Citrus Sinensis ID: 025584
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 250 | ||||||
| 297813707 | 303 | hypothetical protein ARALYDRAFT_490017 [ | 0.884 | 0.729 | 0.724 | 2e-84 | |
| 224071638 | 270 | predicted protein [Populus trichocarpa] | 0.768 | 0.711 | 0.792 | 4e-84 | |
| 255537175 | 305 | ADP-ribose pyrophosphatase, putative [Ri | 0.888 | 0.727 | 0.692 | 7e-84 | |
| 356514188 | 270 | PREDICTED: nudix hydrolase 14, chloropla | 0.816 | 0.755 | 0.747 | 2e-82 | |
| 356513721 | 304 | PREDICTED: nudix hydrolase 14, chloropla | 0.888 | 0.730 | 0.687 | 2e-82 | |
| 18413722 | 309 | nudix hydrolase 14 [Arabidopsis thaliana | 0.932 | 0.754 | 0.684 | 3e-81 | |
| 110622992 | 307 | ADP-sugar diphosphatase [Solanum tuberos | 0.924 | 0.752 | 0.677 | 1e-80 | |
| 225426698 | 306 | PREDICTED: nudix hydrolase 14, chloropla | 0.852 | 0.696 | 0.695 | 8e-80 | |
| 297742638 | 269 | unnamed protein product [Vitis vinifera] | 0.788 | 0.732 | 0.725 | 2e-78 | |
| 4586103 | 310 | putative protein [Arabidopsis thaliana] | 0.932 | 0.751 | 0.669 | 2e-76 |
| >gi|297813707|ref|XP_002874737.1| hypothetical protein ARALYDRAFT_490017 [Arabidopsis lyrata subsp. lyrata] gi|297320574|gb|EFH50996.1| hypothetical protein ARALYDRAFT_490017 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 317 bits (813), Expect = 2e-84, Method: Compositional matrix adjust.
Identities = 163/225 (72%), Positives = 184/225 (81%), Gaps = 4/225 (1%)
Query: 5 FYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVA 64
F LP RL S H + + L C KM SS SPLTHSIT+PSQ ++PV V A
Sbjct: 6 FTLLPSRLLACYSRAFPHRLHHHAELILRC-KM---SSSSPLTHSITLPSQPNEPVLVSA 61
Query: 65 APGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFK 124
G+S SDFR A++S+LF+ WL+NL+SETGILA+G M LKQVLIQGVDMFGKRIGFLKFK
Sbjct: 62 TSGISSSDFRDAIDSSLFRNWLRNLESETGILADGSMTLKQVLIQGVDMFGKRIGFLKFK 121
Query: 125 ADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLD 184
ADIF KETGQKVPGIVFARGPAVAVLILL+S GETYA+LTEQVRVPTG+++LELPAGMLD
Sbjct: 122 ADIFDKETGQKVPGIVFARGPAVAVLILLESNGETYAVLTEQVRVPTGKIVLELPAGMLD 181
Query: 185 DDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPS 229
DDKGDFVGTAVREVEEE GI+LK EDM+DLTAFL PSTG + FPS
Sbjct: 182 DDKGDFVGTAVREVEEEIGIKLKKEDMVDLTAFLDPSTGYRIFPS 226
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224071638|ref|XP_002303547.1| predicted protein [Populus trichocarpa] gi|222840979|gb|EEE78526.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255537175|ref|XP_002509654.1| ADP-ribose pyrophosphatase, putative [Ricinus communis] gi|223549553|gb|EEF51041.1| ADP-ribose pyrophosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356514188|ref|XP_003525788.1| PREDICTED: nudix hydrolase 14, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356513721|ref|XP_003525559.1| PREDICTED: nudix hydrolase 14, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18413722|ref|NP_567384.1| nudix hydrolase 14 [Arabidopsis thaliana] gi|68565950|sp|Q9SZ63.2|NUD14_ARATH RecName: Full=Nudix hydrolase 14, chloroplastic; Short=AtNUDT14; AltName: Full=ADP-sugar diphosphatase; Short=AtASPP; Flags: Precursor gi|15450341|gb|AAK96464.1| AT4g11980/F16J13_50 [Arabidopsis thaliana] gi|24797050|gb|AAN64537.1| At4g11980/F16J13_50 [Arabidopsis thaliana] gi|67966275|emb|CAG38620.1| ADP-sugar diphosphatase [Arabidopsis thaliana] gi|332657679|gb|AEE83079.1| nudix hydrolase 14 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|110622992|emb|CAJ55406.1| ADP-sugar diphosphatase [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|225426698|ref|XP_002281806.1| PREDICTED: nudix hydrolase 14, chloroplastic [Vitis vinifera] gi|147766435|emb|CAN76052.1| hypothetical protein VITISV_016365 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297742638|emb|CBI34787.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|4586103|emb|CAB40939.1| putative protein [Arabidopsis thaliana] gi|7267899|emb|CAB78241.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 250 | ||||||
| TAIR|locus:2118061 | 309 | NUDX14 "nudix hydrolase homolo | 0.88 | 0.711 | 0.714 | 1e-77 | |
| DICTYBASE|DDB_G0271376 | 253 | DDB_G0271376 [Dictyostelium di | 0.616 | 0.608 | 0.402 | 8.2e-28 | |
| DICTYBASE|DDB_G0282603 | 199 | DDB_G0282603 "NUDIX hydrolase | 0.288 | 0.361 | 0.378 | 4.5e-08 | |
| WB|WBGene00003579 | 223 | ndx-2 [Caenorhabditis elegans | 0.392 | 0.439 | 0.287 | 8.1e-06 | |
| POMBASE|SPBP35G2.12 | 205 | SPBP35G2.12 "ADP-ribose diphos | 0.296 | 0.360 | 0.333 | 4.2e-05 | |
| TIGR_CMR|BA_4316 | 179 | BA_4316 "mutT/nudix family pro | 0.284 | 0.396 | 0.435 | 4.9e-05 |
| TAIR|locus:2118061 NUDX14 "nudix hydrolase homolog 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 782 (280.3 bits), Expect = 1.0e-77, P = 1.0e-77
Identities = 163/228 (71%), Positives = 188/228 (82%)
Query: 5 FYTLPKRLTVSPS---PPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVH 61
F LP RL PS P LH ++ ++ L C KM SS S LT SIT+PSQ ++PV
