Citrus Sinensis ID: 025574

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250

MWGYLWIPILFSLSKEFSSVEAQSKILLPSQRQRQQNDAVSSLSVLVPRCPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHVRPCTINLLSTSVARFNCLKILKL

ccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccEEEccccccccccHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHccccccccEEcccc

cccHHHHHHHHHHHHHccHHHcccccccccccccccccEEEEEccccccccccccccccccEEEEEEEccccccccccccccccEEEHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHccccEEcccccccccEEEEEcccccccHHHHccc

MWGYLWIPILFSLSKEFSSVEAQskillpsqrqrqqndavsslsvlvprcpvpdsklnyrpvigivthpgdgasgrlnnatNASYIAASYVKFVESagarvipliynepedvLFEKLELVNGvlytggwakdgLYYAIVEKVFKKILekndagdhfplyaHCLGFELLTMIISKDKNILESFNAADQASTLQFMEntsiegtvfqrfppkliKKLSTDCLvmqnhhvrpctinLLSTSVARFNCLKILKL

MWGYLWIPILFSLSKEFSSVEAQSKIllpsqrqrqqNDAVSSLSVLVPRCPVPDSKLNYRPVIGIVThpgdgasgrLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHVRPCTINLLSTSVARFNCLKILKL

*WGYLWIPILFSLSKEF*************************LSVLVPRCPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHVRPCTINLLSTSVARFNCLKIL**

*WGYLWIPILFSLSKEFSSVEAQSKILLPSQRQRQQNDAVSSLSVLVPRC******LNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHVRPCTINLLSTSVARFNCLKILKL

MWGYLWIPILFSLSKEFSSVEAQSKILLP************SLSVLVPRCPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHVRPCTINLLSTSVARFNCLKILKL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		250	2.2.26 [Sep-21-2011]
O65355		347	Gamma-glutamyl hydrolase	yes	no	0.872	0.628	0.625	8e-82
P93164		342	Gamma-glutamyl hydrolase	no	no	0.792	0.578	0.548	8e-58
Q54LN4		317	Gamma-glutamyl hydrolase	yes	no	0.748	0.589	0.319	1e-25
Q54HL4		347	Gamma-glutamyl hydrolase	no	no	0.748	0.538	0.336	4e-24
Q9Z0L8		317	Gamma-glutamyl hydrolase	yes	no	0.684	0.539	0.381	9e-23
Q62867		317	Gamma-glutamyl hydrolase	yes	no	0.636	0.501	0.378	3e-19
Q92820		318	Gamma-glutamyl hydrolase	yes	no	0.66	0.518	0.337	1e-16
A7YWG4		318	Gamma-glutamyl hydrolase	yes	no	0.652	0.512	0.344	3e-15

>sp\|O65355\|GGH_ARATH Gamma-glutamyl hydrolase OS=Arabidopsis thaliana GN=GGH PE=1 SV=2	Back alignment and function desciption

 Score =  303 bits (776), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 142/227 (62%), Positives = 181/227 (79%), Gaps = 9/227 (3%)

Query: 1   MWGYLWIPIL-FSLSKEFSSVEAQSKILLPSQRQRQQNDAVSSLSVLVPRCPVPDSKLNY 59
           MW Y+W+P++  SL K+   +   + ILLPSQ     + +        P C  PD  LNY
Sbjct: 1   MWSYVWLPLVALSLFKDSIIMAKAATILLPSQTGFDISRS--------PVCSAPDPNLNY 52

Query: 60  RPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLEL 119
           RPVIGI++HPGDGASGRL+NAT+AS IAASYVK  ES GARVIPLI+NEPE++LF+KLEL
Sbjct: 53  RPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEPEEILFQKLEL 112

Query: 120 VNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNIL 179
           VNGV+ TGGWAK+GLY+ IV+K+F K+LE+NDAG+HFP+YA CLGFELLTMIIS++++I 
Sbjct: 113 VNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLTMIISQNRDIF 172

Query: 180 ESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHH 226
           E  +A + AS+LQF+EN +I+GT+FQRFPP+L+KKL TDCLVMQNH 
Sbjct: 173 EKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNHR 219

Has endopeptidase activity against 4-amino-10-methylpteroyl penta-, tetra-, tri- and di-gamma-L-glutamate substrates and is responsible for the production of folic acid, pteglu from teroylpolyglutamates.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 9

>sp\|P93164\|GGH_SOYBN Gamma-glutamyl hydrolase OS=Glycine max PE=2 SV=1	Back alignment and function description

>sp\|Q54LN4\|GGHA_DICDI Gamma-glutamyl hydrolase A OS=Dictyostelium discoideum GN=gghA PE=3 SV=1	Back alignment and function description

>sp\|Q54HL4\|GGHB_DICDI Gamma-glutamyl hydrolase B OS=Dictyostelium discoideum GN=gghB PE=3 SV=1	Back alignment and function description

>sp\|Q9Z0L8\|GGH_MOUSE Gamma-glutamyl hydrolase OS=Mus musculus GN=Ggh PE=1 SV=2	Back alignment and function description

>sp\|Q62867\|GGH_RAT Gamma-glutamyl hydrolase OS=Rattus norvegicus GN=Ggh PE=1 SV=1	Back alignment and function description

>sp\|Q92820\|GGH_HUMAN Gamma-glutamyl hydrolase OS=Homo sapiens GN=GGH PE=1 SV=2	Back alignment and function description

>sp\|A7YWG4\|GGH_BOVIN Gamma-glutamyl hydrolase OS=Bos taurus GN=GGH PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		250
255567082		388	Gamma-glutamyl hydrolase precursor, puta	0.864	0.556	0.764	5e-96
224104165		304	predicted protein [Populus trichocarpa]	0.872	0.717	0.709	5e-92
302142873		514	unnamed protein product [Vitis vinifera]	0.876	0.426	0.721	2e-91
224117460		367	predicted protein [Populus trichocarpa]	0.872	0.594	0.701	3e-91
225461732		384	PREDICTED: gamma-glutamyl hydrolase [Vit	0.876	0.570	0.721	5e-91
224122254		327	predicted protein [Populus trichocarpa]	0.716	0.547	0.793	3e-81
357452059		341	Gamma-glutamylhydrolase [Medicago trunca	0.804	0.589	0.680	7e-81
449518069		433	PREDICTED: LOW QUALITY PROTEIN: gamma-gl	0.856	0.494	0.658	1e-80
449456571		375	PREDICTED: gamma-glutamyl hydrolase-like	0.856	0.570	0.658	2e-80
30699349		347	gamma-glutamyl hydrolase 2 [Arabidopsis	0.872	0.628	0.625	5e-80

>gi\|255567082\|ref\|XP_002524523.1\| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] gi\|223536197\|gb\|EEF37850.1\| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 193/234 (82%), Gaps = 18/234 (7%)

Query: 1   MWGYLWIPILFSLSKEFSSVEAQ--------SKILLPSQRQRQQNDAVSSLSVLVPRCPV 52
           MW YLWIPIL SLSKE S  +A         S ILLPSQ   +           VPRC  
Sbjct: 41  MWNYLWIPILISLSKELSLAKASRSNINSNNSNILLPSQLDDEP----------VPRCLA 90

Query: 53  PDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDV 112
           PD KLNYRPVIGIV+HPGDGASGRL+NATNASYIAASYVKFVESAGARVIPLIYNEP D+
Sbjct: 91  PDPKLNYRPVIGIVSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIYNEPPDI 150

Query: 113 LFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMII 172
           LFEKL LVNGVL+TGGWAK+GLYY IV+ +FKK+L+KNDAG HFPLYA CLGFELLTMII
Sbjct: 151 LFEKLNLVNGVLFTGGWAKNGLYYDIVKAIFKKVLDKNDAGYHFPLYAICLGFELLTMII 210

Query: 173 SKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHH 226
           SKD+NILESFNAADQASTLQFM N +IEGTVFQRFPP L+KKLSTDCLVMQNHH
Sbjct: 211 SKDRNILESFNAADQASTLQFMGNINIEGTVFQRFPPGLLKKLSTDCLVMQNHH 264

