Citrus Sinensis ID: 025477


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MCALFPPFFPSLGWPLEINPICHQQDYITETIEESPQFPQESEPQAEFDRSASFSANSGDPTMVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERLMQKKEELLSKISKPGEISHQQHQRKIAIGSSLASISASRLSDMEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYNEKREDLFPSNFGCKN
ccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEcccEEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccc
cEEEcccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccEccccEEEEEEEccccccccHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccc
mcalfppffpslgwpleinpichqqdyitetieespqfpqesepqaefdrsasfsansgdptMVKKLYHNASERDRRKKINSLYSSLRSLlpvadqtkklsipaTVSRVLKYIPELQQQVERLMQKKEELLSkiskpgeishqqHQRKIAIGSSLASISASRLSDMEILIQISsykvhkcplskiLFNLEEDGLVLVNASFfesfqgrvfYNLHLQVKSTYGLDCEVLNEKLKSFYnekredlfpsnfgckn
MCALFPPFFPSLGWPLEINPICHQQDYITETIEESPQFPQESEPQAEFDRSAsfsansgdptmVKKLYhnaserdrrKKINSLYSSLRSLlpvadqtkklsipatVSRVLKYIPELQQQVERLMQKKEELLSKIskpgeishqqhQRKIAIGSSLASISASRLSDMEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSfynekredlfpsnfgckn
MCALFPPFFPSLGWPLEINPICHQQDYITETIeespqfpqesepqaefDRSASFSANSGDPTMVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERLMQKKEELLSKISKPGEISHQQHQRKiaigsslasisasrlsDMEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYNEKREDLFPSNFGCKN
**ALFPPFFPSLGWPLEINPICHQQDYITET*********************************************************SLLPVADQTKKLSIPATVSRVLKYIPEL********************************************SRLSDMEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYN***************
***LFPPFFPS****************************************************************RRKKINSLYSSLRSLLP**********PATVSRVLKYIPE**************************************************MEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYNEKRED*F*SNF****
MCALFPPFFPSLGWPLEINPICHQQDYITETIE****************RSASFSANSGDPTMVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERLMQKKEELLSKISKPG**********IAIGSSLASISASRLSDMEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYNEKREDLFPSNFGCKN
MCALFPPFFPSLGWPLEINPICHQQDYITETIEESPQFPQESEPQAEFDRSAS****SGDPTMVKK*****SERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERLMQKKEELLSKISK*****************SLASISASRLSDMEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYNEKREDLFPSNFGCKN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCALFPPFFPSLGWPLEINPICHQQDYITETIEESPQFPQESEPQAEFDRSASFSANSGDPTMVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYxxxxxxxxxxxxxxxxxxxxxISKPGEISHQQHQRKIAIGSSLASISASRLSDMEILIQISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYNEKREDLFPSNFGCKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
Q9M1K1253 Transcription factor ORG2 yes no 0.952 0.948 0.464 2e-53
Q9M1K0258 Transcription factor ORG3 no no 0.932 0.910 0.466 7e-46
Q9ZVB5242 Transcription factor bHLH no no 0.904 0.942 0.438 2e-41
Q9FYE6240 Transcription factor bHLH no no 0.662 0.695 0.475 2e-34
Q9FLI0204 Transcription factor bHLH no no 0.662 0.818 0.25 8e-08
Q9STJ6221 Transcription factor bHLH no no 0.646 0.737 0.228 8e-07
Q9FLI1174 Transcription factor bHLH no no 0.269 0.390 0.367 3e-05
Q9STJ7163 Transcription factor bHLH no no 0.630 0.975 0.278 4e-05
Q9FIP9592 Transcription factor ATR2 no no 0.424 0.180 0.307 0.0003
P13526610 Anthocyanin regulatory Lc N/A no 0.559 0.231 0.280 0.0005
>sp|Q9M1K1|ORG2_ARATH Transcription factor ORG2 OS=Arabidopsis thaliana GN=ORG2 PE=1 SV=1 Back     alignment and function desciption
 Score =  209 bits (531), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 162/256 (63%), Gaps = 16/256 (6%)

Query: 1   MCALFPPFFPSLGWP--------LEINPICHQQDYITETIEESPQFPQESEPQAEFDRSA 52
           MCAL P FF + GWP               +   ++  T+   PQ  + +  Q     S 
Sbjct: 1   MCALVPSFFTNFGWPSTNQYESYYGAGDNLNNGTFLELTV---PQTYEVTHHQNSLGVSV 57

Query: 53  SFSANSGD--PTMVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVL 110
           S   N  D  P +VKKL HNASERDRRKKIN+L+SSLRS LP +DQ+KKLSIP TVS+ L
Sbjct: 58  SSEGNEIDNNPVVVKKLNHNASERDRRKKINTLFSSLRSCLPASDQSKKLSIPETVSKSL 117

Query: 111 KYIPELQQQVERLMQKKEELLSKISKPGEISHQQHQRKIAIGSSLASISASRLSDMEILI 170
           KYIPELQQQV+RL+QKKEE+L ++S   +      Q+  A+ S L+++SA+RL D E+++
Sbjct: 118 KYIPELQQQVKRLIQKKEEILVRVSGQRDFELYDKQQPKAVASYLSTVSATRLGDNEVMV 177

Query: 171 QISSYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKST--YGLDCEVL 228
           Q+SS K+H   +S +L  +EEDG VLV+ S   S   R+FY LHLQV++   Y ++CE L
Sbjct: 178 QVSSSKIHNFSISNVLGGIEEDGFVLVDVSSSRSQGERLFYTLHLQVENMDDYKINCEEL 237

Query: 229 NEKLKSFYNEKREDLF 244
           +E++   Y EK E+ F
Sbjct: 238 SERMLYLY-EKCENSF 252





Arabidopsis thaliana (taxid: 3702)
>sp|Q9M1K0|ORG3_ARATH Transcription factor ORG3 OS=Arabidopsis thaliana GN=ORG3 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVB5|BH100_ARATH Transcription factor bHLH100 OS=Arabidopsis thaliana GN=BHLH100 PE=2 SV=1 Back     alignment and function description
>sp|Q9FYE6|BH101_ARATH Transcription factor bHLH101 OS=Arabidopsis thaliana GN=BHLH101 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLI0|BH120_ARATH Transcription factor bHLH120 OS=Arabidopsis thaliana GN=BHLH120 PE=2 SV=2 Back     alignment and function description
>sp|Q9STJ6|BH126_ARATH Transcription factor bHLH126 OS=Arabidopsis thaliana GN=BHLH126 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLI1|BH036_ARATH Transcription factor bHLH36 OS=Arabidopsis thaliana GN=BHLH36 PE=2 SV=1 Back     alignment and function description
>sp|Q9STJ7|BH118_ARATH Transcription factor bHLH118 OS=Arabidopsis thaliana GN=BHLH118 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIP9|ATR2_ARATH Transcription factor ATR2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 Back     alignment and function description
>sp|P13526|ARLC_MAIZE Anthocyanin regulatory Lc protein OS=Zea mays GN=LC PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
297739932245 unnamed protein product [Vitis vinifera] 0.964 0.991 0.668 2e-80
147800349245 hypothetical protein VITISV_031510 [Viti 0.964 0.991 0.663 1e-79
359481913 367 PREDICTED: transcription factor ORG2 [Vi 0.928 0.637 0.670 2e-78
147855391244 hypothetical protein VITISV_027441 [Viti 0.888 0.918 0.651 9e-78
225465343244 PREDICTED: transcription factor ORG2 [Vi 0.888 0.918 0.651 4e-77
296085406225 unnamed protein product [Vitis vinifera] 0.857 0.96 0.662 1e-74
225470060244 PREDICTED: transcription factor ORG2-lik 0.884 0.913 0.657 6e-71
224139732264 predicted protein [Populus trichocarpa] 0.944 0.901 0.623 3e-60
356504732241 PREDICTED: transcription factor ORG2-lik 0.936 0.979 0.543 3e-58
388515305246 unknown [Medicago truncatula] 0.948 0.971 0.520 2e-55
>gi|297739932|emb|CBI30114.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 165/247 (66%), Positives = 199/247 (80%), Gaps = 4/247 (1%)

Query: 1   MCALFPPFFPSLGWPLEINPICHQQDYITETIEESPQFPQ--ESEPQAEFDRSASFSANS 58
           M A  PP F + GWP E +PI H+Q+YI +  E S  F     SEPQAE + S   +A S
Sbjct: 1   MLAFSPPLFSTFGWPWE-DPISHEQNYIYQETEASESFLHLPSSEPQAELNYSTPSAAVS 59

Query: 59  GDPTMVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQ 118
           G+PTMVKKL HNASERDRRKKINSLYSSLRSLLP ADQ KKLSIP+TVSRVLKYIPELQ+
Sbjct: 60  GNPTMVKKLNHNASERDRRKKINSLYSSLRSLLPAADQAKKLSIPSTVSRVLKYIPELQK 119

Query: 119 QVERLMQKKEELLSKISKPGEISHQQHQRKIAIGSSLASISASRLSDMEILIQISSYKVH 178
           QVERL+QKKEELLSKIS+ G+I HQ+ QRK  + SSL+++SA+RLSD EI++QIS++KVH
Sbjct: 120 QVERLIQKKEELLSKISRQGDIIHQEKQRKATLASSLSAVSANRLSDREIVVQISTFKVH 179

Query: 179 KCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKSTYGLDCEVLNEKLKSFYNE 238
           + PLS++L NLEEDGL+++NAS FESF GRVFYNLHLQV+ T+ ++CEVL+EKL S   E
Sbjct: 180 ESPLSEVLLNLEEDGLLVINASSFESFGGRVFYNLHLQVEGTHRMECEVLSEKLLSLC-E 238

Query: 239 KREDLFP 245
           KR D FP
Sbjct: 239 KRRDAFP 245




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147800349|emb|CAN64266.1| hypothetical protein VITISV_031510 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481913|ref|XP_002267194.2| PREDICTED: transcription factor ORG2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147855391|emb|CAN79614.1| hypothetical protein VITISV_027441 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225465343|ref|XP_002271872.1| PREDICTED: transcription factor ORG2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085406|emb|CBI29138.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470060|ref|XP_002267985.1| PREDICTED: transcription factor ORG2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224139732|ref|XP_002323250.1| predicted protein [Populus trichocarpa] gi|222867880|gb|EEF05011.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356504732|ref|XP_003521149.1| PREDICTED: transcription factor ORG2-like [Glycine max] Back     alignment and taxonomy information
>gi|388515305|gb|AFK45714.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
TAIR|locus:2080600253 bHLH38 "basic helix-loop-helix 0.964 0.960 0.426 1.9e-44
TAIR|locus:2080615258 bHLH39 "basic helix-loop-helix 0.944 0.922 0.420 1.9e-42
TAIR|locus:2040287242 BHLH100 "basic helix-loop-heli 0.928 0.966 0.395 3.6e-41
TAIR|locus:2146663240 BHLH101 "AT5G04150" [Arabidops 0.841 0.883 0.378 1.6e-31
UNIPROTKB|Q941Z7248 P0431G06.13-1 "BHLH transcript 0.730 0.741 0.433 6.9e-31
TAIR|locus:2165311174 AT5G51780 "AT5G51780" [Arabido 0.658 0.954 0.283 1.6e-08
TAIR|locus:2138019163 AT4G25400 "AT4G25400" [Arabido 0.630 0.975 0.260 1.1e-07
TAIR|locus:2133089190 AT4G20970 "AT4G20970" [Arabido 0.694 0.921 0.259 2.1e-07
TAIR|locus:2026291234 AT1G71200 "AT1G71200" [Arabido 0.555 0.598 0.278 2.8e-07
UNIPROTKB|G3MZY5105 TAL2 "Uncharacterized protein" 0.289 0.695 0.316 7.9e-05
TAIR|locus:2080600 bHLH38 "basic helix-loop-helix 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 468 (169.8 bits), Expect = 1.9e-44, P = 1.9e-44
 Identities = 108/253 (42%), Positives = 144/253 (56%)

Query:     1 MCALFPPFFPSLGWPL--EINPICHQQDYITE-TIXXXXXXXXXXXXXXXXDRSASFSAN 57
             MCAL P FF + GWP   +        D +   T                     S S+ 
Sbjct:     1 MCALVPSFFTNFGWPSTNQYESYYGAGDNLNNGTFLELTVPQTYEVTHHQNSLGVSVSSE 60

Query:    58 SGD----PTMVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYI 113
               +    P +VKKL HNASERDRRKKIN+L+SSLRS LP +DQ+KKLSIP TVS+ LKYI
Sbjct:    61 GNEIDNNPVVVKKLNHNASERDRRKKINTLFSSLRSCLPASDQSKKLSIPETVSKSLKYI 120

Query:   114 PELQQQVERLMQKKEELLSKISKPGEISHQQHQRKXXXXXXXXXXXXXXXXDMEILIQIS 173
             PELQQQV+RL+QKKEE+L ++S   +      Q+                 D E+++Q+S
Sbjct:   121 PELQQQVKRLIQKKEEILVRVSGQRDFELYDKQQPKAVASYLSTVSATRLGDNEVMVQVS 180

Query:   174 SYKVHKCPLSKILFNLEEDGLVLVNASFFESFQGRVFYNLHLQVKST--YGLDCEVLNEK 231
             S K+H   +S +L  +EEDG VLV+ S   S   R+FY LHLQV++   Y ++CE L+E+
Sbjct:   181 SSKIHNFSISNVLGGIEEDGFVLVDVSSSRSQGERLFYTLHLQVENMDDYKINCEELSER 240

Query:   232 LKSFYNEKREDLF 244
             +   Y EK E+ F
Sbjct:   241 MLYLY-EKCENSF 252




GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0010106 "cellular response to iron ion starvation" evidence=IEP
GO:0005515 "protein binding" evidence=IPI
GO:0055072 "iron ion homeostasis" evidence=IGI
TAIR|locus:2080615 bHLH39 "basic helix-loop-helix 39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040287 BHLH100 "basic helix-loop-helix protein 100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146663 BHLH101 "AT5G04150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q941Z7 P0431G06.13-1 "BHLH transcription factor-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2165311 AT5G51780 "AT5G51780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138019 AT4G25400 "AT4G25400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133089 AT4G20970 "AT4G20970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026291 AT1G71200 "AT1G71200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZY5 TAL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M1K1ORG2_ARATHNo assigned EC number0.46480.95230.9486yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 2e-11
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 4e-11
smart0035353 smart00353, HLH, helix loop helix domain 2e-09
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
 Score = 57.1 bits (139), Expect = 2e-11
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 65  KKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQ 117
           ++  HN  ER RR +IN  +  LR LLP     KKLS    +   ++YI  LQ
Sbjct: 1   RRKAHNERERRRRDRINDAFEELRELLP-TPPNKKLSKAEILRLAIEYIKHLQ 52


Length = 52

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.42
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.38
smart0035353 HLH helix loop helix domain. 99.31
KOG1318411 consensus Helix loop helix transcription factor EB 98.81
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.65
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.63
KOG4029228 consensus Transcription factor HAND2/Transcription 98.07
PLN0321793 transcription factor ATBS1; Provisional 98.05
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.03
KOG4304250 consensus Transcriptional repressors of the hairy/ 97.9
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 97.77
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 97.69
KOG0561 373 consensus bHLH transcription factor [Transcription 97.64
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 97.6
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.49
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 97.44
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 97.33
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.04
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 96.93
KOG3910632 consensus Helix loop helix transcription factor [T 96.79
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 96.73
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 96.61
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 96.58
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 96.22
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.02
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 95.65
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 95.35
KOG4447173 consensus Transcription factor TWIST [Transcriptio 95.33
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 95.15
PRK0019490 hypothetical protein; Validated 95.13
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 95.07
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 95.04
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 95.01
PRK05007884 PII uridylyl-transferase; Provisional 94.99
KOG4395285 consensus Transcription factor Atonal, contains HT 94.86
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 94.56
PRK00275895 glnD PII uridylyl-transferase; Provisional 94.01
PRK03381774 PII uridylyl-transferase; Provisional 93.56
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 93.51
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 93.33
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 93.32
PRK05092931 PII uridylyl-transferase; Provisional 93.19
PRK01759854 glnD PII uridylyl-transferase; Provisional 93.04
PRK04435147 hypothetical protein; Provisional 93.01
PRK04374869 PII uridylyl-transferase; Provisional 92.82
KOG3898254 consensus Transcription factor NeuroD and related 92.73
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 92.67
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 92.44
PRK03381774 PII uridylyl-transferase; Provisional 92.27
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 92.25
PRK05007884 PII uridylyl-transferase; Provisional 92.18
PRK03059856 PII uridylyl-transferase; Provisional 91.87
COG4492150 PheB ACT domain-containing protein [General functi 91.56
PRK01759854 glnD PII uridylyl-transferase; Provisional 91.19
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 91.07
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 90.89
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 90.17
cd0211660 ACT ACT domains are commonly involved in specifica 89.95
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 89.78
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 89.27
PRK05092 931 PII uridylyl-transferase; Provisional 88.58
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 88.32
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 87.88
PRK03059856 PII uridylyl-transferase; Provisional 86.92
PRK04374869 PII uridylyl-transferase; Provisional 86.45
PRK00275 895 glnD PII uridylyl-transferase; Provisional 85.83
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 85.76
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 85.31
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 84.54
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 84.08
PRK07334403 threonine dehydratase; Provisional 83.99
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 83.91
PRK08577136 hypothetical protein; Provisional 83.61
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 82.73
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 82.19
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 81.35
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 80.97
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
Probab=99.42  E-value=4.8e-13  Score=93.49  Aligned_cols=53  Identities=38%  Similarity=0.684  Sum_probs=48.6

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHhcCCCC--CCCCCCChhHHHHHHHHHHHHHH
Q 025477           65 KKLYHNASERDRRKKINSLYSSLRSLLPVA--DQTKKLSIPATVSRVLKYIPELQ  117 (252)
Q Consensus        65 ~k~~H~~~ER~RR~~mn~~f~~LrsllP~~--~~~dK~Si~~~l~~Ai~YIk~Lq  117 (252)
                      +|..|+..||+||..||+.|..|+.+||..  ....|.+..+||..||+||++||
T Consensus         1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            578999999999999999999999999996  35668888889999999999997



; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....

>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 2e-13
1hlo_A80 Protein (transcription factor MAX); transcriptiona 5e-12
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 6e-11
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 8e-11
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 1e-08
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 1e-05
1a0a_A63 BHLH, protein (phosphate system positive regulator 5e-05
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 8e-04
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
 Score = 63.5 bits (155), Expect = 2e-13
 Identities = 17/67 (25%), Positives = 35/67 (52%)

Query: 64  VKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERL 123
           VK+  HN  ER RR ++   + +LR  +P  +  +K      + +   YI  +Q + ++L
Sbjct: 5   VKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKL 64

Query: 124 MQKKEEL 130
           + +++ L
Sbjct: 65  ISEEDLL 71


>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Length = 60 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.65
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.63
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.62
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.6
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.6
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.52
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.51
4ati_A118 MITF, microphthalmia-associated transcription fact 99.45
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.45
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.45
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.44
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.37
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.33
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.92
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.8
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.62
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.54
4ath_A83 MITF, microphthalmia-associated transcription fact 98.1
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 96.53
1u8s_A 192 Glycine cleavage system transcriptional repressor, 94.33
2nyi_A 195 Unknown protein; protein structure initiative, PSI 93.44
1u8s_A192 Glycine cleavage system transcriptional repressor, 93.17
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 92.69
2nyi_A195 Unknown protein; protein structure initiative, PSI 91.49
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 84.96
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 84.73
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 83.98
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 83.87
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 82.55
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 80.94
3he4_B46 Synzip5; heterodimeric coiled-coil, de novo protei 80.85
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
Probab=99.65  E-value=5.6e-16  Score=116.15  Aligned_cols=68  Identities=16%  Similarity=0.331  Sum_probs=63.3

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 025477           65 KKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERLMQKKEELLS  132 (252)
Q Consensus        65 ~k~~H~~~ER~RR~~mn~~f~~LrsllP~~~~~dK~Si~~~l~~Ai~YIk~Lq~~v~~L~~~k~~l~~  132 (252)
                      +|..||+.||+||..||+.|..|+++||.....+|+|.++||..|++||++|+++.++|..+++.+..
T Consensus         1 ~R~~HN~~ER~RR~~lk~~f~~Lr~~vP~~~~~~k~sk~~iL~kA~~yI~~L~~~~~~l~~e~~~L~~   68 (80)
T 1nlw_A            1 SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQR   68 (80)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcchHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            36789999999999999999999999999888899999999999999999999999999988887764



>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>3he4_B Synzip5; heterodimeric coiled-coil, de novo protein; 2.46A {Artificial gene} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 252
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 4e-16
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 1e-12
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 2e-12
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 5e-12
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 1e-10
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 2e-10
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 2e-09
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 1e-06
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myc proto-oncogene protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 69.2 bits (169), Expect = 4e-16
 Identities = 17/71 (23%), Positives = 36/71 (50%)

Query: 64  VKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERL 123
           VK+  HN  ER RR ++   + +LR  +P  +  +K      + +   YI  +Q + ++L
Sbjct: 5   VKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKL 64

Query: 124 MQKKEELLSKI 134
           + +++ L  + 
Sbjct: 65  ISEEDLLRKRR 75


>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.63
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.5
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.49
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.36
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 96.43
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 95.68
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 94.51
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 92.14
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 83.61
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 81.66
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Mad protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.64  E-value=4.2e-16  Score=114.24  Aligned_cols=67  Identities=16%  Similarity=0.335  Sum_probs=62.3

Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 025477           66 KLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVERLMQKKEELLS  132 (252)
Q Consensus        66 k~~H~~~ER~RR~~mn~~f~~LrsllP~~~~~dK~Si~~~l~~Ai~YIk~Lq~~v~~L~~~k~~l~~  132 (252)
                      |..|++.||+||.+||+.|..|+++||......|+|..+||..||+||+.|++.++.|..+++.+..
T Consensus         2 R~~Hn~~Er~RR~~in~~f~~L~~llP~~~~~~k~sK~~iL~~A~~yI~~L~~~~~~l~~~~~~L~~   68 (79)
T d1nlwa_           2 RSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQR   68 (79)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhCccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            6789999999999999999999999999877788999999999999999999999999988887764



>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure