Citrus Sinensis ID: 025584


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MSQLFYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEIIVI
cccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEccccccHHHHHHHcccHHHHHHHHHHcccccccccccccEEEEEEEEEEEEcEEEEEEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEccccccEEEEEEEcccccccEEEEEcccccccccccHHHHHHHHHHHHHccccccccEEEccEEEccccccccccccccHHHHHHHHHccccEEEcc
cccHEEcccccccccccccHHccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHHHHccHHHHHHHHHHHHcccccccccEEEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccEEEEEcccEEEEEEEEccccEEEEEEEEcccccccEEEEEcccccccccccHHHHHHHHHHHHHccEEcHHHHHHHHHHHcccccccccccccccccHEEEEEEEccEEEEc
msqlfytlpkrltvspsppllhfnyrssrtrlvcskmptesspsplthsitipsqlsqpvhvvaapglsesdfrCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIfcketgqkvpgivfaRGPAVAVLILLDSEGETYAILTEQVRvptgrvilelpagmldddkgdfVGTAVREVEEETGIQLKLEDMIDLTaflypstgckffpsavcsFFLHSFFLFLSVEIIVI
msqlfytlpkrltvspsppllhfnyrssRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILteqvrvptGRVILELpagmldddkgDFVGTAVREVEeetgiqlklEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEIIVI
MSQLFYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCsfflhsfflflsVEIIVI
*****YT************LLHFNY**********************************VHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEIIV*
***LFYTLPKRLTVSPSPPLL****************************ITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQW****************LLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEIIVI
MSQLFYTLPKRLTVSPSPPLLHFNYRSSRTRLV**************HSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEIIVI
*SQLFYTLPKRLTVSPSPPLLHFNYRS*****************PLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEIIVI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQLFYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEIIVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query250 2.2.26 [Sep-21-2011]
Q9SZ63309 Nudix hydrolase 14, chlor yes no 0.932 0.754 0.684 4e-83
O61902223 Putative nudix hydrolase yes no 0.392 0.439 0.287 2e-06
P54570185 ADP-ribose pyrophosphatas yes no 0.32 0.432 0.423 0.0003
Q9P791205 Uncharacterized Nudix hyd yes no 0.296 0.360 0.333 0.0007
>sp|Q9SZ63|NUD14_ARATH Nudix hydrolase 14, chloroplastic OS=Arabidopsis thaliana GN=NUDT14 PE=1 SV=2 Back     alignment and function desciption
 Score =  307 bits (787), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 192/241 (79%), Gaps = 8/241 (3%)

Query: 5   FYTLPKRLTVSPS---PPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVH 61
           F  LP RL   PS   P  LH ++  ++  L C KM + SS   LT SIT+PSQ ++PV 
Sbjct: 4   FTLLPSRLLAFPSRALPRRLHHHH--AKLILRC-KMSSSSSS--LTQSITLPSQPNEPVL 58

Query: 62  VVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFL 121
           V A  G+S SDFR A++S+LF+ WL+NL+SE+GILA+G M LKQVLIQGVDMFGKRIGFL
Sbjct: 59  VSATAGISSSDFRDAIDSSLFRNWLRNLESESGILADGSMTLKQVLIQGVDMFGKRIGFL 118

Query: 122 KFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAG 181
           KFKADIF KETGQKVPGIVFARGPAVAVLILL+S+GETYA+LTEQVRVPTG+++LELPAG
Sbjct: 119 KFKADIFDKETGQKVPGIVFARGPAVAVLILLESDGETYAVLTEQVRVPTGKIVLELPAG 178

Query: 182 MLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFL 241
           MLDDDKGDFVGTAVREVEEE GI+LK EDM+DLTAFL PSTG + FPS        S FL
Sbjct: 179 MLDDDKGDFVGTAVREVEEEIGIKLKKEDMVDLTAFLDPSTGYRIFPSPGGCDEEMSVFL 238

Query: 242 F 242
           +
Sbjct: 239 Y 239




Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can use ADP-glucose, ADP-mannose and ADP-ribose as substrates. Regulates the intracellular ADP-glucose levels linked to starch biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 2EC: 1
>sp|O61902|NDX2_CAEEL Putative nudix hydrolase 2 OS=Caenorhabditis elegans GN=ndx-2 PE=3 SV=1 Back     alignment and function description
>sp|P54570|ADPP_BACSU ADP-ribose pyrophosphatase OS=Bacillus subtilis (strain 168) GN=nudF PE=1 SV=1 Back     alignment and function description
>sp|Q9P791|YN8C_SCHPO Uncharacterized Nudix hydrolase P35G2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.12 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
297813707303 hypothetical protein ARALYDRAFT_490017 [ 0.884 0.729 0.724 2e-84
224071638270 predicted protein [Populus trichocarpa] 0.768 0.711 0.792 4e-84
255537175305 ADP-ribose pyrophosphatase, putative [Ri 0.888 0.727 0.692 7e-84
356514188270 PREDICTED: nudix hydrolase 14, chloropla 0.816 0.755 0.747 2e-82
356513721304 PREDICTED: nudix hydrolase 14, chloropla 0.888 0.730 0.687 2e-82
18413722309 nudix hydrolase 14 [Arabidopsis thaliana 0.932 0.754 0.684 3e-81
110622992307 ADP-sugar diphosphatase [Solanum tuberos 0.924 0.752 0.677 1e-80
225426698306 PREDICTED: nudix hydrolase 14, chloropla 0.852 0.696 0.695 8e-80
297742638269 unnamed protein product [Vitis vinifera] 0.788 0.732 0.725 2e-78
4586103310 putative protein [Arabidopsis thaliana] 0.932 0.751 0.669 2e-76
>gi|297813707|ref|XP_002874737.1| hypothetical protein ARALYDRAFT_490017 [Arabidopsis lyrata subsp. lyrata] gi|297320574|gb|EFH50996.1| hypothetical protein ARALYDRAFT_490017 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 184/225 (81%), Gaps = 4/225 (1%)

Query: 5   FYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVA 64
           F  LP RL    S    H  +  +   L C KM   SS SPLTHSIT+PSQ ++PV V A
Sbjct: 6   FTLLPSRLLACYSRAFPHRLHHHAELILRC-KM---SSSSPLTHSITLPSQPNEPVLVSA 61

Query: 65  APGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFK 124
             G+S SDFR A++S+LF+ WL+NL+SETGILA+G M LKQVLIQGVDMFGKRIGFLKFK
Sbjct: 62  TSGISSSDFRDAIDSSLFRNWLRNLESETGILADGSMTLKQVLIQGVDMFGKRIGFLKFK 121

Query: 125 ADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLD 184
           ADIF KETGQKVPGIVFARGPAVAVLILL+S GETYA+LTEQVRVPTG+++LELPAGMLD
Sbjct: 122 ADIFDKETGQKVPGIVFARGPAVAVLILLESNGETYAVLTEQVRVPTGKIVLELPAGMLD 181

Query: 185 DDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPS 229
           DDKGDFVGTAVREVEEE GI+LK EDM+DLTAFL PSTG + FPS
Sbjct: 182 DDKGDFVGTAVREVEEEIGIKLKKEDMVDLTAFLDPSTGYRIFPS 226




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224071638|ref|XP_002303547.1| predicted protein [Populus trichocarpa] gi|222840979|gb|EEE78526.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537175|ref|XP_002509654.1| ADP-ribose pyrophosphatase, putative [Ricinus communis] gi|223549553|gb|EEF51041.1| ADP-ribose pyrophosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356514188|ref|XP_003525788.1| PREDICTED: nudix hydrolase 14, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356513721|ref|XP_003525559.1| PREDICTED: nudix hydrolase 14, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|18413722|ref|NP_567384.1| nudix hydrolase 14 [Arabidopsis thaliana] gi|68565950|sp|Q9SZ63.2|NUD14_ARATH RecName: Full=Nudix hydrolase 14, chloroplastic; Short=AtNUDT14; AltName: Full=ADP-sugar diphosphatase; Short=AtASPP; Flags: Precursor gi|15450341|gb|AAK96464.1| AT4g11980/F16J13_50 [Arabidopsis thaliana] gi|24797050|gb|AAN64537.1| At4g11980/F16J13_50 [Arabidopsis thaliana] gi|67966275|emb|CAG38620.1| ADP-sugar diphosphatase [Arabidopsis thaliana] gi|332657679|gb|AEE83079.1| nudix hydrolase 14 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110622992|emb|CAJ55406.1| ADP-sugar diphosphatase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|225426698|ref|XP_002281806.1| PREDICTED: nudix hydrolase 14, chloroplastic [Vitis vinifera] gi|147766435|emb|CAN76052.1| hypothetical protein VITISV_016365 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742638|emb|CBI34787.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|4586103|emb|CAB40939.1| putative protein [Arabidopsis thaliana] gi|7267899|emb|CAB78241.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
TAIR|locus:2118061309 NUDX14 "nudix hydrolase homolo 0.88 0.711 0.714 1e-77
DICTYBASE|DDB_G0271376253 DDB_G0271376 [Dictyostelium di 0.616 0.608 0.402 8.2e-28
DICTYBASE|DDB_G0282603199 DDB_G0282603 "NUDIX hydrolase 0.288 0.361 0.378 4.5e-08
WB|WBGene00003579223 ndx-2 [Caenorhabditis elegans 0.392 0.439 0.287 8.1e-06
POMBASE|SPBP35G2.12205 SPBP35G2.12 "ADP-ribose diphos 0.296 0.360 0.333 4.2e-05
TIGR_CMR|BA_4316179 BA_4316 "mutT/nudix family pro 0.284 0.396 0.435 4.9e-05
TAIR|locus:2118061 NUDX14 "nudix hydrolase homolog 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 782 (280.3 bits), Expect = 1.0e-77, P = 1.0e-77
 Identities = 163/228 (71%), Positives = 188/228 (82%)