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224104165\|ref\|XP_002333977.1\| predicted protein [Populus trichocarpa] gi\|222839427\|gb\|EEE77764.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|302142873\|emb\|CBI20168.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224117460\|ref\|XP_002331718.1\| predicted protein [Populus trichocarpa] gi\|222874324\|gb\|EEF11455.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225461732\|ref\|XP_002285525.1\| PREDICTED: gamma-glutamyl hydrolase [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224122254\|ref\|XP_002318789.1\| predicted protein [Populus trichocarpa] gi\|222859462\|gb\|EEE97009.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357452059\|ref\|XP_003596306.1\| Gamma-glutamylhydrolase [Medicago truncatula] gi\|355485354\|gb\|AES66557.1\| Gamma-glutamylhydrolase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449518069\|ref\|XP_004166066.1\| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449456571\|ref\|XP_004146022.1\| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|30699349|ref|NP_565186.2| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] gi|26454629|sp|O65355.2|GGH_ARATH RecName: Full=Gamma-glutamyl hydrolase; AltName: Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X carboxypeptidase; Flags: Precursor gi|17979073|gb|AAL49804.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana] gi|20465329|gb|AAM20068.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana] gi|332198016|gb|AEE36137.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		250
TAIR\|locus:2037603		347	GGH2 "gamma-glutamyl hydrolase	0.868	0.625	0.637	9.3e-75
TAIR\|locus:2037573		352	GGH3 "gamma-glutamyl hydrolase	0.888	0.630	0.594	4.3e-70
TAIR\|locus:2037583		348	GGH1 "gamma-glutamyl hydrolase	0.788	0.566	0.643	1.9e-67
UNIPROTKB\|P93164		342	P93164 "Gamma-glutamyl hydrola	0.792	0.578	0.548	3.8e-53
DICTYBASE\|DDB_G0289365		347	gghB "peptidase C26 family pro	0.74	0.533	0.340	2.2e-25
DICTYBASE\|DDB_G0286535		317	gghA "peptidase C26 family pro	0.744	0.586	0.321	3.6e-25
ZFIN\|ZDB-GENE-040426-2615		312	ggh "gamma-glutamyl hydrolase	0.66	0.528	0.392	5.9e-25
MGI\|MGI:1329035		317	Ggh "gamma-glutamyl hydrolase"	0.636	0.501	0.396	8.7e-24
RGD\|2682		317	Ggh "gamma-glutamyl hydrolase	0.636	0.501	0.384	4.9e-21
UNIPROTKB\|F1RTA3		318	GGH "Uncharacterized protein"	0.632	0.496	0.377	1e-20

TAIR\|locus:2037603 GGH2 "gamma-glutamyl hydrolase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 754 (270.5 bits), Expect = 9.3e-75, P = 9.3e-75
 Identities = 144/226 (63%), Positives = 181/226 (80%)

Query:     1 MWGYLWIPIL-FSLSKEFSSVEAQSKILLPSQRQRQQNDAVSSLSVLVPRCPVPDSKLNY 59
             MW Y+W+P++  SL K+   +   + ILLPSQ      D   S     P C  PD  LNY
Sbjct:     1 MWSYVWLPLVALSLFKDSIIMAKAATILLPSQTGF---DISRS-----PVCSAPDPNLNY 52

Query:    60 RPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLEL 119
             RPVIGI++HPGDGASGRL+NAT+AS IAASYVK  ES GARVIPLI+NEPE++LF+KLEL
Sbjct:    53 RPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEPEEILFQKLEL 112

Query:   120 VNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNIL 179
             VNGV+ TGGWAK+GLY+ IV+K+F K+LE+NDAG+HFP+YA CLGFELLTMIIS++++I 
Sbjct:   113 VNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLTMIISQNRDIF 172

Query:   180 ESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNH 225
             E  +A + AS+LQF+EN +I+GT+FQRFPP+L+KKL TDCLVMQNH
Sbjct:   173 EKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNH 218

GO:0003824 "catalytic activity" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006541 "glutamine metabolic process" evidence=IEA

GO:0008242 "omega peptidase activity" evidence=IEA;IDA

GO:0016787 "hydrolase activity" evidence=IEA

GO:0005773 "vacuole" evidence=IDA

GO:0046900 "tetrahydrofolylpolyglutamate metabolic process" evidence=IDA

GO:0006833 "water transport" evidence=RCA

GO:0006970 "response to osmotic stress" evidence=RCA

GO:0009611 "response to wounding" evidence=RCA

GO:0009651 "response to salt stress" evidence=RCA

GO:0009750 "response to fructose stimulus" evidence=RCA

GO:0009805 "coumarin biosynthetic process" evidence=RCA

GO:0046686 "response to cadmium ion" evidence=RCA

TAIR\|locus:2037573 GGH3 "gamma-glutamyl hydrolase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037583 GGH1 "gamma-glutamyl hydrolase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|P93164 P93164 "Gamma-glutamyl hydrolase" [Glycine max (taxid:3847)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0289365 gghB "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0286535 gghA "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2615 ggh "gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1329035 Ggh "gamma-glutamyl hydrolase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|2682 Ggh "gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RTA3 GGH "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O65355	GGH_ARATH	3, ., 4, ., 1, 9, ., 9	0.6255	0.872	0.6282	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.4.19.9	0.914
3rd Layer	3.4.19	0.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.904.3.1	hypothetical protein (303 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	FPGS4	folylpolyglutamate synthase (EC-6.3.2.17) (525 aa)	•	0.899
	FPGS2	folylpolyglutamate synthase (EC-6.3.2.17) (511 aa)	•	0.899
	FPGS5	folylpolyglutamate synthase (EC-6.3.2.12) (442 aa)	•	0.899
	grail3.16455000101	annotation not avaliable (82 aa)	•	0.899
	DHFR-TS-2	dihydrofolate reductase-thymidylate synthase (EC-1.5.1.3 2.1.1.45) (414 aa)	•	0.899
	FPGS3	folylpolyglutamate synthase (EC-6.3.2.17) (587 aa)	•	0.899
	FPGS1	folylpolyglutamate synthase (EC-6.3.2.17) (588 aa)	•	0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		250
cd01747		273	cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutam	3e-71
pfam07722		219	pfam07722, Peptidase_C26, Peptidase C26	3e-35
cd01745		189	cd01745, GATase1_2, Subgroup of proteins having th	3e-04

>gnl\|CDD\|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase	Back alignment and domain information

 Score =  218 bits (558), Expect = 3e-71
 Identities = 74/166 (44%), Positives = 105/166 (63%), Gaps = 6/166 (3%)

Query: 63  IGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNG 122
           IGI+T P DGA    +N T  SYIAASYVKF+ESAGARV+P+  NE E+   +  + +NG
Sbjct: 1   IGILTQPVDGAG---SNKTGHSYIAASYVKFLESAGARVVPIWINESEEYYDKLFKSING 57

Query: 123 VLYTGGWA--KDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILE 180
           +L+ GG        Y    + ++   LE+NDAGD+FP++  CLGFELLT + S +  +LE
Sbjct: 58  ILFPGGAVDIDTSGYARTAKIIYNLALERNDAGDYFPVWGTCLGFELLTYLTSGETLLLE 117

Query: 181 SFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHH 226
           +  A + A  L F    +++  +F+RFPP L+K L+T+ L M NH 
Sbjct: 118 ATEATNSALPLNF-TEDALQSRLFKRFPPDLLKSLATEPLTMNNHR 162

Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 273

>gnl\|CDD\|219535 pfam07722, Peptidase_C26, Peptidase C26	Back alignment and domain information

>gnl\|CDD\|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		250
KOG1559		340	consensus Gamma-glutamyl hydrolase [Coenzyme trans	100.0
cd01747		273	GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot	100.0
PF07722		217	Peptidase_C26: Peptidase C26; InterPro: IPR011697	99.96
COG2071		243	Predicted glutamine amidotransferases [General fun	99.92
PRK11366		254	puuD gamma-glutamyl-gamma-aminobutyrate hydrolase;	99.88
COG0118		204	HisH Glutamine amidotransferase [Amino acid transp	99.84
PRK06895		190	putative anthranilate synthase component II; Provi	99.78
TIGR00888		188	guaA_Nterm GMP synthase (glutamine-hydrolyzing), N	99.78
COG0512		191	PabA Anthranilate/para-aminobenzoate synthases com	99.78
cd01745		189	GATase1_2 Subgroup of proteins having the Type 1 g	99.77
PRK08007		187	para-aminobenzoate synthase component II; Provisio	99.77
PRK12564		360	carbamoyl phosphate synthase small subunit; Review	99.77
PRK05637		208	anthranilate synthase component II; Provisional	99.77
PRK06774		191	para-aminobenzoate synthase component II; Provisio	99.76
TIGR01368		358	CPSaseIIsmall carbamoyl-phosphate synthase, small	99.76
cd01742		181	GATase1_GMP_Synthase Type 1 glutamine amidotransfe	99.76
PRK07765		214	para-aminobenzoate synthase component II; Provisio	99.76
TIGR00566		188	trpG_papA glutamine amidotransferase of anthranila	99.75
cd01743		184	GATase1_Anthranilate_Synthase Type 1 glutamine ami	99.75
PRK05670		189	anthranilate synthase component II; Provisional	99.75
PF00117		192	GATase: Glutamine amidotransferase class-I; InterP	99.75
cd01744		178	GATase1_CPSase Small chain of the glutamine-depend	99.74
PRK08857		193	para-aminobenzoate synthase component II; Provisio	99.74
PLN02335		222	anthranilate synthase	99.73
PRK07649		195	para-aminobenzoate/anthranilate synthase glutamine	99.72
PRK00758		184	GMP synthase subunit A; Validated	99.72
PRK13170		196	hisH imidazole glycerol phosphate synthase subunit	99.71
CHL00101		190	trpG anthranilate synthase component 2	99.71
cd01741		188	GATase1_1 Subgroup of proteins having the Type 1 g	99.7
PRK09065		237	glutamine amidotransferase; Provisional	99.7
PLN02347		536	GMP synthetase	99.7
PLN02771		415	carbamoyl-phosphate synthase (glutamine-hydrolyzin	99.69
COG0518		198	GuaA GMP synthase - Glutamine amidotransferase dom	99.69
COG0505		368	CarA Carbamoylphosphate synthase small subunit [Am	99.68
PRK07567		242	glutamine amidotransferase; Provisional	99.67
PRK12838		354	carbamoyl phosphate synthase small subunit; Review	99.67
PRK13152		201	hisH imidazole glycerol phosphate synthase subunit	99.67
PRK00074		511	guaA GMP synthase; Reviewed	99.66
CHL00197		382	carA carbamoyl-phosphate synthase arginine-specifi	99.66
PRK13566		720	anthranilate synthase; Provisional	99.65
CHL00188		210	hisH imidazole glycerol phosphate synthase subunit	99.65
PRK13146		209	hisH imidazole glycerol phosphate synthase subunit	99.64
TIGR01815		717	TrpE-clade3 anthranilate synthase, alpha proteobac	99.64
PRK07053		234	glutamine amidotransferase; Provisional	99.62
PRK13181		199	hisH imidazole glycerol phosphate synthase subunit	99.62
PRK14004		210	hisH imidazole glycerol phosphate synthase subunit	99.61
PRK06490		239	glutamine amidotransferase; Provisional	99.61
PRK13525		189	glutamine amidotransferase subunit PdxT; Provision	99.59
PRK08250		235	glutamine amidotransferase; Provisional	99.59
PRK13142		192	hisH imidazole glycerol phosphate synthase subunit	99.59
cd01748		198	GATase1_IGP_Synthase Type 1 glutamine amidotransfe	99.59
cd01746		235	GATase1_CTP_Synthase Type 1 glutamine amidotransfe	99.59
PRK05665		240	amidotransferase; Provisional	99.59
PRK14607		534	bifunctional glutamine amidotransferase/anthranila	99.57
PLN02889		918	oxo-acid-lyase/anthranilate synthase	99.55
PRK13527		200	glutamine amidotransferase subunit PdxT; Provision	99.53
PRK13141		205	hisH imidazole glycerol phosphate synthase subunit	99.52
PRK13143		200	hisH imidazole glycerol phosphate synthase subunit	99.5
PRK09522		531	bifunctional glutamine amidotransferase/anthranila	99.48
TIGR01855		196	IMP_synth_hisH imidazole glycerol phosphate syntha	99.45
PLN02832		248	glutamine amidotransferase subunit of pyridoxal 5'	99.45
TIGR01823		742	PabB-fungal aminodeoxychorismate synthase, fungal	99.4
KOG0026		223	consensus Anthranilate synthase, beta chain [Amino	99.4
TIGR00337		525	PyrG CTP synthase. CTP synthase is involved in pyr	99.39
cd01749		183	GATase1_PB Glutamine Amidotransferase (GATase_I) i	99.38
PLN02617		538	imidazole glycerol phosphate synthase hisHF	99.36
TIGR01737		227	FGAM_synth_I phosphoribosylformylglycinamidine syn	99.36
PRK06186		229	hypothetical protein; Validated	99.35
PRK05380		533	pyrG CTP synthetase; Validated	99.31
TIGR03800		184	PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl	99.27
KOG0370		1435	consensus Multifunctional pyrimidine synthesis pro	99.26
KOG1622		552	consensus GMP synthase [Nucleotide transport and m	99.25
KOG1224		767	consensus Para-aminobenzoate (PABA) synthase ABZ1	99.24
cd01740		238	GATase1_FGAR_AT Type 1 glutamine amidotransferase	99.2
PRK01175		261	phosphoribosylformylglycinamidine synthase I; Prov	99.18
PLN02327		557	CTP synthase	99.15
COG0047		231	PurL Phosphoribosylformylglycinamidine (FGAM) synt	99.14
KOG3179		245	consensus Predicted glutamine synthetase [Nucleoti	99.11
KOG0623		541	consensus Glutamine amidotransferase/cyclase [Amin	99.09
PRK13526		179	glutamine amidotransferase subunit PdxT; Provision	99.07
PRK05368		302	homoserine O-succinyltransferase; Provisional	99.02
PRK03619		219	phosphoribosylformylglycinamidine synthase I; Prov	98.97
COG0504		533	PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide	98.88
cd01750		194	GATase1_CobQ Type 1 glutamine amidotransferase (GA	98.8
cd03130		198	GATase1_CobB Type 1 glutamine amidotransferase (GA	98.76
PF13507		259	GATase_5: CobB/CobQ-like glutamine amidotransferas	98.69
COG0311		194	PDX2 Predicted glutamine amidotransferase involved	98.66
KOG2387		585	consensus CTP synthase (UTP-ammonia lyase) [Nucleo	98.64
PRK06278		476	cobyrinic acid a,c-diamide synthase; Validated	98.59
TIGR01857		1239	FGAM-synthase phosphoribosylformylglycinamidine sy	98.49
cd03131		175	GATase1_HTS Type 1 glutamine amidotransferase (GAT	98.48
PF01174		188	SNO: SNO glutamine amidotransferase family; InterP	98.37
cd03146		212	GAT1_Peptidase_E Type 1 glutamine amidotransferase	98.27
cd01653		115	GATase1 Type 1 glutamine amidotransferase (GATase1	98.26
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	98.23
PLN03206		1307	phosphoribosylformylglycinamidine synthase; Provis	98.23
TIGR01735		1310	FGAM_synt phosphoribosylformylglycinamidine syntha	98.19
PRK05297		1290	phosphoribosylformylglycinamidine synthase; Provis	98.17
PRK00784		488	cobyric acid synthase; Provisional	98.17
TIGR00379		449	cobB cobyrinic acid a,c-diamide synthase. This mod	98.08
cd03128		92	GAT_1 Type 1 glutamine amidotransferase (GATase1)-	97.99
PRK13896		433	cobyrinic acid a,c-diamide synthase; Provisional	97.89
KOG3210		226	consensus Imidazoleglycerol-phosphate synthase sub	97.87
PHA03366		1304	FGAM-synthase; Provisional	97.86
TIGR01739		1202	tegu_FGAM_synt herpesvirus tegument protein/v-FGAM	97.85
PF07685		158	GATase_3: CobB/CobQ-like glutamine amidotransferas	97.55
PF04204		298	HTS: Homoserine O-succinyltransferase ; InterPro:	97.52
PRK05282		233	(alpha)-aspartyl dipeptidase; Validated	97.48
cd03144		114	GATase1_ScBLP_like Type 1 glutamine amidotransfera	97.47
TIGR00313		475	cobQ cobyric acid synthase CobQ.	97.43
cd03133		213	GATase1_ES1 Type 1 glutamine amidotransferase (GAT	97.4
cd03169		180	GATase1_PfpI_1 Type 1 glutamine amidotransferase (	97.38
PRK11780		217	isoprenoid biosynthesis protein with amidotransfer	97.3
PRK04155		287	chaperone protein HchA; Provisional	97.27
TIGR01382		166	PfpI intracellular protease, PfpI family. The memb	97.25
TIGR01001		300	metA homoserine O-succinyltransferase. The apparen	97.08
cd03134		165	GATase1_PfpI_like A type 1 glutamine amidotransfer	97.04
cd03147		231	GATase1_Ydr533c_like Type 1 glutamine amidotransfe	97.04
cd03129		210	GAT1_Peptidase_E_like Type 1 glutamine amidotransf	96.99
cd03148		232	GATase1_EcHsp31_like Type 1 glutamine amidotransfe	96.82
cd03132		142	GATase1_catalase Type 1 glutamine amidotransferase	96.8
COG0693		188	ThiJ Putative intracellular protease/amidase [Gene	96.7
cd03137		187	GATase1_AraC_1 AraC transcriptional regulators hav	96.39
PRK11574		196	oxidative-stress-resistance chaperone; Provisional	96.32
PF01965		147	DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T	96.32
cd03140		170	GATase1_PfpI_3 Type 1 glutamine amidotransferase (	96.2
COG3442		250	Predicted glutamine amidotransferase [General func	96.1
cd03135		163	GATase1_DJ-1 Type 1 glutamine amidotransferase (GA	96.04
cd03139		183	GATase1_PfpI_2 Type 1 glutamine amidotransferase (	95.94
COG1492		486	CobQ Cobyric acid synthase [Coenzyme metabolism]	95.78
PRK11249		752	katE hydroperoxidase II; Provisional	95.54
PF03575		154	Peptidase_S51: Peptidase family S51; InterPro: IPR	95.48
COG1897		307	MetA Homoserine trans-succinylase [Amino acid tran	95.34
cd03141		221	GATase1_Hsp31_like Type 1 glutamine amidotransfera	95.29
cd03138		195	GATase1_AraC_2 AraC transcriptional regulators hav	95.15
TIGR02069		250	cyanophycinase cyanophycinase. This model describe	95.14
COG1797		451	CobB Cobyrinic acid a,c-diamide synthase [Coenzyme	95.08
KOG2764		247	consensus Putative transcriptional regulator DJ-1	94.88
cd03145		217	GAT1_cyanophycinase Type 1 glutamine amidotransfer	94.78
cd03136		185	GATase1_AraC_ArgR_like AraC transcriptional regula	94.03
TIGR01383		179	not_thiJ DJ-1 family protein. This model represent	93.89
PRK09393		322	ftrA transcriptional activator FtrA; Provisional	93.53
COG3340		224	PepE Peptidase E [Amino acid transport and metabol	93.0
KOG1907		1320	consensus Phosphoribosylformylglycinamidine syntha	92.84
PF13278		166	DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M	92.38
PRK03372		306	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	92.13
PRK01911		292	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	91.31
PRK03378		292	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	91.09
PRK02649		305	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	90.78
PRK04539		296	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	90.35
PRK02155		291	ppnK NAD(+)/NADH kinase family protein; Provisiona	88.15
PRK14077		287	pnk inorganic polyphosphate/ATP-NAD kinase; Provis	87.37
PRK01231		295	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	86.95
PF09825		367	BPL_N: Biotin-protein ligase, N terminal; InterPro	86.12
PF06283		217	ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A.	85.72
PRK01215		264	competence damage-inducible protein A; Provisional	84.51
COG0303		404	MoeA Molybdopterin biosynthesis enzyme [Coenzyme m	83.84
PLN02935		508	Bifunctional NADH kinase/NAD(+) kinase	83.81
TIGR02667		163	moaB_proteo molybdenum cofactor biosynthesis prote	83.7
PRK03708		277	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	83.14
COG0655		207	WrbA Multimeric flavodoxin WrbA [General function	82.22
COG4090		154	Uncharacterized protein conserved in archaea [Func	82.16

>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=3.8e-51  Score=352.64  Aligned_cols=242  Identities=58%  Similarity=0.997  Sum_probs=220.1

Q ss_pred             CCccchHHHHHhhhccchhhhhhcccccchhhhhhccccccccccccccCCCCCCCCCCCcEEEEeCCCCCCCCCCCCCC
Q 025574            1 MWGYLWIPILFSLSKEFSSVEAQSKILLPSQRQRQQNDAVSSLSVLVPRCPVPDSKLNYRPVIGIVTHPGDGASGRLNNA   80 (250)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PvIGI~~~~~~~~~~~~~~~   80 (250)
                      ||++++++.|.++.....+......|+||+|.+.+.|        +++.|.+|+|++++||||||+++|+++.++|+.++
T Consensus         1 m~~~~~~~~l~~~~~S~~~~~~~~~ilLps~~g~e~S--------RspvcsapdpnlnykPvIGIL~hpg~g~~~rl~n~   72 (340)
T KOG1559|consen    1 MWRFLFFLSLLFFMASPGALLCAESILLPSQAGFELS--------RSPVCSAPDPNLNYKPVIGILSHPGDGASGRLKNA   72 (340)
T ss_pred             CcchHHHHHHHHhccChHHHHHHhheecccccccccc--------cCccccCCCCCcccCceeEEeccCCCCccceeccc
Confidence            8886665555544344457778899999999998755        68999999999999999999999999999999888


Q ss_pred             CcchhhHHHHHHHHHHcCCeEEEeecCCChhhHHHhcccCCEEEECCCCCCCccchHHHHHHHHHHHHhCCCCCCceEEc
Q 025574           81 TNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYA  160 (250)
Q Consensus        81 ~~~~~i~~s~v~~le~~G~~~v~i~~~~~~~~l~~~l~~~dgvIlpGG~~~~~~~~~~~~~li~~~~~~~~~g~~~PILG  160 (250)
                      ..++||++||||.+|..||||+|+.++++++.+..+++.+||||+|||+.....|++..+.+++++++++|+|+|+||+|
T Consensus        73 t~~~yIAASYVK~aEsgGARViPli~nepEe~lfqklelvNGviftGGwak~~dY~~vvkkifnk~le~nDaGehFPvyg  152 (340)
T KOG1559|consen   73 TGRSYIAASYVKLAESGGARVIPLIYNEPEEILFQKLELVNGVIFTGGWAKRGDYFEVVKKIFNKVLERNDAGEHFPVYG  152 (340)
T ss_pred             cCcchhHHHHHHHHHcCCceEEEEecCCcHHHHHHHHHHhceeEecCcccccccHHHHHHHHHHHHHhccCCccccchhh
Confidence            99999999999999999999999999999999999999999999999999888999999999999999999999999999


Q ss_pred             ccchhHHHHHHhcCcccccccccCCCceeeeeeeecCCCCCcccccCChhhhhhcCCccceeeeecccccc---------
Q 025574          161 HCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHVRPCT---------  231 (250)
Q Consensus       161 IClG~QlL~~~~GG~~~~l~~~~~~~~~~pi~~~~~~~~~s~Lf~~lp~~~~~~l~~~~~v~~~Hs~~V~~---------  231 (250)
                      ||+||++|.++..-..++++.++..+..++++|+.++..++++|+++|+++++.|+.+++++++|.|+++|         
T Consensus       153 ~CLGFE~lsmiISqnrdile~~d~vd~AssLqF~~nvn~~~t~FQrFPpELLkkL~~dcLvmq~Hk~gisp~nF~~N~~L  232 (340)
T KOG1559|consen  153 ICLGFELLSMIISQNRDILERFDAVDVASSLQFVGNVNIHGTMFQRFPPELLKKLSTDCLVMQNHKFGISPKNFQGNPAL  232 (340)
T ss_pred             hhhhHHHHHHHHhcChhHHHhhcccccccceeeecccceeehhHhhCCHHHHHHhccchheeeccccccchhhccCCHHH
Confidence            99999999999874346899999989999999988777689999999999999999999999999999998         


Q ss_pred             ---ceEEEEeecCCCeEEEeeC
Q 025574          232 ---INLLSTSVARFNCLKILKL  250 (250)
Q Consensus       232 ---f~vlA~s~D~~g~~Fvs~~  250 (250)
                         |+|++|+.|.++.+|||.+
T Consensus       233 s~FFnilTT~~D~~~k~fvSTv  254 (340)
T KOG1559|consen  233 SSFFNILTTCTDGNSKTFVSTV  254 (340)
T ss_pred             HHHHhheeeecCCCceEEEEee
Confidence               8999999998899999974

>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase	Back alignment and domain information

>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG2071 Predicted glutamine amidotransferases [General function prediction only]	Back alignment and domain information

>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional	Back alignment and domain information

>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06895 putative anthranilate synthase component II; Provisional	Back alignment and domain information

>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit	Back alignment and domain information

>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

>PRK08007 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>PRK05637 anthranilate synthase component II; Provisional	Back alignment and domain information

>PRK06774 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit	Back alignment and domain information

>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase	Back alignment and domain information

>PRK07765 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase	Back alignment and domain information

>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase	Back alignment and domain information

>PRK05670 anthranilate synthase component II; Provisional	Back alignment and domain information

>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group []	Back alignment and domain information

>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II	Back alignment and domain information

>PRK08857 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>PLN02335 anthranilate synthase	Back alignment and domain information

>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated	Back alignment and domain information

>PRK00758 GMP synthase subunit A; Validated	Back alignment and domain information

>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>CHL00101 trpG anthranilate synthase component 2	Back alignment and domain information

>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

>PRK09065 glutamine amidotransferase; Provisional	Back alignment and domain information

>PLN02347 GMP synthetase	Back alignment and domain information

>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing)	Back alignment and domain information

>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]	Back alignment and domain information

>PRK07567 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK00074 guaA GMP synthase; Reviewed	Back alignment and domain information

>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional	Back alignment and domain information

>PRK13566 anthranilate synthase; Provisional	Back alignment and domain information

>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional	Back alignment and domain information

>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade	Back alignment and domain information

>PRK07053 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK06490 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK13525 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>PRK08250 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS)	Back alignment and domain information

>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase	Back alignment and domain information

>PRK05665 amidotransferase; Provisional	Back alignment and domain information

>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>PLN02889 oxo-acid-lyase/anthranilate synthase	Back alignment and domain information

>PRK13527 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit	Back alignment and domain information

>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex	Back alignment and domain information

>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade	Back alignment and domain information

>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00337 PyrG CTP synthase	Back alignment and domain information

>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I	Back alignment and domain information

>PRK06186 hypothetical protein; Validated	Back alignment and domain information

>PRK05380 pyrG CTP synthetase; Validated	Back alignment and domain information

>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2	Back alignment and domain information

>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]	Back alignment and domain information

>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase	Back alignment and domain information

>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

>PLN02327 CTP synthase	Back alignment and domain information

>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13526 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>PRK05368 homoserine O-succinyltransferase; Provisional	Back alignment and domain information

>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]	Back alignment and domain information

>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ)	Back alignment and domain information

>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase	Back alignment and domain information

>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A	Back alignment and domain information

>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK06278 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II	Back alignment and domain information

>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS)	Back alignment and domain information

>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ]	Back alignment and domain information

>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E	Back alignment and domain information

>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>PRK00784 cobyric acid synthase; Provisional	Back alignment and domain information

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase	Back alignment and domain information

>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional	Back alignment and domain information

>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism]	Back alignment and domain information

>PHA03366 FGAM-synthase; Provisional	Back alignment and domain information

>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase	Back alignment and domain information

>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea []	Back alignment and domain information

>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi	Back alignment and domain information

>PRK05282 (alpha)-aspartyl dipeptidase; Validated	Back alignment and domain information

>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP)	Back alignment and domain information

>TIGR00313 cobQ cobyric acid synthase CobQ	Back alignment and domain information

>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1	Back alignment and domain information

>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional	Back alignment and domain information

>PRK04155 chaperone protein HchA; Provisional	Back alignment and domain information

>TIGR01382 PfpI intracellular protease, PfpI family	Back alignment and domain information

>TIGR01001 metA homoserine O-succinyltransferase	Back alignment and domain information

>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus	Back alignment and domain information

>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein	Back alignment and domain information

>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins	Back alignment and domain information

>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31)	Back alignment and domain information

>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases	Back alignment and domain information

>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only]	Back alignment and domain information

>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK11574 oxidative-stress-resistance chaperone; Provisional	Back alignment and domain information

>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity	Back alignment and domain information

>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>COG3442 Predicted glutamine amidotransferase [General function prediction only]	Back alignment and domain information

>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1	Back alignment and domain information

>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK11249 katE hydroperoxidase II; Provisional	Back alignment and domain information

>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism]	Back alignment and domain information

>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein	Back alignment and domain information

>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>TIGR02069 cyanophycinase cyanophycinase	Back alignment and domain information

>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]	Back alignment and domain information

>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms]	Back alignment and domain information

>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase	Back alignment and domain information

>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>TIGR01383 not_thiJ DJ-1 family protein	Back alignment and domain information

>PRK09393 ftrA transcriptional activator FtrA; Provisional	Back alignment and domain information

>COG3340 PepE Peptidase E [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C	Back alignment and domain information

>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional	Back alignment and domain information

>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown	Back alignment and domain information

>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A	Back alignment and domain information

>PRK01215 competence damage-inducible protein A; Provisional	Back alignment and domain information

>COG0303 MoeA Molybdopterin biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PLN02935 Bifunctional NADH kinase/NAD(+) kinase	Back alignment and domain information

>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial	Back alignment and domain information

>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only]	Back alignment and domain information

>COG4090 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		250
1l9x_A		315	Structure Of Gamma-Glutamyl Hydrolase Length = 315		4e-18

>pdb|1L9X|A Chain A, Structure Of Gamma-Glutamyl Hydrolase Length = 315

Back alignment and structure

Iteration: 1

Score = 88.2 bits (217), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 64/187 (34%), Positives = 100/187 (53%), Gaps = 15/187 (8%) Query: 46 LVPRCP--VPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIP 103 LVPR P +P+IGI+ ++ YIAASYVK++ESAGARV+P Sbjct: 14 LVPRGSHMRPHGDTAKKPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAGARVVP 70 Query: 104 LIYNEPE---DVLFEKLELVNGVLYTGGWAK-DGLYYAIVEKVFKKI-LEKNDAGDHFPL 158 + + E ++LF+ +NG+L+ GG YA V K+F + ++ D GD+FP+ Sbjct: 71 VRLDLTEKDYEILFKS---INGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPV 127 Query: 159 YAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTD 218 + CLGFE L+++IS + +L + + D A L F + +FQ FP +L+ L+ + Sbjct: 128 WGTCLGFEELSLLISGE-CLLTATDTVDVAMPLNFT-GGQLHSRMFQNFPTELLLSLAVE 185 Query: 219 CLVMQNH 225 L H Sbjct: 186 PLTANFH 192

PyMOL of 1l9x

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		250
1l9x_A		315	Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO	4e-42
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-09
3fij_A		254	LIN1909 protein; 11172J, uncharacterized protein,	8e-07

>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315	Back alignment and structure

 Score =  145 bits (366), Expect = 4e-42
 Identities = 57/188 (30%), Positives = 93/188 (49%), Gaps = 7/188 (3%)

Query: 41  SSLSVLVPRCPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGAR 100
           SS  V       P      +P+IGI+         ++       YIAASYVK++ESAGAR
Sbjct: 11  SSGLVPRGSHMRPHGDTAKKPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAGAR 67

Query: 101 VIPLIYNEPEDVLFEKLELVNGVLYTGGWA--KDGLYYAIVEKVFKKILEKNDAGDHFPL 158
           V+P+  +  E       + +NG+L+ GG    +   Y  + +  +   ++  D GD+FP+
Sbjct: 68  VVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPV 127

Query: 159 YAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTD 218
           +  CLGFE L+++IS  + +L + +  D A  L F     +   +FQ FP +L+  L+ +
Sbjct: 128 WGTCLGFEELSLLIS-GECLLTATDTVDVAMPLNFTGG-QLHSRMFQNFPTELLLSLAVE 185

Query: 219 CLVMQNHH 226
            L    H 
Sbjct: 186 PLTANFHK 193

PyMOL of 1l9x

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		250
1l9x_A		315	Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO	99.96
3fij_A		254	LIN1909 protein; 11172J, uncharacterized protein,	99.92
2vpi_A		218	GMP synthase; guanine monophosphate synthetase, ph	99.79
2a9v_A		212	GMP synthase; structural genomics, joint center fo	99.77
4gud_A		211	Imidazole glycerol phosphate synthase subunit His;	99.76
1i1q_B		192	Anthranilate synthase component II; tryptophan bio	99.75
1qdl_B		195	Protein (anthranilate synthase (TRPG-SUBUNIT)); tr	99.75
1wl8_A		189	GMP synthase [glutamine-hydrolyzing] subunit A; tr	99.75
1gpm_A		525	GMP synthetase, XMP aminase; class I glutamine ami	99.74
1o1y_A		239	Conserved hypothetical protein TM1158; flavodoxin-	99.74
3tqi_A		527	GMP synthase [glutamine-hydrolyzing]; ligase; 2.84	99.73
3m3p_A		250	Glutamine amido transferase; structural genomics,	99.73
1a9x_B		379	Carbamoyl phosphate synthetase (small chain); amid	99.72
3l7n_A		236	Putative uncharacterized protein; glutamine amidot	99.72
2ywb_A		503	GMP synthase [glutamine-hydrolyzing]; GMP syntheta	99.69
3uow_A		556	GMP synthetase; structural genomics consortium, SG	99.68
2w7t_A		273	CTP synthetase, putative cytidine triphosphate syn	99.68
3d54_D		213	Phosphoribosylformylglycinamidine synthase 1; alph	99.65
2vxo_A		697	GMP synthase [glutamine-hydrolyzing]; proto-oncoge	99.65
2ywd_A		191	Glutamine amidotransferase subunit PDXT; pyridoxin	99.64
1gpw_B		201	Amidotransferase HISH; lyase/transferase, complex	99.64
1ka9_H		200	Imidazole glycerol phosphtate synthase; riken stru	99.61
2ywj_A		186	Glutamine amidotransferase subunit PDXT; uncharact	99.61
1q7r_A		219	Predicted amidotransferase; structural genomics, Y	99.52
3r75_A		645	Anthranilate/para-aminobenzoate synthases compone;	99.51
1jvn_A		555	Glutamine, bifunctional histidine biosynthesis pro	99.49
1vco_A		550	CTP synthetase; tetramer, riken structural genomic	99.48
2v4u_A		289	CTP synthase 2; pyrimidine biosynthesis, glutamine	99.45
2iss_D		208	Glutamine amidotransferase subunit PDXT; (beta/alp	99.43
2nv0_A		196	Glutamine amidotransferase subunit PDXT; 3-layer(A	99.43
2abw_A		227	PDX2 protein, glutaminase; PLP-synthase, vitamin B	99.35
1s1m_A		545	CTP synthase; CTP synthetase, UTP:ammonia ligase (	99.34
3nva_A		535	CTP synthase; rossman fold, nucleotide binding, LI	99.31
2vdj_A		301	Homoserine O-succinyltransferase; methionine biosy	99.23
2h2w_A		312	Homoserine O-succinyltransferase; TM0881, (EC 2.3.	99.15
3ugj_A		1303	Phosphoribosylformylglycinamidine synthase; amidot	98.88
3l4e_A		206	Uncharacterized peptidase LMO0363; hypothetical pr	98.62
1fy2_A		229	Aspartyl dipeptidase; serine protease, catalytic t	98.6
1oi4_A		193	Hypothetical protein YHBO; PFPI/THIJ family, compl	98.06
3l18_A		168	Intracellular protease I; gatase1_PFPI_LIKE, hydro	97.49
2rk3_A		197	Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha	97.44
4hcj_A		177	THIJ/PFPI domain protein; structural genomics, PSI	97.38
2vrn_A		190	Protease I, DR1199; cysteine sulfenic acid, DJ-1/T	97.37
1vhq_A		232	Enhancing lycopene biosynthesis protein 2; structu	97.26
4e08_A		190	DJ-1 beta; flavodoxin-like fold, stress response,	97.16
3efe_A		212	THIJ/PFPI family protein; structural GEN csgid, ce	97.14
2ab0_A		205	YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase	97.08
3f5d_A		206	Protein YDEA; unknow protein, PSI-II, nysgrc, stru	96.94
2fex_A		188	Conserved hypothetical protein; structural genomic	96.92
3ttv_A		753	Catalase HPII; heme orientation, oxidoreductase; H	96.89
3l3b_A		242	ES1 family protein; ssgcid, NIH, niaid, SBRI, UW,	96.89
3ej6_A		688	Catalase-3; heme, hydrogen iron, metal-binding, ox	96.88
3uk7_A		396	Class I glutamine amidotransferase-like domain-CO	96.6
3cne_A		175	Putative protease I; structural genomics, PSI-2, M	96.5
3uk7_A		396	Class I glutamine amidotransferase-like domain-CO	96.39
2iuf_A		688	Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen	96.39
3ot1_A		208	4-methyl-5(B-hydroxyethyl)-thiazole monophosphate	96.26
3gra_A		202	Transcriptional regulator, ARAC family; transcript	96.01
3kkl_A		244	Probable chaperone protein HSP33; peptidase, heat	95.97
3fse_A		365	Two-domain protein containing DJ-1/THIJ/PFPI-like	95.92
1n57_A		291	Chaperone HSP31, protein YEDU; alpha-beta sandwich	95.88
3er6_A		209	Putative transcriptional regulator protein; struct	95.85
3noq_A		231	THIJ/PFPI family protein; DJ-1 superfamily, isocya	95.83
3en0_A		291	Cyanophycinase; serine protease, beta peptide spec	95.81
1sy7_A		715	Catalase 1; heme oxidation, singlet oxygen, oxidor	95.74
3ewn_A		253	THIJ/PFPI family protein; monomer, PSI nysgrc, str	95.63
3mgk_A		211	Intracellular protease/amidase related enzyme (THI	95.51
1u9c_A		224	APC35852; structural genomics, protein structure i	95.3
1rw7_A		243	YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe	94.7
3n7t_A		247	Macrophage binding protein; seattle structural gen	94.55
4gdh_A		194	DJ-1, uncharacterized protein C22E12.03C; unknown	92.31
3bhn_A		236	THIJ/PFPI domain protein; structural genomics, joi	89.01
3h75_A		350	Periplasmic sugar-binding domain protein; protein	87.64
3pzy_A		164	MOG; ssgcid, seattle structural genomics center fo	87.1
2an1_A		292	Putative kinase; structural genomics, PSI, protein	84.83
1di6_A		195	MOGA, molybdenum cofactor biosynthetic enzyme; MOC	82.61
3l6u_A		293	ABC-type sugar transport system periplasmic compo;	82.24
3uug_A		330	Multiple sugar-binding periplasmic receptor CHVE;	82.09
3l49_A		291	ABC sugar (ribose) transporter, periplasmic substr	81.83
3m9w_A		313	D-xylose-binding periplasmic protein; xylose bindi	81.67
1u0t_A		307	Inorganic polyphosphate/ATP-NAD kinase; alpha-beta	81.39
3tb6_A		298	Arabinose metabolism transcriptional repressor; tr	81.38
3kbq_A		172	Protein TA0487; structural genomics, CINA, protein	81.02
1y5e_A		169	Molybdenum cofactor biosynthesis protein B; struct	80.1
3rfq_A		185	Pterin-4-alpha-carbinolamine dehydratase MOAB2; st	80.06

>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1	Back alignment and structure

Probab=99.96  E-value=4e-29  Score=226.93  Aligned_cols=202  Identities=30%  Similarity=0.451  Sum_probs=138.0

Q ss_pred             ccccccccCCCCCCCCCCCcEEEEeCCCCCCCCCCCCCCCcchhhHHHHHHHHHHcCCeEEEeecCCChhhHHHhcccCC
Q 025574           42 SLSVLVPRCPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVN  121 (250)
Q Consensus        42 ~~~~~~~~~~~~~~~~~~~PvIGI~~~~~~~~~~~~~~~~~~~~i~~s~v~~le~~G~~~v~i~~~~~~~~l~~~l~~~d  121 (250)
                      |-++.--||-.+.+..+.||+|||++.......   ......+|+.++|+++|+++|+++++++++.+.+.+...++.+|
T Consensus        12 ~~~~~~~~~m~~~~~~~~~P~IGI~~~~~~~~~---~~~~~~~~~~~~~~~~l~~~G~~~~vv~~~~~~~~i~~~l~~~d   88 (315)
T 1l9x_A           12 SGLVPRGSHMRPHGDTAKKPIIGILMQKCRNKV---MKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSIN   88 (315)
T ss_dssp             ----------------CCCCEEEEECEECCSHH---HHTTCSEEEEHHHHHHHHHTTCEEEEECSSCCHHHHHHHHHHSS
T ss_pred             cCcccCccccCCCcccCCCCEEEEECCcccccc---cccCcceehHHHHHHHHHHCCCEEEEEecCCCHHHHHHHHhcCC
Confidence            455566678888888899999999998653210   01124678899999999999999999998776777777678899


Q ss_pred             EEEECCCC-CCCccchH-HHHHHHHHHHHhCCCCCCceEEcccchhHHHHHHhcCcccccccccCCCceeeeeeeecCCC
Q 025574          122 GVLYTGGW-AKDGLYYA-IVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSI  199 (250)
Q Consensus       122 gvIlpGG~-~~~~~~~~-~~~~li~~~~~~~~~g~~~PILGIClG~QlL~~~~GG~~~~l~~~~~~~~~~pi~~~~~~~~  199 (250)
                      |||||||+ +.++..+. ....+++.+++..++|+.+||||||+|||+|+.++||++ .+..+..++...|++...... 
T Consensus        89 glil~GG~~~v~p~~~~~~~~~l~~~~~~~~~~g~~~PiLGIC~G~Qll~~a~GG~~-~~~~~~~~g~~~p~~~~~~~~-  166 (315)
T 1l9x_A           89 GILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISGEC-LLTATDTVDVAMPLNFTGGQL-  166 (315)
T ss_dssp             EEEECCCCCCTTTCHHHHHHHHHHHHHHHHHHTTCCCCEEEETHHHHHHHHHHHSSC-CCEEEEEEEEEECCEECSTTT-
T ss_pred             EEEEeCCCcccChhhhhHHHHHHHHHHHHHHhcCCCceEEEEChHHHHHHHHhCCcc-ccccccccCCCCCeeeccCCC-
Confidence            99999997 55555343 334677777776434444999999999999999999983 233333333345665543323 


Q ss_pred             CCcccccCChhhhhhcCCccceeeeeccccc--------c----ceEEEEeecCCCeEEEee
Q 025574          200 EGTVFQRFPPKLIKKLSTDCLVMQNHHVRPC--------T----INLLSTSVARFNCLKILK  249 (250)
Q Consensus       200 ~s~Lf~~lp~~~~~~l~~~~~v~~~Hs~~V~--------~----f~vlA~s~D~~g~~Fvs~  249 (250)
                      .++||+.+|+.+...++++..++++|+|+|.        .    ++++|++.| +..+++++
T Consensus       167 ~s~L~~~~~~~~~~~l~~~~~~~~~H~~~V~~~~~~~~~~l~~g~~v~A~s~d-g~ve~i~~  227 (315)
T 1l9x_A          167 HSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKKFFNVLTTNTD-GKIEFIST  227 (315)
T ss_dssp             TCSTTTTSCHHHHHHHHHSCCEEEEEEEECBHHHHHTCHHHHHHEEEEEEEES-SSCEEEEE
T ss_pred             CChHHHhcChhhhhhccccceEEEhhhhhcCccccccccccCCCCEEEEEcCC-CCEEEEEE
Confidence            6889999999887767667778889999997        3    899999965 56788764

PyMOL of 1l9x

>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua}	Back alignment and structure

>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens}	Back alignment and structure

>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1	Back alignment and structure

>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae}	Back alignment and structure

>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B*	Back alignment and structure

>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1	Back alignment and structure

>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A	Back alignment and structure

>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1	Back alignment and structure

>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1	Back alignment and structure

>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii}	Back alignment and structure

>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A*	Back alignment and structure

>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B*	Back alignment and structure

>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans}	Back alignment and structure

>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A*	Back alignment and structure

>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum}	Back alignment and structure

>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei}	Back alignment and structure

>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima}	Back alignment and structure

>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens}	Back alignment and structure

>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B	Back alignment and structure

>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1	Back alignment and structure

>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii}	Back alignment and structure

>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1	Back alignment and structure

>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A*	Back alignment and structure

>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A	Back alignment and structure

>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A	Back alignment and structure

>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A	Back alignment and structure

>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima}	Back alignment and structure

>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B*	Back alignment and structure

>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G	Back alignment and structure

>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A*	Back alignment and structure

>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A	Back alignment and structure

>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima}	Back alignment and structure

>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A*	Back alignment and structure

>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A	Back alignment and structure

>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2	Back alignment and structure

>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A	Back alignment and structure

>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ...	Back alignment and structure

>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii}	Back alignment and structure

>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans}	Back alignment and structure

>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A	Back alignment and structure

>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster}	Back alignment and structure

>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis}	Back alignment and structure

>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2	Back alignment and structure

>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis}	Back alignment and structure

>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2	Back alignment and structure

>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ...	Back alignment and structure

>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa}	Back alignment and structure

>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana}	Back alignment and structure

>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana}	Back alignment and structure

>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A*	Back alignment and structure

>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0	Back alignment and structure

>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida}	Back alignment and structure

>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A*	Back alignment and structure

>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A	Back alignment and structure

>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus}	Back alignment and structure

>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A	Back alignment and structure

>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP}	Back alignment and structure

>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3	Back alignment and structure

>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV}	Back alignment and structure

>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2	Back alignment and structure

>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A	Back alignment and structure

>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0	Back alignment and structure

>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A	Back alignment and structure

>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4}	Back alignment and structure

>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5}	Back alignment and structure

>3pzy_A MOG; ssgcid, seattle structural genomics center for infectious DI biosynthetic protein; 1.80A {Mycobacterium avium subsp} PDB: 3oi9_A 2g4r_A	Back alignment and structure

>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium}	Back alignment and structure

>1di6_A MOGA, molybdenum cofactor biosynthetic enzyme; MOCO, MOCO biosynthesis, gephyrin function; 1.45A {Escherichia coli} SCOP: c.57.1.1 PDB: 1di7_A	Back alignment and structure

>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum}	Back alignment and structure

>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A*	Back alignment and structure

>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides}	Back alignment and structure

>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A*	Back alignment and structure

>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A	Back alignment and structure

>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis}	Back alignment and structure

>3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum}	Back alignment and structure

>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1	Back alignment and structure

>3rfq_A Pterin-4-alpha-carbinolamine dehydratase MOAB2; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: B3P; 2.25A {Mycobacterium marinum} PDB: 3tcr_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		250
d1l9xa_		288	c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho	3e-23

>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 93.4 bits (231), Expect = 3e-23
 Identities = 53/169 (31%), Positives = 89/169 (52%), Gaps = 7/169 (4%)

Query: 60  RPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLEL 119
           +P+IGI+         ++       YIAASYVK++ESAGARV+P+  +  E       + 
Sbjct: 3   KPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKS 59

Query: 120 VNGVLYTGGWA--KDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKN 177
           +NG+L+ GG    +   Y  + +  +   ++  D GD+FP++  CLGFE L+++IS  + 
Sbjct: 60  INGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISG-EC 118

Query: 178 ILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHH 226
           +L + +  D A  L F     +   +FQ FP +L+  L+ + L    H 
Sbjct: 119 LLTATDTVDVAMPLNFT-GGQLHSRMFQNFPTELLLSLAVEPLTANFHK 166

PyMOL of d1l9xa_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		250
d1l9xa_		288	gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta	100.0
d2a9va1		196	GMP synthase subunit A, GuaAA {Archaeon Thermoplas	99.79
d1wl8a1		188	GMP synthase subunit A, GuaAA {Archaeon Pyrococcus	99.77
d1a9xb2		228	Carbamoyl phosphate synthetase, small subunit C-te	99.75
d1qdlb_		195	Anthranilate synthase GAT subunit, TrpG {Archaeon	99.72
d1o1ya_		230	Hypothetical protein TM1158 {Thermotoga maritima [	99.7
d1i7qb_		192	Anthranilate synthase GAT subunit, TrpG {Serratia	99.67
d2nv0a1		195	Hypothetical protein YaaE {Bacillus subtilis [TaxI	99.65
d1jvna2		232	GAT subunit, HisH, (or domain) of imidazoleglycero	99.64
d1gpma2		205	GMP synthetase {Escherichia coli [TaxId: 562]}	99.61
d2abwa1		218	Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p	99.59
d1q7ra_		202	Hypothetical protein YaaE {Bacillus stearothermoph	99.54
d1k9vf_		200	GAT subunit, HisH, (or domain) of imidazoleglycero	99.51
d1ka9h_		195	GAT subunit, HisH, (or domain) of imidazoleglycero	99.37
d1s1ma1		258	CTP synthase PyrG, C-terminal domain {Escherichia	99.25
d1vcoa1		250	CTP synthase PyrG, C-terminal domain {Thermus ther	99.25
d2ghra1		281	Homoserine O-succinyltransferase HTS (MetA) {Bacil	99.03
d1t3ta2		262	FGAM synthase PurL, amidotransferase domain {Salmo	98.96
d1p80a1		156	Catalase, C-terminal domain {Escherichia coli, HPI	97.64
d1vhqa_		217	Putative sigma cross-reacting protein 27A (SCRP-27	97.39
d1oi4a1		170	Hypothetical protein YhbO {Escherichia coli [TaxId	97.3
d1sy7a1		184	Catalase, C-terminal domain {Neurospora crassa [Ta	97.17
d1p5fa_		186	DJ-1 {Human (Homo sapiens) [TaxId: 9606]}	97.09
d1g2ia_		166	Intracellular protease {Archaeon Pyrococcus horiko	97.03
d1u9ca_		221	GK2698 ortholog {Bacillus stearothermophilus [TaxI	96.81
d2fexa1		188	Hypothetical protein Atu0886 {Agrobacterium tumefa	96.62
d1qvwa_		236	Hypothetical protein Ydr533Cp {Baker's yeast (Sacc	96.27
d2ab0a1		195	Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]	96.11
d1n57a_		279	HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]}	93.81
d1fyea_		229	Aspartyl dipeptidase PepE {Salmonella typhimurium	91.58
d1jyea_		271	Lac-repressor (lacR) core (C-terminal domain) {Esc	89.18
d2ftsa3		155	Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId	89.0
d2jfga1		93	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase	87.96
d1u0ta_		302	Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob	87.43
d1uz5a3		148	MoeA, central domain {Archaeon Pyrococcus horikosh	87.11
d1wu2a3		144	MoeA, central domain {Pyrococcus horikoshii, PH164	84.11
d2nqra3		149	MoeA, central domain {Escherichia coli [TaxId: 562	83.17
d1a9xa4		121	Carbamoyl phosphate synthetase (CPS), large subuni	82.68
d1e5da1		152	Rubredoxin oxygen:oxidoreductase (ROO), C-terminal	80.43
d1t0ba_		240	GK2113 homologue {Bacillus stearothermophilus [Tax	80.01

>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-34  Score=257.09  Aligned_cols=186  Identities=31%  Similarity=0.497  Sum_probs=151.0

Q ss_pred             CCcEEEEeCCCCCCCCCCCCCCCcchhhHHHHHHHHHHcCCeEEEeecCCChhhHHHhcccCCEEEECCCCC-CCc-cch
Q 025574           59 YRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPEDVLFEKLELVNGVLYTGGWA-KDG-LYY  136 (250)
Q Consensus        59 ~~PvIGI~~~~~~~~~~~~~~~~~~~~i~~s~v~~le~~G~~~v~i~~~~~~~~l~~~l~~~dgvIlpGG~~-~~~-~~~  136 (250)
                      .||||||++++.....   ......+||+++|+++++++|++|++++++.+.++++..++++||||||||+. .++ .|.
T Consensus         2 ~kPiIGI~~~~~~~~~---~~~~~~~yi~~sYvk~ie~aGa~vvpi~~~~~~~~~~~~l~~idGillpGG~~~~~~~~~~   78 (288)
T d1l9xa_           2 KKPIIGILMQKCRNKV---MKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYA   78 (288)
T ss_dssp             CCCEEEEECEECCSHH---HHTTCSEEEEHHHHHHHHHTTCEEEEECSSCCHHHHHHHHHHSSEEEECCCCCCTTTCHHH
T ss_pred             CCCEEEEeCCcccCcc---cccchHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHhhcCCeEecCCCCCccccccc
Confidence            6899999998765321   23456789999999999999999999999999999999999999999999985 344 344


Q ss_pred             HHHHHHHHHHHHhCCCCCCceEEcccchhHHHHHHhcCcccccccccCCCceeeeeeeecCCCCCcccccCChhhhhhcC
Q 025574          137 AIVEKVFKKILEKNDAGDHFPLYAHCLGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLS  216 (250)
Q Consensus       137 ~~~~~li~~~~~~~~~g~~~PILGIClG~QlL~~~~GG~~~~l~~~~~~~~~~pi~~~~~~~~~s~Lf~~lp~~~~~~l~  216 (250)
                      +..+.+++.++++++.++++||||||+|||+|+.++||+. ........+...++++..... .+.+|..+|..+...+.
T Consensus        79 ~~~r~~~~~~l~~~~~~~~~PilGIC~G~Qll~~~~gG~~-~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~  156 (288)
T d1l9xa_          79 KVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISGEC-LLTATDTVDVAMPLNFTGGQL-HSRMFQNFPTELLLSLA  156 (288)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCEEEETHHHHHHHHHHHSSC-CCEEEEEEEEEECCEECSTTT-TCSTTTTSCHHHHHHHH
T ss_pred             ccchHHHHHHHHHHHhhCCCCeEEEcHHHHHHHHHhCCEe-eccccCcCCcceeEEecCCCc-cceeEeecccchhhhcc
Confidence            4556888888888888999999999999999999999973 233333344455666655433 67899999999999999


Q ss_pred             Cccceeeeecccccc------------ceEEEEeecCCCeEEEeeC
Q 025574          217 TDCLVMQNHHVRPCT------------INLLSTSVARFNCLKILKL  250 (250)
Q Consensus       217 ~~~~v~~~Hs~~V~~------------f~vlA~s~D~~g~~Fvs~~  250 (250)
                      ++..++++|+++|++            |+++|++.| ++.+||+++
T Consensus       157 ~~~~~~~~H~~~v~~~~~~~~~~l~~~~~v~a~s~d-~~~e~I~~i  201 (288)
T d1l9xa_         157 VEPLTANFHKWSLSVKNFTMNEKLKKFFNVLTTNTD-GKIEFISTM  201 (288)
T ss_dssp             HSCCEEEEEEEECBHHHHHTCHHHHHHEEEEEEEES-SSCEEEEEE
T ss_pred             CCceEEEecccEEEecccchhhhcCCceEEEEEECC-CCeEEEEEE
Confidence            999999999999963            899999977 788898763

PyMOL of d1l9xa_

>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}	Back information, alignment and structure

>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Archaeon Pyrococcus horikoshii, PH0582 [TaxId: 53953]}	Back information, alignment and structure

>d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}	Back information, alignment and structure

>d2nqra3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1t0ba_ c.23.16.6 (A:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure