Citrus Sinensis ID: 025490
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| 255562308 | 364 | Dual specificity protein phosphatase, pu | 0.646 | 0.447 | 0.781 | 1e-66 | |
| 225440081 | 366 | PREDICTED: dual specificity protein phos | 0.650 | 0.448 | 0.781 | 3e-64 | |
| 224137682 | 355 | predicted protein [Populus trichocarpa] | 0.611 | 0.433 | 0.757 | 8e-58 | |
| 449446728 | 365 | PREDICTED: dual specificity protein phos | 0.646 | 0.446 | 0.759 | 4e-57 | |
| 449489501 | 365 | PREDICTED: dual specificity protein phos | 0.646 | 0.446 | 0.759 | 4e-57 | |
| 224089979 | 352 | predicted protein [Populus trichocarpa] | 0.599 | 0.428 | 0.739 | 2e-56 | |
| 356504682 | 354 | PREDICTED: dual specificity protein phos | 0.702 | 0.5 | 0.497 | 3e-54 | |
| 357509359 | 370 | Dual specificity protein phosphatase [Me | 0.710 | 0.483 | 0.509 | 2e-53 | |
| 87241169 | 360 | Dual specificity protein phosphatase [Me | 0.710 | 0.497 | 0.509 | 3e-53 | |
| 356571921 | 354 | PREDICTED: dual specificity protein phos | 0.702 | 0.5 | 0.502 | 3e-52 |
| >gi|255562308|ref|XP_002522161.1| Dual specificity protein phosphatase, putative [Ricinus communis] gi|223538599|gb|EEF40202.1| Dual specificity protein phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 259 bits (661), Expect = 1e-66, Method: Compositional matrix adjust.
Identities = 129/165 (78%), Positives = 143/165 (86%), Gaps = 2/165 (1%)
Query: 1 MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKV 60
MPYLVR++LFIGNI DAA++LQ S+EITH+LSVL+S SISFF EWR+ L IP+KEIKKV
Sbjct: 1 MPYLVRKNLFIGNIGDAAEVLQKDSTEITHILSVLNSPSISFFAEWRTGLNIPAKEIKKV 60
Query: 61 YAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDY 120
Y GG + S S +DLG GS+S LSP KLLYSLEYAGKDLKLVRM VPIRDMESE+LLDY
Sbjct: 61 YVGGFDE--SASKEDLGTGSKSSLSPNKLLYSLEYAGKDLKLVRMAVPIRDMESEDLLDY 118
Query: 121 LDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSE 165
LDVC DFID+ RKEG VLVHCFAGVSRSAAIITAYLMRTEQLS E
Sbjct: 119 LDVCLDFIDQSRKEGSVLVHCFAGVSRSAAIITAYLMRTEQLSQE 163
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225440081|ref|XP_002282532.1| PREDICTED: dual specificity protein phosphatase 12 [Vitis vinifera] gi|297741650|emb|CBI32782.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224137682|ref|XP_002322618.1| predicted protein [Populus trichocarpa] gi|222867248|gb|EEF04379.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449446728|ref|XP_004141123.1| PREDICTED: dual specificity protein phosphatase 12-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449489501|ref|XP_004158331.1| PREDICTED: dual specificity protein phosphatase 12-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224089979|ref|XP_002308890.1| predicted protein [Populus trichocarpa] gi|222854866|gb|EEE92413.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356504682|ref|XP_003521124.1| PREDICTED: dual specificity protein phosphatase 12-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357509359|ref|XP_003624968.1| Dual specificity protein phosphatase [Medicago truncatula] gi|355499983|gb|AES81186.1| Dual specificity protein phosphatase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|87241169|gb|ABD33027.1| Dual specificity protein phosphatase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356571921|ref|XP_003554119.1| PREDICTED: dual specificity protein phosphatase 12-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| UNIPROTKB|Q2RAU9 | 356 | Os11g0136800 "Os11g0136800 pro | 0.611 | 0.432 | 0.523 | 1.6e-43 | |
| UNIPROTKB|Q2QY35 | 356 | LOC_Os12g03990 "Os12g0133700 p | 0.611 | 0.432 | 0.517 | 5.2e-43 | |
| TAIR|locus:2082395 | 167 | MKP2 "MAPK phosphatase 2" [Ara | 0.222 | 0.335 | 0.456 | 7.3e-17 | |
| UNIPROTKB|E2RKL4 | 227 | DUSP19 "Uncharacterized protei | 0.230 | 0.255 | 0.491 | 1.7e-15 | |
| UNIPROTKB|Q5VNG7 | 199 | OJ1460_H08.5 "Uncharacterized | 0.234 | 0.296 | 0.5 | 2.4e-15 | |
| UNIPROTKB|Q8WTR2 | 217 | DUSP19 "Dual specificity prote | 0.230 | 0.267 | 0.508 | 4.8e-15 | |
| UNIPROTKB|A6H7A7 | 227 | DUSP19 "Uncharacterized protei | 0.285 | 0.317 | 0.432 | 4.6e-13 | |
| UNIPROTKB|F1RYL2 | 227 | DUSP19 "Uncharacterized protei | 0.285 | 0.317 | 0.432 | 4.8e-13 | |
| MGI|MGI:1915332 | 220 | Dusp19 "dual specificity phosp | 0.222 | 0.254 | 0.491 | 5.2e-13 | |
| RGD|1307457 | 220 | Dusp19 "dual specificity phosp | 0.230 | 0.263 | 0.474 | 8e-13 |
| UNIPROTKB|Q2RAU9 Os11g0136800 "Os11g0136800 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 391 (142.7 bits), Expect = 1.6e-43, Sum P(2) = 1.6e-43
Identities = 88/168 (52%), Positives = 112/168 (66%)
Query: 1 MPYLVREHLFIGNISDAADILQNGSSE---ITHMLSVLSSASISFFTEWRSSLTIPSKEI 57
MP+LVRE LF G+I+DA L +++ TH+LSV+SSASISF T+ R L+IP++E+
Sbjct: 1 MPHLVRERLFFGDINDAIAALTTTAADTGGFTHLLSVVSSASISFITDCRPGLSIPTEEV 60
Query: 58 KKVYAXXXXXXXXXXXXXXXXXXRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENL 117
++V A S ++P +LL +E AG L++ RM VP+RD E ENL
Sbjct: 61 RRVVAGEEGAPPV-----------SAVAPGRLLRVVERAGVGLRVTRMAVPLRDTEEENL 109
Query: 118 LDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSE 165
LD+L+ C DFID RKEG VLVHCFAGVSRSA II AYLMRTEQ S E
Sbjct: 110 LDHLEPCLDFIDEGRKEGNVLVHCFAGVSRSATIIVAYLMRTEQKSLE 157
|
|
| UNIPROTKB|Q2QY35 LOC_Os12g03990 "Os12g0133700 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082395 MKP2 "MAPK phosphatase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RKL4 DUSP19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5VNG7 OJ1460_H08.5 "Uncharacterized protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WTR2 DUSP19 "Dual specificity protein phosphatase 19" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H7A7 DUSP19 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RYL2 DUSP19 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915332 Dusp19 "dual specificity phosphatase 19" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307457 Dusp19 "dual specificity phosphatase 19" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 5e-25 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 2e-21 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 4e-21 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 3e-08 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 1e-06 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 1e-06 | |
| COG5350 | 172 | COG5350, COG5350, Predicted protein tyrosine phosp | 6e-04 | |
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 8e-04 |
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
Score = 96.1 bits (240), Expect = 5e-25
Identities = 38/91 (41%), Positives = 50/91 (54%), Gaps = 15/91 (16%)
Query: 103 VRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGG-VLVHCFAGVSRSAAIITAYLMRTEQ 161
+ VPI D+ S+++ Y D DFID R++GG VLVHC AGVSRSA ++ AYLM+T
Sbjct: 49 NYLYVPILDLPSQDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLG 108
Query: 162 LSSE-------------GLNK-FIFSLEYYE 178
LS N F+ L+ YE
Sbjct: 109 LSLREAYEFVKSRRPIISPNAGFMRQLKEYE 139
|
Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 100.0 | |
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 100.0 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 99.97 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 99.97 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.96 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.96 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.93 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.84 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 99.84 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.82 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.66 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.63 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.49 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.38 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.37 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 99.23 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.14 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.09 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.09 | |
| PLN02727 | 986 | NAD kinase | 98.94 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.82 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.75 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.68 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 98.6 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 98.59 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 98.43 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.39 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.23 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 98.18 | |
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 98.12 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 98.1 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 98.09 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 98.08 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 98.05 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 98.01 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 97.93 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 97.69 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 97.59 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 97.52 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 97.41 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 97.3 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 96.85 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 96.46 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 95.08 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 95.07 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 94.4 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 93.72 | |
| KOG4471 | 717 | consensus Phosphatidylinositol 3-phosphate 3-phosp | 92.36 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 86.57 | |
| KOG1089 | 573 | consensus Myotubularin-related phosphatidylinosito | 83.62 |
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-32 Score=221.30 Aligned_cols=136 Identities=34% Similarity=0.502 Sum_probs=123.8
Q ss_pred CceeecCeeecChhchhhHHHhhhCCCcEEEEccccccccchhcccccCCCChhhhhhhccCCCCCCCCCCCCCCCCCCC
Q 025490 2 PYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSR 81 (252)
Q Consensus 2 P~~I~~~LylGs~~~a~d~~~L~~~gIt~IVnl~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (252)
|++|.|+||+|+.+++.+.+.|+++||++|||++.+...
T Consensus 1 ~~~I~~~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~~----------------------------------------- 39 (138)
T smart00195 1 PSEILPHLYLGSYSSALNLALLKKLGITHVINVTNEVPN----------------------------------------- 39 (138)
T ss_pred CcEEeCCeEECChhHcCCHHHHHHcCCCEEEEccCCCCC-----------------------------------------
Confidence 899999999999999999999999999999999873200
Q ss_pred CCCCCchhhhhhhhhccCcceEEEEEecCCCCCCcHHHHHHHHHHHHHHHhhCC-cEEEecCCCCChhHHHHHHHHHHHc
Q 025490 82 SCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEG-GVLVHCFAGVSRSAAIITAYLMRTE 160 (252)
Q Consensus 82 ~~~~p~~~~~~~~~~~~~~~i~~l~ipi~D~~~~~l~~~~~~~~~fI~~~~~~G-~VLVHC~aG~sRS~~lv~ayLm~~~ 160 (252)
....++.|+++|+.|....++.+.++++++||+.+.++| +|||||.+|+|||+++++||||...
T Consensus 40 ---------------~~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~VlVHC~~G~~RS~~v~~~yl~~~~ 104 (138)
T smart00195 40 ---------------LNKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGKVLVHCQAGVSRSATLIIAYLMKYR 104 (138)
T ss_pred ---------------CCCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCeEEEECCCCCchHHHHHHHHHHHHh
Confidence 012368899999999777788899999999999999887 4999999999999999999999999
Q ss_pred CCCHHHHHHHHHhhcccccchhhhhhhhchhhhhcccchhhhhhhhhcccCCCCCCCCChhHHHHHHHHhcCCccCChhH
Q 025490 161 QLSSEGLNKFIFSLEYYESTQSYCLFLSDEYEICDCHFKLTYFLFSFALFFPLSFCPCIPAGALESLRQSCESVCPNDGF 240 (252)
Q Consensus 161 ~~s~~eA~~~v~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~v~~~r~~~~pn~~f 240 (252)
||+++ +|++.|+.+||.+.||.+|
T Consensus 105 ~~~~~--------------------------------------------------------~A~~~v~~~R~~~~p~~~~ 128 (138)
T smart00195 105 NLSLN--------------------------------------------------------DAYDFVKDRRPIISPNFGF 128 (138)
T ss_pred CCCHH--------------------------------------------------------HHHHHHHHHCCccCCCHhH
Confidence 99999 9999999999999999999
Q ss_pred HHHHHHHHH
Q 025490 241 LEQVILIIV 249 (252)
Q Consensus 241 ~~ql~~~~~ 249 (252)
++||.+||+
T Consensus 129 ~~qL~~~e~ 137 (138)
T smart00195 129 LRQLIEYER 137 (138)
T ss_pred HHHHHHHhh
Confidence 999999986
|
|
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 252 | ||||
| 3s4e_A | 144 | Crystal Structrue Of A Novel Mitogen-Activated Prot | 4e-10 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 2e-07 | ||
| 2g6z_A | 211 | Crystal Structure Of Human Dusp5 Length = 211 | 2e-07 | ||
| 2esb_A | 188 | Crystal Structure Of Human Dusp18 Length = 188 | 3e-07 | ||
| 1mkp_A | 144 | Crystal Structure Of Pyst1 (Mkp3) Length = 144 | 3e-07 | ||
| 2hxp_A | 155 | Crystal Structure Of The Human Phosphatase (Dusp9) | 1e-06 | ||
| 1yz4_A | 160 | Crystal Structure Of Dusp15 Length = 160 | 3e-06 | ||
| 2wgp_A | 190 | Crystal Structure Of Human Dual Specificity Phospha | 3e-06 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 6e-06 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 6e-06 | ||
| 2r0b_A | 154 | Crystal Structure Of Human Tyrosine Phosphatase-lik | 1e-05 | ||
| 2oud_A | 177 | Crystal Structure Of The Catalytic Domain Of Human | 5e-05 | ||
| 1zzw_A | 149 | Crystal Structure Of Catalytic Domain Of Human Map | 5e-05 | ||
| 1j4x_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase C124 | 7e-05 | ||
| 2hcm_A | 164 | Crystal Structure Of Mouse Putative Dual Specificit | 7e-05 | ||
| 1m3g_A | 145 | Solution Structure Of The Catalytic Domain Of Mapk | 8e-05 | ||
| 1wrm_A | 165 | Crystal Structure Of Jsp-1 Length = 165 | 2e-04 | ||
| 2nt2_A | 145 | Crystal Structure Of Slingshot Phosphatase 2 Length | 3e-04 | ||
| 2p4d_A | 172 | Structure-Assisted Discovery Of Variola Major H1 Ph | 4e-04 |
| >pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 | Back alignment and structure |
|
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 | Back alignment and structure |
| >pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 | Back alignment and structure |
| >pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 | Back alignment and structure |
| >pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 | Back alignment and structure |
| >pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 | Back alignment and structure |
| >pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 | Back alignment and structure |
| >pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 | Back alignment and structure |
| >pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 | Back alignment and structure |
| >pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 | Back alignment and structure |
| >pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 | Back alignment and structure |
| >pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 | Back alignment and structure |
| >pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 | Back alignment and structure |
| >pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 | Back alignment and structure |
| >pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 9e-27 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 2e-26 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 2e-26 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 3e-26 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 3e-26 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 3e-26 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 3e-26 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 5e-26 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 5e-26 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 5e-26 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 8e-26 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 8e-26 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 1e-25 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 1e-25 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 2e-25 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 2e-25 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 3e-25 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 4e-25 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 5e-25 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 8e-25 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 3e-24 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 1e-21 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 2e-18 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 4e-10 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 3e-07 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 6e-07 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 9e-05 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 2e-04 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 3e-04 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 3e-04 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 3e-04 |
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
Score = 100 bits (252), Expect = 9e-27
Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
Query: 102 LVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGG-VLVHCFAGVSRSAAIITAYLMRTE 160
+ + VP+ D +E+LL +L+ ++ ++GG LV+C G SRSAA+ TAYLMR
Sbjct: 56 VAELRVPVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHR 115
Query: 161 QLSSE 165
S +
Sbjct: 116 GHSLD 120
|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 100.0 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 100.0 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 100.0 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 100.0 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 100.0 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.98 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.98 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.97 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.97 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.97 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.97 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.97 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.97 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.97 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.97 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.97 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.97 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.97 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.97 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.96 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.96 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.94 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.94 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.93 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.93 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.92 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.86 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.84 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.82 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.81 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.8 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.79 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.79 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.79 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.64 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.58 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.53 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.3 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.27 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.0 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 98.95 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.8 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.74 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.68 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.66 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.61 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.61 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.61 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.6 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.6 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.59 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.57 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.56 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.55 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.53 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.51 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.51 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.51 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.5 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.5 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.5 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.49 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.49 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.47 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.46 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.44 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.43 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.38 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.31 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.27 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.27 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.26 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 98.22 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.18 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.13 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.12 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.11 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.09 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.09 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.08 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 98.02 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.95 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.86 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.14 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 86.65 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 83.92 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 81.32 |
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.3e-35 Score=240.79 Aligned_cols=138 Identities=22% Similarity=0.281 Sum_probs=123.9
Q ss_pred CceeecCeeecChhchhhHHHhhhCCCcEEEEccccccccchhcccccCCCChhhhhhhccCCCCCCCCCCCCCCCCCCC
Q 025490 2 PYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSR 81 (252)
Q Consensus 2 P~~I~~~LylGs~~~a~d~~~L~~~gIt~IVnl~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (252)
|++|.|+||+|+...+.|.+.|++.|||+|||++.+.
T Consensus 10 ~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~------------------------------------------- 46 (161)
T 3emu_A 10 PTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEV------------------------------------------- 46 (161)
T ss_dssp CEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC----------------------------------------------
T ss_pred ceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCC-------------------------------------------
Confidence 7899999999999999999999999999999998731
Q ss_pred CCCCCchhhhhhhhhccCcceEEEEEecCCCCCCcHHHHHHHHHHHHHHHhhCC-cEEEecCCCCChhHHHHHHHHHHHc
Q 025490 82 SCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEG-GVLVHCFAGVSRSAAIITAYLMRTE 160 (252)
Q Consensus 82 ~~~~p~~~~~~~~~~~~~~~i~~l~ipi~D~~~~~l~~~~~~~~~fI~~~~~~G-~VLVHC~aG~sRS~~lv~ayLm~~~ 160 (252)
|.. ...++.|+++|+.|.+..++.++|+++++||++++++| +|||||.+|+|||+++++||||+..
T Consensus 47 ----~~~---------~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~ 113 (161)
T 3emu_A 47 ----PSL---------FKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYYQ 113 (161)
T ss_dssp -----------------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCEEEEEESSSSSHHHHHHHHHHHHHT
T ss_pred ----ccc---------cCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCeEEEEcCCCCcHHHHHHHHHHHHHh
Confidence 000 01268899999999999999999999999999998876 5999999999999999999999999
Q ss_pred CCCHHHHHHHHHhhcccccchhhhhhhhchhhhhcccchhhhhhhhhcccCCCCCCCCChhHHHHHHHHhcCCccCChhH
Q 025490 161 QLSSEGLNKFIFSLEYYESTQSYCLFLSDEYEICDCHFKLTYFLFSFALFFPLSFCPCIPAGALESLRQSCESVCPNDGF 240 (252)
Q Consensus 161 ~~s~~eA~~~v~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~v~~~r~~~~pn~~f 240 (252)
||+++ +|++.|+.+||.+.||.||
T Consensus 114 ~~s~~--------------------------------------------------------~A~~~v~~~Rp~i~pn~~f 137 (161)
T 3emu_A 114 RLSFI--------------------------------------------------------NAFNKVQGLYPLIDIESGF 137 (161)
T ss_dssp TCCHH--------------------------------------------------------HHHHHHHHHCTTCCCCHHH
T ss_pred CCCHH--------------------------------------------------------HHHHHHHHHCCCcCCCHHH
Confidence 99999 9999999999999999999
Q ss_pred HHHHHHHHHHh
Q 025490 241 LEQVILIIVER 251 (252)
Q Consensus 241 ~~ql~~~~~~~ 251 (252)
++||.+||+..
T Consensus 138 ~~qL~~~e~~L 148 (161)
T 3emu_A 138 ILQLKLFEKKL 148 (161)
T ss_dssp HHHHHHHHHHH
T ss_pred HHHHHHHHHHH
Confidence 99999999763
|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 252 | ||||
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 1e-08 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 1e-06 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 2e-06 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 3e-06 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 4e-06 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 7e-06 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-04 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 2e-04 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 0.002 |
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: VH1-related dual-specificity phosphatase, VHR species: Human (Homo sapiens) [TaxId: 9606]
Score = 50.9 bits (121), Expect = 1e-08
Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
Query: 98 KDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRR--RKEGGVLVHCFAGVSRSAAIITAY 155
KD + + + D + NL Y + DFID+ +K G VLVHC G SRS ++ AY
Sbjct: 72 KDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAY 131
Query: 156 LMRTEQLSSE 165
LM +++ +
Sbjct: 132 LMMRQKMDVK 141
|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 100.0 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 100.0 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 100.0 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.84 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.82 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.82 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.75 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.66 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.55 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.8 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 98.5 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.48 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.38 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 98.22 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.1 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.08 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.05 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.03 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.02 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.0 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 97.97 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.96 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 97.96 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 97.95 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 95.66 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 88.44 |
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]
Probab=100.00 E-value=2.4e-36 Score=242.56 Aligned_cols=140 Identities=27% Similarity=0.401 Sum_probs=126.7
Q ss_pred CCceeecCeeecChhchhhHHHhhhCCCcEEEEccccccccchhcccccCCCChhhhhhhccCCCCCCCCCCCCCCCCCC
Q 025490 1 MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGS 80 (252)
Q Consensus 1 ~P~~I~~~LylGs~~~a~d~~~L~~~gIt~IVnl~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (252)
+|+||+|+||||+..++.+.+.|++.|||+|||++.+...
T Consensus 3 ~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~---------------------------------------- 42 (144)
T d1mkpa_ 3 FPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPN---------------------------------------- 42 (144)
T ss_dssp CCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCCC----------------------------------------
T ss_pred CCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCCc----------------------------------------
Confidence 6999999999999999999999999999999999873210
Q ss_pred CCCCCCchhhhhhhhhccCcceEEEEEecCCCCCCcHHHHHHHHHHHHHHHhhCC-cEEEecCCCCChhHHHHHHHHHHH
Q 025490 81 RSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEG-GVLVHCFAGVSRSAAIITAYLMRT 159 (252)
Q Consensus 81 ~~~~~p~~~~~~~~~~~~~~~i~~l~ipi~D~~~~~l~~~~~~~~~fI~~~~~~G-~VLVHC~aG~sRS~~lv~ayLm~~ 159 (252)
. .....++.|+++|+.|.+.+++.++|+++++||++++++| +|||||.+|+|||+++++||||++
T Consensus 43 -------~-------~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~~~~VlVHC~~G~~RS~~vv~aYLm~~ 108 (144)
T d1mkpa_ 43 -------L-------FENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHSLAGISRSVTVTVAYLMQK 108 (144)
T ss_dssp -------E-------EEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHTTCEEEEECSSCSHHHHHHHHHHHHHH
T ss_pred -------c-------ccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhccceEEEEecccccchHHHHHHHHHHH
Confidence 0 0123468899999999999999999999999999999877 599999999999999999999999
Q ss_pred cCCCHHHHHHHHHhhcccccchhhhhhhhchhhhhcccchhhhhhhhhcccCCCCCCCCChhHHHHHHHHhcCCccCChh
Q 025490 160 EQLSSEGLNKFIFSLEYYESTQSYCLFLSDEYEICDCHFKLTYFLFSFALFFPLSFCPCIPAGALESLRQSCESVCPNDG 239 (252)
Q Consensus 160 ~~~s~~eA~~~v~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~v~~~r~~~~pn~~ 239 (252)
.||+++ +|++.|+.+||.++||.+
T Consensus 109 ~~~~~~--------------------------------------------------------~A~~~v~~~Rp~i~pn~~ 132 (144)
T d1mkpa_ 109 LNLSMN--------------------------------------------------------DAYDIVKMKKSNISPNFN 132 (144)
T ss_dssp HTCCHH--------------------------------------------------------HHHHHHHHHCTTCCCCST
T ss_pred hCCCHH--------------------------------------------------------HHHHHHHHHCCCCCCCHH
Confidence 999999 999999999999999999
Q ss_pred HHHHHHHHHHH
Q 025490 240 FLEQVILIIVE 250 (252)
Q Consensus 240 f~~ql~~~~~~ 250 (252)
|++||++||+.
T Consensus 133 f~~qL~~~e~~ 143 (144)
T d1mkpa_ 133 FMGQLLDFERT 143 (144)
T ss_dssp THHHHHHHHHT
T ss_pred HHHHHHHHHhh
Confidence 99999999875
|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|