Query:     5 FYTLPKRLTVSPS---PPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVH 61
             F  LP RL   PS   P  LH ++  ++  L C KM   SS S LT SIT+PSQ ++PV 
Sbjct:     4 FTLLPSRLLAFPSRALPRRLHHHH--AKLILRC-KM--SSSSSSLTQSITLPSQPNEPVL 58

Query:    62 VVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFL 121
             V A  G+S SDFR A++S+LF+ WL+NL+SE+GILA+G M LKQVLIQGVDMFGKRIGFL
Sbjct:    59 VSATAGISSSDFRDAIDSSLFRNWLRNLESESGILADGSMTLKQVLIQGVDMFGKRIGFL 118

Query:   122 KFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAG 181
             KFKADIF KETGQKVPGIVFARGPAVAVLILL+S+GETYA+LTEQVRVPTG+++LELPAG
Sbjct:   119 KFKADIFDKETGQKVPGIVFARGPAVAVLILLESDGETYAVLTEQVRVPTGKIVLELPAG 178

Query:   182 MLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPS 229
             MLDDDKGDFVGTAVREVEEE GI+LK EDM+DLTAFL PSTG + FPS
Sbjct:   179 MLDDDKGDFVGTAVREVEEEIGIKLKKEDMVDLTAFLDPSTGYRIFPS 226




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0019144 "ADP-sugar diphosphatase activity" evidence=IDA
GO:0080041 "ADP-ribose pyrophosphohydrolase activity" evidence=IDA
GO:0080042 "ADP-glucose pyrophosphohydrolase activity" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
DICTYBASE|DDB_G0271376 DDB_G0271376 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282603 DDB_G0282603 "NUDIX hydrolase family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00003579 ndx-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPBP35G2.12 SPBP35G2.12 "ADP-ribose diphosphatase, NudF subfamily (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4316 BA_4316 "mutT/nudix family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SZ63NUD14_ARATH3, ., 6, ., 1, ., 2, 10.68460.9320.7540yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00030908
hypothetical protein (271 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
PLN03143291 PLN03143, PLN03143, nudix hydrolase; Provisional 1e-130
cd03424137 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase 2e-19
pfam00293133 pfam00293, NUDIX, NUDIX domain 3e-11
COG0494161 COG0494, MutT, NTP pyrophosphohydrolases including 8e-11
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup 2e-05
cd03426157 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse) 3e-05
cd04676129 cd04676, Nudix_Hydrolase_17, Members of the Nudix 4e-05
TIGR00052185 TIGR00052, TIGR00052, nudix-type nucleoside diphos 1e-04
PRK10729202 PRK10729, nudF, ADP-ribose pyrophosphatase NudF; P 4e-04
cd03673131 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate 9e-04
cd04692144 cd04692, Nudix_Hydrolase_33, Members of the Nudix 0.003
>gnl|CDD|215602 PLN03143, PLN03143, nudix hydrolase; Provisional Back     alignment and domain information
 Score =  370 bits (951), Expect = e-130
 Identities = 166/225 (73%), Positives = 180/225 (80%), Gaps = 13/225 (5%)

Query: 5   FYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVA 64
           F  LP R    PS                 S     SS SPLTHSIT+P Q  QPV VVA
Sbjct: 2   FTLLPSRPLALPSR----------MAHKEASSS---SSSSPLTHSITLPGQPGQPVLVVA 48

Query: 65  APGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFK 124
           APG+S SDFR A++S+LF+QWLKNLQSE+GILA G M LKQVLIQGVDMFGKRIGFLKFK
Sbjct: 49  APGISSSDFRKAIDSSLFRQWLKNLQSESGILAYGSMSLKQVLIQGVDMFGKRIGFLKFK 108

Query: 125 ADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLD 184
           ADI  KETGQKVPGIVFARGPAVAVLILL+SEGETYA+LTEQVRVP G+ +LELPAGMLD
Sbjct: 109 ADIIDKETGQKVPGIVFARGPAVAVLILLESEGETYAVLTEQVRVPVGKFVLELPAGMLD 168

Query: 185 DDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPS 229
           DDKGDFVGTAVREVEEETGI+LKLEDM+DLTAFL PSTGC+ FPS
Sbjct: 169 DDKGDFVGTAVREVEEETGIKLKLEDMVDLTAFLDPSTGCRMFPS 213


Length = 291

>gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239518 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|129162 TIGR00052, TIGR00052, nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>gnl|CDD|182682 PRK10729, nudF, ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|240048 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 250
PLN03143291 nudix hydrolase; Provisional 100.0
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 99.92
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 99.91
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.89
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.87
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 99.85
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.59
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.5
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.47
PRK10707190 putative NUDIX hydrolase; Provisional 99.45
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.44
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.43
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.41
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.41
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.4
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.39
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.38
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.37
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.37
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.37
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.37
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.36
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.35
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.35
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.35
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.34
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.33
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.32
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.31
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.28
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.28
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.27
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.27
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.26
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.26
PLN02325144 nudix hydrolase 99.26
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.25
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.25
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.24
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.24
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.24
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.24
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.23
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.22
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.22
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.21
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.2
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.2
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.19
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.19
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.19
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.17
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.17
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.16
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.16
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 99.15
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.15
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.13
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.13
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.12
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.12
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.11
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.1
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.1
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.1
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.09
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.08
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.07
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.05
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.02
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.0
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 98.99
PLN02709222 nudix hydrolase 98.99
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 98.98
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 98.96
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 98.84
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 98.83
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 98.82
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 98.8
PRK08999 312 hypothetical protein; Provisional 98.75
KOG4432 405 consensus Uncharacterized NUDIX family hydrolase [ 98.7
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 98.58
KOG4432405 consensus Uncharacterized NUDIX family hydrolase [ 98.47
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 98.41
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.35
PLN02791 770 Nudix hydrolase homolog 98.34
PLN02552247 isopentenyl-diphosphate delta-isomerase 97.96
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 97.94
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 97.68
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 97.61
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 96.8
PLN02839372 nudix hydrolase 95.41
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 94.97
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 94.77
KOG4195275 consensus Transient receptor potential-related cha 94.56
KOG2937 348 consensus Decapping enzyme complex, predicted pyro 89.76
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 89.17
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 88.01
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-52  Score=384.30  Aligned_cols=212  Identities=76%  Similarity=1.110  Sum_probs=193.2

Q ss_pred             eeeeecCCCCCCCCceeEEEeCCCCCCCeEEEeCCCCCHHhHhhhhcCchHHHHHHHhhhhcccccCCCcceEEEEEeeE
Q 025584           32 LVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGV  111 (250)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~W~~~l~~~~~l~~~~~~~L~~i~v~~v  111 (250)
                      .+.++|+++++  ++++||+||++++++|+|+++||+|++|+.+++++++|++|++++++++++|++++|.||+|+||+|
T Consensus        18 ~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~v   95 (291)
T PLN03143         18 HKEASSSSSSS--PLTHSITLPGQPGQPVLVVAAPGISSSDFRKAIDSSLFRQWLKNLQSESGILAYGSMSLKQVLIQGV   95 (291)
T ss_pred             eehhccCCCCC--CceeEEEccCCCCCceeEecCCCCCHHHHHhHhcChHHHHHHHHhhhccccccCCCceeEEEEEEEE
Confidence            34445555454  7999999999889999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecccccEEEEEEEEEEcCCCceeeeEEEEcCCEEEEEEEEcCCCceEEEEEEeeecCCCCcEEEecceecCCCCCCHH
Q 025584          112 DMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFV  191 (250)
Q Consensus       112 d~fg~~~gf~kl~~d~~~~~~G~~~p~~v~~rg~aV~VL~il~~~~~~~VlLvrQ~R~p~~~~~~ElPAG~vD~geEt~~  191 (250)
                      |+||+|.||+++++|.++.+||+..+++++.++++|+|+++++.++++++||++|||+|.+.+.||+|||++|+++|+++
T Consensus        96 d~fg~~~gflkv~~d~~~l~~G~~~~~~v~~rg~aVaVL~~l~~~ge~~VlLVrQ~R~pvg~~~lE~PAG~lD~~~edp~  175 (291)
T PLN03143         96 DMFGKRIGFLKFKADIIDKETGQKVPGIVFARGPAVAVLILLESEGETYAVLTEQVRVPVGKFVLELPAGMLDDDKGDFV  175 (291)
T ss_pred             ecccCceeEEEEEEEEEECCCCCEeeEEEEEcCCeEEEEEEEeCCCCEEEEEEEeEecCCCcEEEEecccccCCCCCCHH
Confidence            99999999999999999999999999999999999999988776666789999999999999999999999998557999


Q ss_pred             HHHHHHHHHHhCCcccccceeeccccccCCCCceeecCCccccceEEEEEEEce
Q 025584          192 GTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSV  245 (250)
Q Consensus       192 ~AA~REL~EETGl~i~~~~L~~L~~l~~~~~~~~~~pspG~~dE~i~lFl~~~~  245 (250)
                      +||+||++|||||.+...++..++.++++.+...+||+||+|||.+++|++.+.
T Consensus       176 ~aA~REL~EETG~~~~a~~lv~L~~~~~~~~g~~v~pspG~~dE~i~Lfla~~~  229 (291)
T PLN03143        176 GTAVREVEEETGIKLKLEDMVDLTAFLDPSTGCRMFPSPGGCDEEISLFLYRGH  229 (291)
T ss_pred             HHHHHHHHHHHCCccccceEEEeeeccccCcCceEEecCCccCCeEEEEEEccc
Confidence            999999999999998767888887666666677999999999999999998754



>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] Back     alignment and domain information
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
2yvm_A182 Crystal Structure Of Ndx2 In Complex With Mg2+ From 1e-05
>pdb|2YVM|A Chain A, Crystal Structure Of Ndx2 In Complex With Mg2+ From Thermus Thermophilus Hb8 Length = 182 Back     alignment and structure

Iteration: 1

Score = 46.6 bits (109), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 37/117 (31%), Positives = 62/117 (52%), Gaps = 15/117 (12%) Query: 101 MLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETY 160 +LL+++L + V + +R+ TG+++ V+ GP A +L +E T Sbjct: 7 ILLEEILSEPVRLVKERV----------RTHTGREL-TYVYRPGPVAASFVLPVTERGT- 54 Query: 161 AILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAF 217 A+L Q R PTG+ +LE+PAG +D+ + A RE+ EE G + E +I L +F Sbjct: 55 ALLVRQYRHPTGKFLLEVPAGKVDEGETP-EAAARRELREEVGAE--AETLIPLPSF 108

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 7e-15
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 3e-14
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 3e-13
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 3e-13
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 1e-12
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 1e-12
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 2e-12
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 2e-11
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 2e-11
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 7e-07
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 1e-06
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 1e-05
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 2e-05
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 3e-05
3grn_A153 MUTT related protein; structural genomics, hydrola 3e-05
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 5e-05
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 9e-05
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 1e-04
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 1e-04
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 2e-04
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 2e-04
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, 2e-04
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 2e-04
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 4e-04
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 5e-04
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 5e-04
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 6e-04
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Length = 191 Back     alignment and structure
 Score = 70.0 bits (172), Expect = 7e-15
 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 13/90 (14%)

Query: 140 VFARGPAVAVLILLDSEGETYAILTEQVRVPT------GRVILELPAGMLDDDKGDFVGT 193
           V+ RG    +L+    +     +L  Q RV T         ++E  AG+LD    +    
Sbjct: 41  VYDRGNGATILLYNTKKKT--VVLIRQFRVATWVNGNESGQLIESCAGLLD--NDEPEVC 96

Query: 194 AVREVEEETGIQLKLEDMIDLTAFLYPSTG 223
             +E  EETG   ++ ++  L    Y S G
Sbjct: 97  IRKEAIEETG--YEVGEVRKLFEL-YMSPG 123


>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Length = 218 Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.85
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.85
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.83
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.83
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.81
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.81
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.75
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.72
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.67
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.48
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.43
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.42
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.4
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.38
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.38
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.38
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.36
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.36
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.36
3grn_A153 MUTT related protein; structural genomics, hydrola 99.35
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.35
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.34
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.34
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.34
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.33
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.33
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.33
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.33
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.32
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.31
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.31
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.3
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.3
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.3
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.28
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.27
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.27
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.27
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.27
3exq_A161 Nudix family hydrolase; protein structure initiati 99.27
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.26
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.25
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.25
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.25
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.25
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.23
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.22
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.2
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.2
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.2
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.2
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.2
3f13_A163 Putative nudix hydrolase family member; structural 99.19
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.17
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.16
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 99.15
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.13
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.13
2fb1_A 226 Conserved hypothetical protein; structural genomic 99.12
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 99.12
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.12
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.11
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.07
3gz5_A 240 MUTT/nudix family protein; DNA binding protein, nu 99.06
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.05
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.0
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 98.99
3e57_A211 Uncharacterized protein TM1382; structural genomic 98.82
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 98.73
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 98.67
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 98.61
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 98.61
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 98.61
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 98.61
3bho_A208 Cleavage and polyadenylation specificity factor su 98.56
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 98.43
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.08
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
Probab=99.85  E-value=2.4e-20  Score=160.24  Aligned_cols=114  Identities=25%  Similarity=0.253  Sum_probs=95.6

Q ss_pred             ccEEEEEEEEEEcCCCceeeeEEEEc-------CCEEEEEEEEcCC-CceEEEEEEeeecCCCCcEEEecceecCCCCCC
Q 025584          118 IGFLKFKADIFCKETGQKVPGIVFAR-------GPAVAVLILLDSE-GETYAILTEQVRVPTGRVILELPAGMLDDDKGD  189 (250)
Q Consensus       118 ~gf~kl~~d~~~~~~G~~~p~~v~~r-------g~aV~VL~il~~~-~~~~VlLvrQ~R~p~~~~~~ElPAG~vD~geEt  189 (250)
                      ++|++++.+.+..++|+...+.++.+       +++|+|++++..+ ++.++||++|+|.+.+.+.|++|||++|+| |+
T Consensus        28 ~~~~~~~~~~~~~~~G~~~~~~~v~~~~~~~~~~~av~v~~v~~~~~~~~~vlLv~q~R~~~~~~~welPgG~ve~g-Es  106 (212)
T 2dsc_A           28 GKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDG-ET  106 (212)
T ss_dssp             CSSEEEEEEEEECTTSCEEEEEEEEETTCCTTSCSEEEEEEEEECTTSCCEEEEEEEEEGGGTEEEEECCEEECCTT-CC
T ss_pred             CCEEEEEEEEEECCCCCEEEEEEEEeeccCCCCCCEEEEEEEEeCCCCCcEEEEEEeecCCCCCcEEECCccccCCC-CC
Confidence            78999999999999999877776665       6899998876443 234699999999998778999999999997 69


Q ss_pred             HHHHHHHHHHHHhCCcccccceeeccccccCCCCceeecCCccccceEEEEEEE
Q 025584          190 FVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFL  243 (250)
Q Consensus       190 ~~~AA~REL~EETGl~i~~~~L~~L~~l~~~~~~~~~~pspG~~dE~i~lFl~~  243 (250)
                      +++||+|||+||||+.+.  .+..+         ..++.+||++++.+++|++.
T Consensus       107 ~~~aA~REl~EEtGl~~~--~~~~l---------~~~~~~~~~~~~~~~~~~a~  149 (212)
T 2dsc_A          107 PEAAALRELEEETGYKGD--IAECS---------PAVCMDPGLSNCTIHIVTVT  149 (212)
T ss_dssp             HHHHHHHHHHHHHCCCCE--EEEEC---------CCEESCTTTBCCEEEEEEEE
T ss_pred             HHHHHHHHHHHHhCCCcc--ceEEe---------ccEEcCCCccCceEEEEEEE
Confidence            999999999999999874  33334         35789999999999999886



>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 250
d1v8ya_158 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus 4e-07
d1mqea_202 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobac 7e-07
d2fvva1135 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat 2e-05
d2azwa1147 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E 6e-05
d1vhza_186 d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche 6e-05
d1sjya_158 d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc 1e-04
d1irya_156 d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha 3e-04
d1viua_189 d.113.1.1 (A:) ADP-ribose pyrophosphatase homologu 0.001
d2a6ta2151 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c 0.004
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: ADP-ribose pyrophosphatase
species: Thermus thermophilus [TaxId: 274]
 Score = 46.3 bits (109), Expect = 4e-07
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 140 VFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVE 199
           +    PAVAV+ L +       +   Q+R   G   LE+PAG+++  + D +  A RE+ 
Sbjct: 20  IVEHKPAVAVIALREGR----MLFVRQMRPAVGLAPLEIPAGLIEPGE-DPLEAARRELA 74

Query: 200 EETGIQLKLEDMIDL 214
           E+TG+   L  +   
Sbjct: 75  EQTGLSGDLTYLFSY 89


>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 202 Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Length = 189 Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.91
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 99.9
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 99.89
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.89
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.81
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.5
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.45
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.43
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.39
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.37
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.37
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.35
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.34
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.34
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.31
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.3
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.25
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.25
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.23
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.22
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.22
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.2
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.19
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.15
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.09
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.0
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 98.72
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 98.61
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 98.38
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 97.8
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: ADP-ribose pyrophosphatase
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.91  E-value=6.9e-24  Score=181.63  Aligned_cols=123  Identities=26%  Similarity=0.241  Sum_probs=101.8

Q ss_pred             EeeEeeecccccEEEEEEEEEEcCCCceeeeEEEEcCCEEEEEEEEcCCCceEEEEEEeeecCCCCcEEEecceecC-CC
Q 025584          108 IQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLD-DD  186 (250)
Q Consensus       108 v~~vd~fg~~~gf~kl~~d~~~~~~G~~~p~~v~~rg~aV~VL~il~~~~~~~VlLvrQ~R~p~~~~~~ElPAG~vD-~g  186 (250)
                      +++...|.  +.|++++.+.+..|||....+.++.++++|+|+++ +.++  ++||++|||++.+.+.|++|||++| +|
T Consensus         4 l~s~~v~~--~~~~~v~~d~v~~pdG~~~~~~~v~~~~~V~vl~~-~~~~--~ilLvrq~R~~~~~~~welPaG~ie~~g   78 (202)
T d1mqea_           4 ISSETLHT--GAIFALRRDQVRMPGGGIVTREVVEHFGAVAIVAM-DDNG--NIPMVYQYRHTYGRRLWELPAGLLDVAG   78 (202)
T ss_dssp             EEEEEEEE--CSSEEEEEEEEC-----CEEEEEEEECCEEEEEEC-CTTS--EEEEEEEEETTTTEEEEECCEEECCSTT
T ss_pred             ccEEEEEE--CCEEEEEEEEEECCCCCEEEEEEEEcCCeEEEEEE-CCCC--EEEEEEecccccCceEEeccccccccCC
Confidence            34444554  68999999999999999999999999999999875 5555  4999999999999999999999999 56


Q ss_pred             CCCHHHHHHHHHHHHhCCcccccceeeccccccCCCCceeecCCccccceEEEEEEEceeE
Q 025584          187 KGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEI  247 (250)
Q Consensus       187 eEt~~~AA~REL~EETGl~i~~~~L~~L~~l~~~~~~~~~~pspG~~dE~i~lFl~~~~e~  247 (250)
                       |++++||+|||+||||+.++  .+..+         +.++++||++++.+++|++.+...
T Consensus        79 -E~~~~aA~REl~EETG~~~~--~~~~l---------~~~~~~~g~~~~~~~~fla~~~~~  127 (202)
T d1mqea_          79 -EPPHLTAARELREEVGLQAS--TWQVL---------VDLDTAPGFSDESVRVYLATGLRE  127 (202)
T ss_dssp             -CCHHHHHHHHHHHHHCEEEE--EEEEE---------EEECSCTTTBCCCEEEEEEEEEEE
T ss_pred             -CCHHHHHHHHHhhccccccc--cceEe---------eeeeccCccCCcEEEEEEEEeccc
Confidence             79999999999999999874  67777         578999999999999999986654



>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure