknown [Medicago truncatula] 0.298 0.291 0.772 9e-25
357480619261 Proline-rich protein [Medicago truncatul 0.298 0.291 0.772 9e-25
>gi|240255932|ref|NP_974559.5| metal ion binding protein [Arabidopsis thaliana] gi|332658339|gb|AEE83739.1| metal ion binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  156 bits (394), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 154/264 (58%), Gaps = 24/264 (9%)

Query: 2   GEKKVTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDK 61
           G++KVT M LKVDL C+KCYKKVKKVLCKFPQI+DQ+FDEK+N V IKVVCCSPE+I DK
Sbjct: 5   GKEKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPERIMDK 64

Query: 62  LCCKGEGSIKSIAILEPEKPKPPPPKPKEPEKPKAPEKPKEPEKPKQPEKP----KEPEK 117
           LC KG GSIK+I I+EP KP  P P+    +   A  K  E  K  +  K     KEPEK
Sbjct: 65  LCSKGGGSIKTIEIVEPPKPPQPQPQQPPQKPKDAQPKAPEKPKEPEKPKQPEKLKEPEK 124

Query: 118 PKQPEKPKEPEKPKEPEKPKEPEKPKEPAKPKEPEKPKEPPKPSPPPPAPAPAPAPAPAP 177
           PKQPEKPKEPEK K+P     P           P     P    P PP  A    P   P
Sbjct: 125 PKQPEKPKEPEKTKQPAPAPAPAPAPAAKPAPAPAPAPAPAPKQPGPPPQAIPMMPQGQP 184

Query: 178 APVPCHPPVGVCCRECYEGRGGGPCYDLGYGQ-TRHYDGYCGRPVYEGWAGGCDT----- 231
           A         +CC   Y+G  GGP ++ GYG   + Y+ Y GRPVYE W GGC       
Sbjct: 185 A---------MCCGPYYDGY-GGPAFN-GYGMPPQPYECY-GRPVYESWGGGCPPPPPAY 232

Query: 232 RDYYRSRCSDYICEENPTAPCTIM 255
           R  + +RC DY  EENP + C+IM
Sbjct: 233 RQCHVTRC-DYFSEENPQS-CSIM 254




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|194466241|gb|ACF74351.1| putative metal ion-binding protein [Arachis hypogaea] Back     alignment and taxonomy information
>gi|359496103|ref|XP_002269930.2| PREDICTED: uncharacterized protein LOC100250652 [Vitis vinifera] gi|297735871|emb|CBI18630.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496105|ref|XP_003635154.1| PREDICTED: uncharacterized protein LOC100853846 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118486749|gb|ABK95210.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|315659650|ref|ZP_07912511.1| serine-aspartate repeat-containing protein F [Staphylococcus lugdunensis M23590] gi|315495383|gb|EFU83717.1| serine-aspartate repeat-containing protein F [Staphylococcus lugdunensis M23590] Back     alignment and taxonomy information
>gi|418636420|ref|ZP_13198771.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis VCU139] gi|374840992|gb|EHS04472.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis VCU139] Back     alignment and taxonomy information
>gi|297804556|ref|XP_002870162.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. lyrata] gi|297315998|gb|EFH46421.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388494848|gb|AFK35490.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357480619|ref|XP_003610595.1| Proline-rich protein [Medicago truncatula] gi|355511650|gb|AES92792.1| Proline-rich protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query255
TAIR|locus:1006589875254 AT4G16380 [Arabidopsis thalian 0.294 0.295 0.6 7.6e-29
TAIR|locus:2026042171 AT1G51090 [Arabidopsis thalian 0.286 0.426 0.561 1.1e-22
TAIR|locus:2010192189 AT1G49420 [Arabidopsis thalian 0.282 0.380 0.520 2.4e-19
TAIR|locus:1006589875 AT4G16380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 7.6e-29, Sum P(2) = 7.6e-29
 Identities = 45/75 (60%), Positives = 54/75 (72%)

Query:     2 GEKKVTTMVLKVDLQCSXXXXXXXXXXXXFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDK 61
             G++KVT M LKVDL C+            FPQI+DQ+FDEK+N V IKVVCCSPE+I DK
Sbjct:     5 GKEKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPERIMDK 64