Sbjct: 4 FTLLPSRLLAFPSRALPRRLHHHH--AKLILRC-KM--SSSSSSLTQSITLPSQPNEPVL 58
Query: 62 VVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFL 121
V A G+S SDFR A++S+LF+ WL+NL+SE+GILA+G M LKQVLIQGVDMFGKRIGFL
Sbjct: 59 VSATAGISSSDFRDAIDSSLFRNWLRNLESESGILADGSMTLKQVLIQGVDMFGKRIGFL 118
Query: 122 KFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAG 181
KFKADIF KETGQKVPGIVFARGPAVAVLILL+S+GETYA+LTEQVRVPTG+++LELPAG
Sbjct: 119 KFKADIFDKETGQKVPGIVFARGPAVAVLILLESDGETYAVLTEQVRVPTGKIVLELPAG 178
Query: 182 MLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPS 229
MLDDDKGDFVGTAVREVEEE GI+LK EDM+DLTAFL PSTG + FPS
Sbjct: 179 MLDDDKGDFVGTAVREVEEEIGIKLKKEDMVDLTAFLDPSTGYRIFPS 226
|
|
| DICTYBASE|DDB_G0271376 DDB_G0271376 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0282603 DDB_G0282603 "NUDIX hydrolase family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003579 ndx-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP35G2.12 SPBP35G2.12 "ADP-ribose diphosphatase, NudF subfamily (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4316 BA_4316 "mutT/nudix family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00030908 | hypothetical protein (271 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 250 | |||
| PLN03143 | 291 | PLN03143, PLN03143, nudix hydrolase; Provisional | 1e-130 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 2e-19 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 3e-11 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 8e-11 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 2e-05 | |
| cd03426 | 157 | cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse) | 3e-05 | |
| cd04676 | 129 | cd04676, Nudix_Hydrolase_17, Members of the Nudix | 4e-05 | |
| TIGR00052 | 185 | TIGR00052, TIGR00052, nudix-type nucleoside diphos | 1e-04 | |
| PRK10729 | 202 | PRK10729, nudF, ADP-ribose pyrophosphatase NudF; P | 4e-04 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 9e-04 | |
| cd04692 | 144 | cd04692, Nudix_Hydrolase_33, Members of the Nudix | 0.003 |
| >gnl|CDD|215602 PLN03143, PLN03143, nudix hydrolase; Provisional | Back alignment and domain information |
|---|
Score = 370 bits (951), Expect = e-130
Identities = 166/225 (73%), Positives = 180/225 (80%), Gaps = 13/225 (5%)
Query: 5 FYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVA 64
F LP R PS S SS SPLTHSIT+P Q QPV VVA
Sbjct: 2 FTLLPSRPLALPSR----------MAHKEASSS---SSSSPLTHSITLPGQPGQPVLVVA 48
Query: 65 APGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFK 124
APG+S SDFR A++S+LF+QWLKNLQSE+GILA G M LKQVLIQGVDMFGKRIGFLKFK
Sbjct: 49 APGISSSDFRKAIDSSLFRQWLKNLQSESGILAYGSMSLKQVLIQGVDMFGKRIGFLKFK 108
Query: 125 ADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLD 184
ADI KETGQKVPGIVFARGPAVAVLILL+SEGETYA+LTEQVRVP G+ +LELPAGMLD
Sbjct: 109 ADIIDKETGQKVPGIVFARGPAVAVLILLESEGETYAVLTEQVRVPVGKFVLELPAGMLD 168
Query: 185 DDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPS 229
DDKGDFVGTAVREVEEETGI+LKLEDM+DLTAFL PSTGC+ FPS
Sbjct: 169 DDKGDFVGTAVREVEEETGIKLKLEDMVDLTAFLDPSTGCRMFPS 213
|
Length = 291 |
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239518 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|129162 TIGR00052, TIGR00052, nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >gnl|CDD|182682 PRK10729, nudF, ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240048 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| PLN03143 | 291 | nudix hydrolase; Provisional | 100.0 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.92 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 99.91 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.89 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.87 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.85 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.59 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.5 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.47 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.45 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.44 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.43 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.41 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.41 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.4 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.39 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.38 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.37 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.37 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.37 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.37 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.36 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.35 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.35 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.35 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.34 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.33 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.32 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.31 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.28 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.28 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.27 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.27 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.26 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.26 | |
| PLN02325 | 144 | nudix hydrolase | 99.26 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.25 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.25 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.24 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.24 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.24 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.24 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.23 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.22 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.22 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.21 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.2 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.2 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.19 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.19 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.19 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.17 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.17 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.16 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.16 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 99.15 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.15 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.13 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.13 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.12 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.12 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.11 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.1 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.1 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.1 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.09 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.08 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.07 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.05 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.02 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.0 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 98.99 | |
| PLN02709 | 222 | nudix hydrolase | 98.99 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 98.98 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 98.96 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 98.84 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 98.83 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 98.82 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 98.8 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 98.75 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 98.7 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 98.58 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 98.47 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 98.41 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 98.35 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 98.34 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 97.96 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 97.94 | |
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 97.68 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 97.61 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 96.8 | |
| PLN02839 | 372 | nudix hydrolase | 95.41 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 94.97 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 94.77 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 94.56 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 89.76 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 89.17 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 88.01 |
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-52 Score=384.30 Aligned_cols=212 Identities=76% Similarity=1.110 Sum_probs=193.2
Q ss_pred eeeeecCCCCCCCCceeEEEeCCCCCCCeEEEeCCCCCHHhHhhhhcCchHHHHHHHhhhhcccccCCCcceEEEEEeeE
Q 025584 32 LVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGV 111 (250)
Q Consensus 32 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~W~~~l~~~~~l~~~~~~~L~~i~v~~v 111 (250)
.+.++|+++++ ++++||+||++++++|+|+++||+|++|+.+++++++|++|++++++++++|++++|.||+|+||+|
T Consensus 18 ~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~v 95 (291)
T PLN03143 18 HKEASSSSSSS--PLTHSITLPGQPGQPVLVVAAPGISSSDFRKAIDSSLFRQWLKNLQSESGILAYGSMSLKQVLIQGV 95 (291)
T ss_pred eehhccCCCCC--CceeEEEccCCCCCceeEecCCCCCHHHHHhHhcChHHHHHHHHhhhccccccCCCceeEEEEEEEE
Confidence 34445555454 7999999999889999999999999999999999999999999999999999999999999999999
Q ss_pred eeecccccEEEEEEEEEEcCCCceeeeEEEEcCCEEEEEEEEcCCCceEEEEEEeeecCCCCcEEEecceecCCCCCCHH
Q 025584 112 DMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFV 191 (250)
Q Consensus 112 d~fg~~~gf~kl~~d~~~~~~G~~~p~~v~~rg~aV~VL~il~~~~~~~VlLvrQ~R~p~~~~~~ElPAG~vD~geEt~~ 191 (250)
|+||+|.||+++++|.++.+||+..+++++.++++|+|+++++.++++++||++|||+|.+.+.||+|||++|+++|+++
T Consensus 96 d~fg~~~gflkv~~d~~~l~~G~~~~~~v~~rg~aVaVL~~l~~~ge~~VlLVrQ~R~pvg~~~lE~PAG~lD~~~edp~ 175 (291)
T PLN03143 96 DMFGKRIGFLKFKADIIDKETGQKVPGIVFARGPAVAVLILLESEGETYAVLTEQVRVPVGKFVLELPAGMLDDDKGDFV 175 (291)
T ss_pred ecccCceeEEEEEEEEEECCCCCEeeEEEEEcCCeEEEEEEEeCCCCEEEEEEEeEecCCCcEEEEecccccCCCCCCHH
Confidence 99999999999999999999999999999999999999988776666789999999999999999999999998557999
Q ss_pred HHHHHHHHHHhCCcccccceeeccccccCCCCceeecCCccccceEEEEEEEce
Q 025584 192 GTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSV 245 (250)
Q Consensus 192 ~AA~REL~EETGl~i~~~~L~~L~~l~~~~~~~~~~pspG~~dE~i~lFl~~~~ 245 (250)
+||+||++|||||.+...++..++.++++.+...+||+||+|||.+++|++.+.
T Consensus 176 ~aA~REL~EETG~~~~a~~lv~L~~~~~~~~g~~v~pspG~~dE~i~Lfla~~~ 229 (291)
T PLN03143 176 GTAVREVEEETGIKLKLEDMVDLTAFLDPSTGCRMFPSPGGCDEEISLFLYRGH 229 (291)
T ss_pred HHHHHHHHHHHCCccccceEEEeeeccccCcCceEEecCCccCCeEEEEEEccc
Confidence 999999999999998767888887666666677999999999999999998754
|
|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 250 | ||||
| 2yvm_A | 182 | Crystal Structure Of Ndx2 In Complex With Mg2+ From | 1e-05 |
| >pdb|2YVM|A Chain A, Crystal Structure Of Ndx2 In Complex With Mg2+ From Thermus Thermophilus Hb8 Length = 182 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 250 | |||
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 7e-15 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 3e-14 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 3e-13 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 3e-13 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 1e-12 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 1e-12 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 2e-12 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 2e-11 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 2e-11 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 7e-07 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 1e-06 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 1e-05 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 2e-05 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 3e-05 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 3e-05 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 5e-05 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 9e-05 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 1e-04 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 1e-04 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 2e-04 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 2e-04 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 2e-04 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 2e-04 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 4e-04 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 5e-04 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 5e-04 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 6e-04 |
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Length = 191 | Back alignment and structure |
|---|
Score = 70.0 bits (172), Expect = 7e-15
Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 13/90 (14%)
Query: 140 VFARGPAVAVLILLDSEGETYAILTEQVRVPT------GRVILELPAGMLDDDKGDFVGT 193
V+ RG +L+ + +L Q RV T ++E AG+LD +
Sbjct: 41 VYDRGNGATILLYNTKKKT--VVLIRQFRVATWVNGNESGQLIESCAGLLD--NDEPEVC 96
Query: 194 AVREVEEETGIQLKLEDMIDLTAFLYPSTG 223
+E EETG ++ ++ L Y S G
Sbjct: 97 IRKEAIEETG--YEVGEVRKLFEL-YMSPG 123
|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.85 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.85 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.83 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.83 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.81 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.81 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.75 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.72 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.67 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.48 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.43 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.42 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.4 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.38 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.38 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.38 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.36 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.36 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.36 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.35 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.35 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.34 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.34 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.34 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.33 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.33 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.33 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.33 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.32 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.31 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.31 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.3 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.3 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.3 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.28 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.27 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.27 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.27 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.27 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.27 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.26 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.25 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.25 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.25 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.25 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.23 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.22 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.2 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.2 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.2 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.2 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.2 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.19 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.17 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.16 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.15 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.13 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.13 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.12 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.12 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.12 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.11 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.07 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.06 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.05 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.0 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 98.99 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 98.82 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 98.73 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 98.67 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 98.61 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 98.61 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 98.61 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 98.61 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.56 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.43 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 98.08 |
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
Probab=99.85 E-value=2.4e-20 Score=160.24 Aligned_cols=114 Identities=25% Similarity=0.253 Sum_probs=95.6
Q ss_pred ccEEEEEEEEEEcCCCceeeeEEEEc-------CCEEEEEEEEcCC-CceEEEEEEeeecCCCCcEEEecceecCCCCCC
Q 025584 118 IGFLKFKADIFCKETGQKVPGIVFAR-------GPAVAVLILLDSE-GETYAILTEQVRVPTGRVILELPAGMLDDDKGD 189 (250)
Q Consensus 118 ~gf~kl~~d~~~~~~G~~~p~~v~~r-------g~aV~VL~il~~~-~~~~VlLvrQ~R~p~~~~~~ElPAG~vD~geEt 189 (250)
++|++++.+.+..++|+...+.++.+ +++|+|++++..+ ++.++||++|+|.+.+.+.|++|||++|+| |+
T Consensus 28 ~~~~~~~~~~~~~~~G~~~~~~~v~~~~~~~~~~~av~v~~v~~~~~~~~~vlLv~q~R~~~~~~~welPgG~ve~g-Es 106 (212)
T 2dsc_A 28 GKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDG-ET 106 (212)
T ss_dssp CSSEEEEEEEEECTTSCEEEEEEEEETTCCTTSCSEEEEEEEEECTTSCCEEEEEEEEEGGGTEEEEECCEEECCTT-CC
T ss_pred CCEEEEEEEEEECCCCCEEEEEEEEeeccCCCCCCEEEEEEEEeCCCCCcEEEEEEeecCCCCCcEEECCccccCCC-CC
Confidence 78999999999999999877776665 6899998876443 234699999999998778999999999997 69
Q ss_pred HHHHHHHHHHHHhCCcccccceeeccccccCCCCceeecCCccccceEEEEEEE
Q 025584 190 FVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFL 243 (250)
Q Consensus 190 ~~~AA~REL~EETGl~i~~~~L~~L~~l~~~~~~~~~~pspG~~dE~i~lFl~~ 243 (250)
+++||+|||+||||+.+. .+..+ ..++.+||++++.+++|++.
T Consensus 107 ~~~aA~REl~EEtGl~~~--~~~~l---------~~~~~~~~~~~~~~~~~~a~ 149 (212)
T 2dsc_A 107 PEAAALRELEEETGYKGD--IAECS---------PAVCMDPGLSNCTIHIVTVT 149 (212)
T ss_dssp HHHHHHHHHHHHHCCCCE--EEEEC---------CCEESCTTTBCCEEEEEEEE
T ss_pred HHHHHHHHHHHHhCCCcc--ceEEe---------ccEEcCCCccCceEEEEEEE
Confidence 999999999999999874 33334 35789999999999999886
|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 250 | ||||
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 4e-07 | |
| d1mqea_ | 202 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobac | 7e-07 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 2e-05 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 6e-05 | |
| d1vhza_ | 186 | d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche | 6e-05 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 1e-04 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 3e-04 | |
| d1viua_ | 189 | d.113.1.1 (A:) ADP-ribose pyrophosphatase homologu | 0.001 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 0.004 |
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: ADP-ribose pyrophosphatase species: Thermus thermophilus [TaxId: 274]
Score = 46.3 bits (109), Expect = 4e-07
Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%)
Query: 140 VFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLDDDKGDFVGTAVREVE 199
+ PAVAV+ L + + Q+R G LE+PAG+++ + D + A RE+
Sbjct: 20 IVEHKPAVAVIALREGR----MLFVRQMRPAVGLAPLEIPAGLIEPGE-DPLEAARRELA 74
Query: 200 EETGIQLKLEDMIDL 214
E+TG+ L +
Sbjct: 75 EQTGLSGDLTYLFSY 89
|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 202 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Length = 189 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.91 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.9 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.89 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.89 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.81 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.5 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.45 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.43 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.39 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.37 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.37 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.35 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.34 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.34 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.31 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.3 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.25 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.25 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.23 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.22 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.22 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.2 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.19 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.15 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.09 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.0 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 98.72 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 98.61 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 98.38 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 97.8 |
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: ADP-ribose pyrophosphatase species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.91 E-value=6.9e-24 Score=181.63 Aligned_cols=123 Identities=26% Similarity=0.241 Sum_probs=101.8
Q ss_pred EeeEeeecccccEEEEEEEEEEcCCCceeeeEEEEcCCEEEEEEEEcCCCceEEEEEEeeecCCCCcEEEecceecC-CC
Q 025584 108 IQGVDMFGKRIGFLKFKADIFCKETGQKVPGIVFARGPAVAVLILLDSEGETYAILTEQVRVPTGRVILELPAGMLD-DD 186 (250)
Q Consensus 108 v~~vd~fg~~~gf~kl~~d~~~~~~G~~~p~~v~~rg~aV~VL~il~~~~~~~VlLvrQ~R~p~~~~~~ElPAG~vD-~g 186 (250)
+++...|. +.|++++.+.+..|||....+.++.++++|+|+++ +.++ ++||++|||++.+.+.|++|||++| +|
T Consensus 4 l~s~~v~~--~~~~~v~~d~v~~pdG~~~~~~~v~~~~~V~vl~~-~~~~--~ilLvrq~R~~~~~~~welPaG~ie~~g 78 (202)
T d1mqea_ 4 ISSETLHT--GAIFALRRDQVRMPGGGIVTREVVEHFGAVAIVAM-DDNG--NIPMVYQYRHTYGRRLWELPAGLLDVAG 78 (202)
T ss_dssp EEEEEEEE--CSSEEEEEEEEC-----CEEEEEEEECCEEEEEEC-CTTS--EEEEEEEEETTTTEEEEECCEEECCSTT
T ss_pred ccEEEEEE--CCEEEEEEEEEECCCCCEEEEEEEEcCCeEEEEEE-CCCC--EEEEEEecccccCceEEeccccccccCC
Confidence 34444554 68999999999999999999999999999999875 5555 4999999999999999999999999 56
Q ss_pred CCCHHHHHHHHHHHHhCCcccccceeeccccccCCCCceeecCCccccceEEEEEEEceeE
Q 025584 187 KGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAVCSFFLHSFFLFLSVEI 247 (250)
Q Consensus 187 eEt~~~AA~REL~EETGl~i~~~~L~~L~~l~~~~~~~~~~pspG~~dE~i~lFl~~~~e~ 247 (250)
|++++||+|||+||||+.++ .+..+ +.++++||++++.+++|++.+...
T Consensus 79 -E~~~~aA~REl~EETG~~~~--~~~~l---------~~~~~~~g~~~~~~~~fla~~~~~ 127 (202)
T d1mqea_ 79 -EPPHLTAARELREEVGLQAS--TWQVL---------VDLDTAPGFSDESVRVYLATGLRE 127 (202)
T ss_dssp -CCHHHHHHHHHHHHHCEEEE--EEEEE---------EEECSCTTTBCCCEEEEEEEEEEE
T ss_pred -CCHHHHHHHHHhhccccccc--cceEe---------eeeeccCccCCcEEEEEEEEeccc
Confidence 79999999999999999874 67777 578999999999999999986654
|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|