Query:    62 LCCKGEGSIKSIAIL 76
             LC KG GSIK+I I+
Sbjct:    65 LCSKGGGSIKTIEIV 79


GO:0005634 "nucleus" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2026042 AT1G51090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010192 AT1G49420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query255
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 5e-15
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 2e-14
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 3e-13
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 1e-11
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 3e-11
pfam10310 436 pfam10310, DUF2413, Protein of unknown function (D 4e-11
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-11
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 5e-11
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 1e-10
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-10
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-10
pfam10310 436 pfam10310, DUF2413, Protein of unknown function (D 5e-10
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 1e-09
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 2e-09
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-09
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 3e-09
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 9e-09
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-08
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 2e-08
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 2e-08
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 2e-08
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-08
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 5e-08
COG3087264 COG3087, FtsN, Cell division protein [Cell divisio 6e-08
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 7e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-08
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 9e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 9e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-08
TIGR03490 541 TIGR03490, Mycoplas_LppA, mycoides cluster lipopro 1e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-07
pfam04652315 pfam04652, DUF605, Vta1 like 2e-07
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 2e-07
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 3e-07
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-07
PRK09752 1250 PRK09752, PRK09752, adhesin; Provisional 3e-07
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 3e-07
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-07
COG5373 931 COG5373, COG5373, Predicted membrane protein [Func 4e-07
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 5e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-07
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 6e-07
pfam02993238 pfam02993, MCPVI, Minor capsid protein VI 6e-07
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 7e-07
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 9e-07
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 9e-07
pfam03286198 pfam03286, Pox_Ag35, Pox virus Ag35 surface protei 9e-07
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 1e-06
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 1e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-06
TIGR03490 541 TIGR03490, Mycoplas_LppA, mycoides cluster lipopro 1e-06
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 1e-06
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-06
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 2e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 2e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-06
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 2e-06
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 2e-06
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-06
PRK12372413 PRK12372, PRK12372, ribonuclease III; Reviewed 2e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-06
COG3087264 COG3087, FtsN, Cell division protein [Cell divisio 3e-06
TIGR021021111 TIGR02102, pullulan_Gpos, pullulanase, extracellul 3e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-06
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 4e-06
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 4e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-06
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 7e-06
pfam10310 436 pfam10310, DUF2413, Protein of unknown function (D 8e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-05
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 1e-05
pfam10310 436 pfam10310, DUF2413, Protein of unknown function (D 2e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-05
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 2e-05
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-05
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-05
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-05
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-05
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-05
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-05
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-05
pfam13254414 pfam13254, DUF4045, Domain of unknown function (DU 4e-05
pfam13254414 pfam13254, DUF4045, Domain of unknown function (DU 4e-05
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 4e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 4e-05
pfam04652315 pfam04652, DUF605, Vta1 like 5e-05
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 5e-05
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 5e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 5e-05
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 5e-05
PRK10905328 PRK10905, PRK10905, cell division protein DamX; Va 5e-05
TIGR02442 633 TIGR02442, Cob-chelat-sub, cobaltochelatase subuni 5e-05
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 5e-05
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 6e-05
PRK09752 1250 PRK09752, PRK09752, adhesin; Provisional 6e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 6e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 6e-05
TIGR02442 633 TIGR02442, Cob-chelat-sub, cobaltochelatase subuni 6e-05
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 7e-05
PRK09752 1250 PRK09752, PRK09752, adhesin; Provisional 7e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 8e-05
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 8e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 9e-05
pfam04652315 pfam04652, DUF605, Vta1 like 9e-05
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 9e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 9e-05
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 9e-05
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 9e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 1e-04
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 1e-04
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 1e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 1e-04
COG49321531 COG4932, COG4932, Predicted outer membrane protein 1e-04
COG3115324 COG3115, ZipA, Cell division protein [Cell divisio 1e-04
PTZ00441576 PTZ00441, PTZ00441, sporozoite surface protein 2 ( 1e-04
PRK05703 424 PRK05703, flhF, flagellar biosynthesis regulator F 1e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
COG5373 931 COG5373, COG5373, Predicted membrane protein [Func 2e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-04
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-04
TIGR01347 403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 2e-04
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 2e-04
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 3e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-04
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 3e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 3e-04
COG49321531 COG4932, COG4932, Predicted outer membrane protein 3e-04
COG3115324 COG3115, ZipA, Cell division protein [Cell divisio 3e-04
PRK00708209 PRK00708, PRK00708, sec-independent translocase; P 3e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 4e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 4e-04
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 4e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 4e-04
COG2948 360 COG2948, VirB10, Type IV secretory pathway, VirB10 4e-04
pfam11711377 pfam11711, Tim54, Inner membrane protein import co 4e-04
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 5e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 5e-04
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 5e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-04
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 6e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 6e-04
COG3115324 COG3115, ZipA, Cell division protein [Cell divisio 6e-04
TIGR01347 403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 6e-04
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 6e-04
pfam13254414 pfam13254, DUF4045, Domain of unknown function (DU 7e-04
TIGR02442 633 TIGR02442, Cob-chelat-sub, cobaltochelatase subuni 7e-04
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 7e-04
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 7e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-04
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 8e-04
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 8e-04
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 9e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 0.001
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
PRK09752 1250 PRK09752, PRK09752, adhesin; Provisional 0.001
TIGR021021111 TIGR02102, pullulan_Gpos, pullulanase, extracellul 0.001
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.001
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.001
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.001
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.001
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.001
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.001
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.001
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.001
COG49321531 COG4932, COG4932, Predicted outer membrane protein 0.001
COG49321531 COG4932, COG4932, Predicted outer membrane protein 0.001
PRK05996423 PRK05996, motB, flagellar motor protein MotB; Vali 0.001
PRK05996423 PRK05996, motB, flagellar motor protein MotB; Vali 0.001
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.001
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 0.001
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.001
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 0.001
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.002
COG3087264 COG3087, FtsN, Cell division protein [Cell divisio 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 0.002
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 0.002
pfam11711377 pfam11711, Tim54, Inner membrane protein import co 0.002
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.002
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.002
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.002
PRK10547 670 PRK10547, PRK10547, chemotaxis protein CheA; Provi 0.002
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 0.002
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 0.002
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 0.002
pfam06217301 pfam06217, GAGA_bind, GAGA binding protein-like fa 0.002
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.003
PRK10905328 PRK10905, PRK10905, cell division protein DamX; Va 0.003
PRK05996423 PRK05996, motB, flagellar motor protein MotB; Vali 0.003
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.003
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.003
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.003
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 0.003
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 0.003
PRK06347 592 PRK06347, PRK06347, autolysin; Reviewed 0.003
pfam03213 325 pfam03213, Pox_P35, Poxvirus P35 protein 0.003
pfam05110 1154 pfam05110, AF-4, AF-4 proto-oncoprotein 0.003
pfam05053618 pfam05053, Menin, Menin 0.003
pfam1013898 pfam10138, Tellurium_res, Tellurium resistance pro 0.003
PRK08119382 PRK08119, PRK08119, flagellar motor switch protein 0.003
PLN02226 463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 0.003
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.004
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 0.004
COG5373 931 COG5373, COG5373, Predicted membrane protein [Func 0.004
TIGR021021111 TIGR02102, pullulan_Gpos, pullulanase, extracellul 0.004
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.004
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.004
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.004
COG2948 360 COG2948, VirB10, Type IV secretory pathway, VirB10 0.004
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.004
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.004
PRK14952584 PRK14952, PRK14952, DNA polymerase III subunits ga 0.004
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 0.004
pfam06375 561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 0.004
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
 Score = 74.0 bits (181), Expect = 5e-15
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 80  KPKPPPPKPKEPEKPKAPEKPKEPEKPKQPEKPKEPEKPKQPEKPKEPEKPKEPEKPKEP 139
           KP   P   K+PE PK P+ PK+PE+PK+P++P+  ++P +P+ PK PE    P+ PK P
Sbjct: 568 KPSKIPTLSKKPEFPKDPKHPKDPEEPKKPKRPRSAQRPTRPKSPKLPELLDIPKSPKRP 627

Query: 140 EKPKEPAKPKEPEKPKEPPKPSPPPPAPAPAPAPAPAP 177
           E PK P +P  P++P  P +P  P    +P P  +P P
Sbjct: 628 ESPKSPKRPPPPQRPSSPERPEGPKIIKSPKPPKSPKP 665


Length = 943

>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|234229 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72 family Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|217476 pfam03286, Pox_Ag35, Pox virus Ag35 surface protein Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|234229 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72 family Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233728 TIGR02102, pullulan_Gpos, pullulanase, extracellular, Gram-positive Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|222010 pfam13254, DUF4045, Domain of unknown function (DUF4045) Back     alignment and domain information
>gnl|CDD|222010 pfam13254, DUF4045, Domain of unknown function (DUF4045) Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236792 PRK10905, PRK10905, cell division protein DamX; Validated Back     alignment and domain information
>gnl|CDD|233870 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|233870 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227268 COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|240420 PTZ00441, PTZ00441, sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227268 COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|225499 COG2948, VirB10, Type IV secretory pathway, VirB10 components [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|221179 pfam11711, Tim54, Inner membrane protein import complex subunit Tim54 Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|222010 pfam13254, DUF4045, Domain of unknown function (DUF4045) Back     alignment and domain information
>gnl|CDD|233870 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional Back     alignment and domain information
>gnl|CDD|233728 TIGR02102, pullulan_Gpos, pullulanase, extracellular, Gram-positive Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227268 COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|227268 COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235665 PRK05996, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|235665 PRK05996, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|221179 pfam11711, Tim54, Inner membrane protein import complex subunit Tim54 Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236712 PRK10547, PRK10547, chemotaxis protein CheA; Provisional Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|218941 pfam06217, GAGA_bind, GAGA binding protein-like family Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236792 PRK10905, PRK10905, cell division protein DamX; Validated Back     alignment and domain information
>gnl|CDD|235665 PRK05996, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed Back     alignment and domain information
>gnl|CDD|217428 pfam03213, Pox_P35, Poxvirus P35 protein Back     alignment and domain information
>gnl|CDD|218440 pfam05110, AF-4, AF-4 proto-oncoprotein Back     alignment and domain information
>gnl|CDD|191179 pfam05053, Menin, Menin Back     alignment and domain information
>gnl|CDD|220596 pfam10138, Tellurium_res, Tellurium resistance protein Back     alignment and domain information
>gnl|CDD|236154 PRK08119, PRK08119, flagellar motor switch protein; Validated Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233728 TIGR02102, pullulan_Gpos, pullulanase, extracellular, Gram-positive Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|225499 COG2948, VirB10, Type IV secretory pathway, VirB10 components [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 255
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.53
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.48
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.38
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.81
PRK10671 834 copA copper exporting ATPase; Provisional 98.19
PLN02957238 copper, zinc superoxide dismutase 98.12
TIGR0000368 copper ion binding protein. This model describes a 97.93
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.3
PTZ00449 943 104 kDa microneme/rhoptry antigen; Provisional 96.92
PTZ00449 943 104 kDa microneme/rhoptry antigen; Provisional 96.74
PRK10671 834 copA copper exporting ATPase; Provisional 96.67
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 96.48
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.24
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 95.45
COG188897 Uncharacterized protein conserved in archaea [Func 93.18
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 92.91
TIGR0205292 MerP mercuric transport protein periplasmic compon 90.21
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 85.89
PF1373284 DUF4162: Domain of unknown function (DUF4162) 80.01
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=99.53  E-value=3.5e-14  Score=106.05  Aligned_cols=67  Identities=33%  Similarity=0.500  Sum_probs=62.1

Q ss_pred             ceEEEEEEeccChhhHHHHHHHHhcCCCceeEEEEcCCCeEEEEEeecCHHHHHHHHHHhcCCccceeEEe
Q 025287            6 VTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGSIKSIAIL   76 (255)
Q Consensus         6 vtt~vLKV~M~C~gCakKIkKAL~kI~GV~sV~VDlk~~kVTVeG~~vdpekLv~aL~kKggk~IK~IEIV   76 (255)
                      +++.+|+|+|||+||+.+|++.|+.+.||.++.+|.++++|||.|. ++++.|+++|++.+++   ++++|
T Consensus         4 ~~~~v~kv~~~C~gc~~kV~~~l~~~~GV~~v~id~~~~kvtV~g~-~~p~~vl~~l~k~~~k---~~~~~   70 (73)
T KOG1603|consen    4 IKTVVLKVNMHCEGCARKVKRVLQKLKGVESVDIDIKKQKVTVKGN-VDPVKLLKKLKKTGGK---RAELW   70 (73)
T ss_pred             ccEEEEEECcccccHHHHHHHHhhccCCeEEEEecCCCCEEEEEEe-cCHHHHHHHHHhcCCC---ceEEe
Confidence            5689999999999999999999999999999999999999999999 9999999999997756   56555



>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00449 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>PTZ00449 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>PF13732 DUF4162: Domain of unknown function (DUF4162) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query255
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-18
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 7e-18
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-14
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 6e-14
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-09
2o8l_A274 V8 protease, taphylococcal serine; serine protease 9e-11
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 4e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 6e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 1e-09
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-09
2o8l_A274 V8 protease, taphylococcal serine; serine protease 3e-09
2o8l_A274 V8 protease, taphylococcal serine; serine protease 3e-08
2o8l_A274 V8 protease, taphylococcal serine; serine protease 1e-05
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 4e-09
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 1e-07
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 4e-06
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 2e-05
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-08
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 4e-08
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 1e-07
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 3e-06
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 7e-04
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 3e-08
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 2e-07
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 2e-07
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 3e-07
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 7e-07
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 9e-07
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 9e-07
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 1e-06
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 3e-06
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 8e-07
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 9e-07
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 3e-06
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 9e-07
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 6e-06
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-05
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 1e-06
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 2e-06
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 3e-06
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 1e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 2e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 2e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 7e-05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 9e-05
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 3e-06
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 1e-05
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 1e-05
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 3e-04
2wd6_A349 Agglutinin receptor; cell adhesion, secreted, V-re 4e-05
2wd6_A349 Agglutinin receptor; cell adhesion, secreted, V-re 2e-04
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 7e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 8e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 8e-05
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 8e-05
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 8e-05
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 1e-04
1eys_C382 Photosynthetic reaction center; membrane protein c 1e-04
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 2e-04
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 3e-04
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 3e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 5e-04
3ecq_A 1531 Protein SPR0328, endo-alpha-N-acetylgalactosaminid 8e-04
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
 Score = 83.1 bits (204), Expect = 3e-18
 Identities = 21/124 (16%), Positives = 28/124 (22%), Gaps = 5/124 (4%)

Query: 77  EPEKPKPPPPKPKEPEKPKAPEKPKEPEKPKQPEKPKEPEKPK----QPEKPKEPEKP-K 131
            PE             +    E  K+ E     E   E  +      +   P   E    
Sbjct: 26  VPENSGANTELVSGESEHSTNEADKQNEGEHARENKLEKAEGVATASETASPASNEAATT 85

Query: 132 EPEKPKEPEKPKEPAKPKEPEKPKEPPKPSPPPPAPAPAPAPAPAPAPVPCHPPVGVCCR 191
           E  +     KP+E A     E P    KP       A   A        P          
Sbjct: 86  ETAEAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAAEANKTEKE 145

Query: 192 ECYE 195
              +
Sbjct: 146 VQPD 149


>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 Back     alignment and structure
>2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1eys_C Photosynthetic reaction center; membrane protein complex, electron transport; HET: BGL BCL BPH MQ8 HEM CRT LDA PEF; 2.20A {Thermochromatium tepidum} SCOP: a.138.1.2 Length = 382 Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Length = 355 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3ecq_A Protein SPR0328, endo-alpha-N-acetylgalactosaminidase; distorted (beta/alpha)8 (TIM) barrel glycoside hydrolase DOM WALL; 2.90A {Streptococcus pneumoniae} Length = 1531 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query255
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.52
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.46
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.37
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.36
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.29
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.28
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.26
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.25
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.22
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.21
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.2
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.19
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.19
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.19
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.17
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.16
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.14
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.14
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.13
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.11
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.1
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.1
2kyz_A67 Heavy metal binding protein; structural genomics, 99.1
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 99.09
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.09
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.08
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.07
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.04
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 99.01
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 99.0
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.96
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.96
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.92
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.87
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.87
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.85
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.78
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.76
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.63
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.54
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.23
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 95.86
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 94.46
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 92.06
2jsx_A95 Protein NAPD; TAT, proofreading, cytoplasm, chaper 84.65
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.52  E-value=4.2e-14  Score=99.43  Aligned_cols=67  Identities=22%  Similarity=0.317  Sum_probs=60.1

Q ss_pred             ceEEEEEEeccChhhHHHHHHHHhcCCCceeEEEEcCCCeEEEEEeecCHHHHHHHHHHhcCCccceeEEeCC
Q 025287            6 VTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGSIKSIAILEP   78 (255)
Q Consensus         6 vtt~vLKV~M~C~gCakKIkKAL~kI~GV~sV~VDlk~~kVTVeG~~vdpekLv~aL~kKggk~IK~IEIVsp   78 (255)
                      |++++|+|+|+|.+|+++|+++|.+++|| ++++|+.+++++|++. ++.+.|+++|++.|++    ++++++
T Consensus         1 m~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~-~~~~~i~~~i~~~Gy~----~~~~~~   67 (68)
T 3iwl_A            1 MPKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESE-HSMDTLLATLKKTGKT----VSYLGL   67 (68)
T ss_dssp             -CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEES-SCHHHHHHHHHTTCSC----EEEEEC
T ss_pred             CceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEec-CCHHHHHHHHHHcCCc----eEecCC
Confidence            45788999999999999999999999999 9999999999999997 8999999999988775    666653



>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>2jsx_A Protein NAPD; TAT, proofreading, cytoplasm, chaperone; NMR {Escherichia coli K12} PDB: 2pq4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 255
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 1e-04
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 5e-04
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 0.001
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 0.001
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 37.1 bits (86), Expect = 1e-04
 Identities = 11/56 (19%), Positives = 20/56 (35%), Gaps = 1/56 (1%)

Query: 7  TTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRDKL 62
                + + C  C   +K  L   P I    FD +   + ++    +P  I + L
Sbjct: 6  YEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESS-VAPSTIINTL 60


>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query255
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.66
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.61
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.59
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.51
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.5
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.45
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.44
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.42
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.41
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.41
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.4
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.4
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.39
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.29
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 92.85
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 92.82
d1urra_97 Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila 84.03
d1uwda_102 Hypothetical protein TM0487 {Thermotoga maritima [ 80.5
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.66  E-value=1.4e-16  Score=116.37  Aligned_cols=63  Identities=21%  Similarity=0.296  Sum_probs=59.3

Q ss_pred             ceEEEEEEeccChhhHHHHHHHHhcCC-CceeEEEEcCCCeEEEEEeecCHHHHHHHHHHhcCCc
Q 025287            6 VTTMVLKVDLQCSKCYKKVKKVLCKFP-QIQDQIFDEKTNTVRIKVVCCSPEKIRDKLCCKGEGS   69 (255)
Q Consensus         6 vtt~vLKV~M~C~gCakKIkKAL~kI~-GV~sV~VDlk~~kVTVeG~~vdpekLv~aL~kKggk~   69 (255)
                      |+++.|+|+|||.+|+++|+++|.+|+ ||.+|++|+.+++|+|+|+ +++++|+++|++.|+++
T Consensus         3 ~kt~~f~V~MtC~~C~~~Ie~~L~~l~~gV~~v~v~~~~~~v~V~~~-~~~~~i~~~i~~~G~~~   66 (72)
T d1cc8a_           3 IKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTT-LPYDFILEKIKKTGKEV   66 (72)
T ss_dssp             CEEEEEEECCCSHHHHHHHHHHHHTTTTSEEEEEEETTTTEEEEEES-SCHHHHHHHHHTTSSCE
T ss_pred             cEEEEEEECcCcHHHHHHHHHHHHcCcCceEEEEEECCCCEEEEeec-CCHHHHHHHHHHHCCcc
Confidence            789999999999999999999999995 9999999999999999999 99999999999876653



>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure