Citrus Sinensis ID: 025588
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 250 | ||||||
| 221327587 | 250 | ascorbate peroxidase [Citrus maxima] | 1.0 | 1.0 | 0.98 | 1e-140 | |
| 224138586 | 250 | predicted protein [Populus trichocarpa] | 0.996 | 0.996 | 0.907 | 1e-132 | |
| 153799884 | 251 | cytosolic ascorbate peroxidase [Dimocarp | 0.992 | 0.988 | 0.911 | 1e-132 | |
| 161778778 | 253 | cytosolic ascorbate peroxidase [Vitis vi | 1.0 | 0.988 | 0.912 | 1e-132 | |
| 297741493 | 253 | unnamed protein product [Vitis vinifera] | 1.0 | 0.988 | 0.908 | 1e-131 | |
| 167375884 | 250 | ascorbate peroxidase [Litchi chinensis] | 0.988 | 0.988 | 0.914 | 1e-131 | |
| 154199607 | 251 | putative ascorbate peroxidase [Litchi ch | 0.992 | 0.988 | 0.907 | 1e-131 | |
| 224068648 | 245 | predicted protein [Populus trichocarpa] | 0.98 | 1.0 | 0.906 | 1e-129 | |
| 147799398 | 253 | hypothetical protein VITISV_005618 [Viti | 0.984 | 0.972 | 0.902 | 1e-128 | |
| 212896802 | 249 | ascorbate peroxidase [Oncidium Gower Ram | 0.996 | 1.0 | 0.891 | 1e-127 |
| >gi|221327587|gb|ACM17463.1| ascorbate peroxidase [Citrus maxima] | Back alignment and taxonomy information |
|---|
Score = 504 bits (1299), Expect = e-140, Method: Compositional matrix adjust.
Identities = 245/250 (98%), Positives = 247/250 (98%)
Query: 1 MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTI 60
MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTI
Sbjct: 1 MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTI 60
Query: 61 RHPDELAHEANNGLDIAVRLLEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP 120
HPDELAHEANNGLDIAVRLLEPI+QQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP
Sbjct: 61 SHPDELAHEANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP 120
Query: 121 DKSDPPPEGRLPNATKGSDHLRDVFGHMGLSDKEIVVLSGGHTLGRCHKERSGFEGPWTN 180
DKSDPPPEGR PNATKGSDHLRDVFGHMGLSDK+IVVLSGGHTLGRCHKERSGFEGPWTN
Sbjct: 121 DKSDPPPEGRSPNATKGSDHLRDVFGHMGLSDKDIVVLSGGHTLGRCHKERSGFEGPWTN 180
Query: 181 NPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLK 240
NPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDA FADYAEAHLK
Sbjct: 181 NPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAFFADYAEAHLK 240
Query: 241 LSELGFADAE 250
LSELGFADAE
Sbjct: 241 LSELGFADAE 250
|
Source: Citrus maxima Species: Citrus maxima Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224138586|ref|XP_002322851.1| predicted protein [Populus trichocarpa] gi|118482515|gb|ABK93180.1| unknown [Populus trichocarpa] gi|222867481|gb|EEF04612.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|153799884|gb|ABS50864.1| cytosolic ascorbate peroxidase [Dimocarpus longan] | Back alignment and taxonomy information |
|---|
| >gi|161778778|gb|ABX79340.1| cytosolic ascorbate peroxidase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741493|emb|CBI32625.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|167375884|gb|ABZ79406.1| ascorbate peroxidase [Litchi chinensis] | Back alignment and taxonomy information |
|---|
| >gi|154199607|gb|ABB46514.2| putative ascorbate peroxidase [Litchi chinensis] | Back alignment and taxonomy information |
|---|
| >gi|224068648|ref|XP_002326165.1| predicted protein [Populus trichocarpa] gi|222833358|gb|EEE71835.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147799398|emb|CAN59923.1| hypothetical protein VITISV_005618 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|212896802|gb|ACJ38537.1| ascorbate peroxidase [Oncidium Gower Ramsey] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 250 | ||||||
| TAIR|locus:2074914 | 251 | APX2 "ascorbate peroxidase 2" | 0.992 | 0.988 | 0.794 | 2.4e-108 | |
| TAIR|locus:2026616 | 250 | APX1 "ascorbate peroxidase 1" | 0.996 | 0.996 | 0.74 | 1.2e-99 | |
| TAIR|locus:2131586 | 287 | APX3 "ascorbate peroxidase 3" | 0.964 | 0.839 | 0.630 | 2.1e-77 | |
| TAIR|locus:2125409 | 279 | APX5 "ascorbate peroxidase 5" | 0.952 | 0.853 | 0.577 | 3.8e-69 | |
| ASPGD|ASPL0000029968 | 312 | AN5440 [Emericella nidulans (t | 0.628 | 0.503 | 0.521 | 5.4e-53 | |
| UNIPROTKB|A4R606 | 300 | MGG_10368 "Putative heme-bindi | 0.628 | 0.523 | 0.552 | 1.8e-52 | |
| ASPGD|ASPL0000044163 | 361 | ccp1 [Emericella nidulans (tax | 0.972 | 0.673 | 0.412 | 9.5e-50 | |
| UNIPROTKB|O04873 | 421 | O04873 "Thylakoid-bound ascorb | 0.964 | 0.572 | 0.432 | 9.8e-48 | |
| UNIPROTKB|A4QVH4 | 362 | CCP1 "Cytochrome c peroxidase, | 0.868 | 0.599 | 0.432 | 1.8e-46 | |
| CGD|CAL0000335 | 291 | orf19.584 [Candida albicans (t | 0.632 | 0.542 | 0.5 | 7.6e-44 |
| TAIR|locus:2074914 APX2 "ascorbate peroxidase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1071 (382.1 bits), Expect = 2.4e-108, P = 2.4e-108
Identities = 197/248 (79%), Positives = 215/248 (86%)
Query: 3 KCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTIRH 62
K YP+V +EY+KAV++CKRKLRGLIAEKHCAPI+LRLAWHSAGT+DV TKTGGPFGTIRH
Sbjct: 4 KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRH 63
Query: 63 PDELAHEANNGLDIAVRLLEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRPDK 122
P ELAH+ANNGLDIAVRLL+PI++ FPILSYADFYQLAGVVAVE+TGGPEIPFHPGR DK
Sbjct: 64 PQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDK 123
Query: 123 SDPPPEGRLPNATKGSDHLRDVFGHMGLSDKEIVVLSGGHTLGRCHKERSGFEGPWTNNP 182
+PPPEGRLP ATKG DHLRDVFG MGL+DK+IV LSGGHTLGRCHKERSGFEG WT NP
Sbjct: 124 VEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNP 183
Query: 183 LIFDNSYFXXXXXXXXXXXXXXPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLKLS 242
LIFDNSYF P+DKALL+DP+F P VEKYAADEDA F DY EAHLKLS
Sbjct: 184 LIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLS 243
Query: 243 ELGFADAE 250
ELGFAD E
Sbjct: 244 ELGFADKE 251
|
|
| TAIR|locus:2026616 APX1 "ascorbate peroxidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131586 APX3 "ascorbate peroxidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125409 APX5 "ascorbate peroxidase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000029968 AN5440 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4R606 MGG_10368 "Putative heme-binding peroxidase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000044163 ccp1 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O04873 O04873 "Thylakoid-bound ascorbate peroxidase" [Cucurbita cv. Kurokawa Amakuri (taxid:3666)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4QVH4 CCP1 "Cytochrome c peroxidase, mitochondrial" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000335 orf19.584 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.XVI.2663.1 | SubName- Full=Putative uncharacterized protein; (245 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.XVI.1375.1 | • | 0.899 | |||||||||
| estExt_fgenesh4_pm.C_280146 | • | 0.899 | |||||||||
| estExt_fgenesh4_pg.C_LG_I2142 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 250 | |||
| PLN02879 | 251 | PLN02879, PLN02879, L-ascorbate peroxidase | 1e-159 | |
| cd00691 | 253 | cd00691, ascorbate_peroxidase, Ascorbate peroxidas | 1e-156 | |
| PLN02364 | 250 | PLN02364, PLN02364, L-ascorbate peroxidase 1 | 1e-145 | |
| PLN02608 | 289 | PLN02608, PLN02608, L-ascorbate peroxidase | 1e-143 | |
| cd00314 | 255 | cd00314, plant_peroxidase_like, Heme-dependent per | 4e-66 | |
| pfam00141 | 180 | pfam00141, peroxidase, Peroxidase | 2e-53 | |
| COG0376 | 730 | COG0376, KatG, Catalase (peroxidase I) [Inorganic | 2e-39 | |
| cd00693 | 298 | cd00693, secretory_peroxidase, Horseradish peroxid | 1e-25 | |
| cd00649 | 409 | cd00649, catalase_peroxidase_1, N-terminal catalyt | 1e-24 | |
| cd00692 | 328 | cd00692, ligninase, Ligninase and other manganese- | 1e-23 | |
| TIGR00198 | 716 | TIGR00198, cat_per_HPI, catalase/peroxidase HPI | 3e-23 | |
| PRK15061 | 726 | PRK15061, PRK15061, catalase/hydroperoxidase HPI(I | 5e-22 | |
| cd08201 | 264 | cd08201, plant_peroxidase_like_1, Uncharacterized | 2e-13 | |
| PLN03030 | 324 | PLN03030, PLN03030, cationic peroxidase; Provision | 1e-05 | |
| cd08200 | 297 | cd08200, catalase_peroxidase_2, C-terminal non-cat | 1e-05 | |
| TIGR00198 | 716 | TIGR00198, cat_per_HPI, catalase/peroxidase HPI | 3e-05 | |
| COG0376 | 730 | COG0376, KatG, Catalase (peroxidase I) [Inorganic | 4e-05 | |
| PRK15061 | 726 | PRK15061, PRK15061, catalase/hydroperoxidase HPI(I | 8e-04 |
| >gnl|CDD|178467 PLN02879, PLN02879, L-ascorbate peroxidase | Back alignment and domain information |
|---|
Score = 441 bits (1134), Expect = e-159
Identities = 210/250 (84%), Positives = 230/250 (92%)
Query: 1 MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTI 60
+ K YP+V +EY+KAV++CKRKLRGLIAEKHCAPI+LRLAWHSAGT+DV TKTGGPFGTI
Sbjct: 2 VKKSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTI 61
Query: 61 RHPDELAHEANNGLDIAVRLLEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP 120
RHP ELAH+ANNGLDIAVRLL+PI++ FPILSYADFYQLAGVVAVE+TGGPEIPFHPGR
Sbjct: 62 RHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRL 121
Query: 121 DKSDPPPEGRLPNATKGSDHLRDVFGHMGLSDKEIVVLSGGHTLGRCHKERSGFEGPWTN 180
DK +PPPEGRLP ATKG DHLRDVFG MGL+DK+IV LSGGHTLGRCHKERSGFEG WT
Sbjct: 122 DKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTP 181
Query: 181 NPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLK 240
NPLIFDNSYFKE+LSGEKEGLLQLP+DKALL+DP+F P VEKYAADEDA F DY EAHLK
Sbjct: 182 NPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLK 241
Query: 241 LSELGFADAE 250
LSELGFAD E
Sbjct: 242 LSELGFADKE 251
|
Length = 251 |
| >gnl|CDD|173825 cd00691, ascorbate_peroxidase, Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|166005 PLN02364, PLN02364, L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178218 PLN02608, PLN02608, L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|173823 cd00314, plant_peroxidase_like, Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|215745 pfam00141, peroxidase, Peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173827 cd00693, secretory_peroxidase, Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|173824 cd00649, catalase_peroxidase_1, N-terminal catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|173826 cd00692, ligninase, Ligninase and other manganese-dependent fungal peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173829 cd08201, plant_peroxidase_like_1, Uncharacterized family of plant peroxidase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215545 PLN03030, PLN03030, cationic peroxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173828 cd08200, catalase_peroxidase_2, C-terminal non-catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| PLN02879 | 251 | L-ascorbate peroxidase | 100.0 | |
| PLN02364 | 250 | L-ascorbate peroxidase 1 | 100.0 | |
| PLN02608 | 289 | L-ascorbate peroxidase | 100.0 | |
| cd00691 | 253 | ascorbate_peroxidase Ascorbate peroxidases and cyt | 100.0 | |
| PLN03030 | 324 | cationic peroxidase; Provisional | 100.0 | |
| cd00693 | 298 | secretory_peroxidase Horseradish peroxidase and re | 100.0 | |
| cd00692 | 328 | ligninase Ligninase and other manganese-dependent | 100.0 | |
| cd00649 | 409 | catalase_peroxidase_1 N-terminal catalytic domain | 100.0 | |
| cd00314 | 255 | plant_peroxidase_like Heme-dependent peroxidases s | 100.0 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 100.0 | |
| PF00141 | 230 | peroxidase: Peroxidase; InterPro: IPR002016 Peroxi | 100.0 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 100.0 | |
| cd08201 | 264 | plant_peroxidase_like_1 Uncharacterized family of | 100.0 | |
| cd08200 | 297 | catalase_peroxidase_2 C-terminal non-catalytic dom | 100.0 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 100.0 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 100.0 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 100.0 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 99.9 |
| >PLN02879 L-ascorbate peroxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-78 Score=532.43 Aligned_cols=250 Identities=84% Similarity=1.407 Sum_probs=244.0
Q ss_pred CCCCCCChhHHHHHHHHHHHHHHHHHHhcCCchhHHHHHhhccccccccCCCCCCCCCcccCcccccccccCchHHHHHH
Q 025588 1 MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTIRHPDELAHEANNGLDIAVRL 80 (250)
Q Consensus 1 ~~~~cp~~~~~~~~~v~~~~~~~~~~~~~~~~a~~~lRl~FHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~ 80 (250)
|.+.||.+-+.|+++++.++++|.+++.+++++|.+|||+||||+|||..+++|||||||++++|+++++|.||+.++++
T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~vRla~Hdagt~~~~~~~GG~~Gsirf~~E~~~~~N~gL~~~~~~ 81 (251)
T PLN02879 2 VKKSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRL 81 (251)
T ss_pred CcccCCCccHHHHHHHHHHHHHHHHHHhCCCchhHhHHHHHhhhccccCCCCCCCCCeeecChhhccCCCcCChHHHHHH
Confidence 56899999999999999999999999999999999999999999999999999999999999999999999999989999
Q ss_pred HHHHHhhCCCCcHHHHHHhhhhhhhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHHhhcCCChhhhhHhhc
Q 025588 81 LEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRPDKSDPPPEGRLPNATKGSDHLRDVFGHMGLSDKEIVVLSG 160 (250)
Q Consensus 81 i~~ik~~~~~vS~ADiialaa~~av~~~GGP~~~~~~GR~D~~~~~~~~~lP~~~~~~~~l~~~F~~~Gl~~~e~VaL~G 160 (250)
|++||+++++|||||||+||+++||+.+|||.|+|++||+|+..++++++||.|+.+++++++.|+++||+++|||||+|
T Consensus 82 i~~iK~~~~~VScADilalAa~~AV~~~GGP~~~~~~GR~D~~~~~~~~~lP~p~~~~~~l~~~F~~~Gl~~~dlVALsG 161 (251)
T PLN02879 82 LDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSG 161 (251)
T ss_pred HHHHHHHcCCcCHHHHHHHHHHHHHHhcCCCccCCCCCCCCCCCCCcccCCCCCCCCHHHHHHHHHHcCCCHHHHeeeec
Confidence 99999999999999999999999999999999999999999999998999999999999999999999999999999999
Q ss_pred cccccccccCCCCCCCCCCCCCCccChHHHHHHhccccCCccccchhhhcccCCCcHHHHHHhhcChHHHHHHHHHHHHH
Q 025588 161 GHTLGRCHKERSGFEGPWTNNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLK 240 (250)
Q Consensus 161 aHtiG~~~~~~~~~~g~~~~tp~~fDN~Yy~~ll~~~~~gll~l~sD~~L~~d~~t~~~v~~yA~~~~~F~~~Fa~am~K 240 (250)
|||||++||.++++.|+|+.||.+|||+||++|+.++.+|+++|+||++|+.|++|+++|++||.||+.|+++|+.||+|
T Consensus 162 aHTiG~ah~~r~g~~g~~d~tp~~FDN~Yy~~ll~~~~~gll~L~SD~aL~~D~~t~~~V~~~A~d~~~F~~~Fa~Am~K 241 (251)
T PLN02879 162 GHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLK 241 (251)
T ss_pred cccccccccccccCCCCCCCCccceeHHHHHHHHcCCcCCCccchhhHHHhcCCcHHHHHHHHhhCHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999877799999999999999999999999999999999999999999
Q ss_pred HHhCCCCCCC
Q 025588 241 LSELGFADAE 250 (250)
Q Consensus 241 m~~~gv~~~~ 250 (250)
|+++|+.++|
T Consensus 242 L~~lg~~~~~ 251 (251)
T PLN02879 242 LSELGFADKE 251 (251)
T ss_pred HHccCCCCCC
Confidence 9999999986
|
|
| >PLN02364 L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
| >PLN02608 L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >cd00691 ascorbate_peroxidase Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
| >PLN03030 cationic peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd00693 secretory_peroxidase Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
| >cd00692 ligninase Ligninase and other manganese-dependent fungal peroxidases | Back alignment and domain information |
|---|
| >cd00649 catalase_peroxidase_1 N-terminal catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >cd00314 plant_peroxidase_like Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PF00141 peroxidase: Peroxidase; InterPro: IPR002016 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >cd08201 plant_peroxidase_like_1 Uncharacterized family of plant peroxidase-like proteins | Back alignment and domain information |
|---|
| >cd08200 catalase_peroxidase_2 C-terminal non-catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 250 | ||||
| 2xif_A | 249 | The Structure Of Ascorbate Peroxidase Compound Ii L | 1e-113 | ||
| 1apx_A | 249 | Crystal Structure Of Recombinant Ascorbate Peroxida | 1e-113 | ||
| 2y6b_A | 249 | Ascorbate Peroxidase R38k Mutant Length = 249 | 1e-113 | ||
| 1oaf_A | 261 | Ascobate Peroxidase From Soybean Cytosol In Complex | 1e-113 | ||
| 2vcf_X | 264 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 1e-113 | ||
| 2y6a_A | 249 | Ascorbate Peroxidase R38a Mutant Length = 249 | 1e-112 | ||
| 2cl4_X | 261 | Ascorbate Peroxidase R172a Mutant Length = 261 | 1e-112 | ||
| 2vcs_A | 261 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 1e-112 | ||
| 3zcy_A | 249 | Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | 1e-111 | ||
| 2ggn_X | 261 | Conformational Mobility In The Active Site Of A Hem | 1e-111 | ||
| 3zch_A | 261 | Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | 1e-110 | ||
| 3zcg_A | 261 | Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | 1e-110 | ||
| 1iyn_A | 295 | Crystal Structure Of Chloroplastic Ascorbate Peroxi | 1e-53 | ||
| 1jci_A | 294 | Stabilization Of The Engineered Cation-Binding Loop | 3e-45 | ||
| 4ged_A | 268 | Crystal Structure Of The Leishmania Major Peroxidas | 5e-45 | ||
| 3riv_A | 271 | The Crystal Structure Of Leishmania Major Peroxidas | 5e-45 | ||
| 1stq_A | 294 | Cyrstal Structure Of Cytochrome C Peroxidase Mutant | 5e-45 | ||
| 1jdr_A | 294 | Crystal Structure Of A Proximal Domain Potassium Bi | 2e-44 | ||
| 1sog_A | 294 | Cyrstal Structure Of Cytochrome C Peroxidase Mutant | 3e-44 | ||
| 3riw_A | 271 | The Crystal Structure Of Leishmania Major Peroxidas | 7e-44 | ||
| 3e2n_A | 287 | Engineering Ascorbate Peroxidase Activity Into Cyto | 2e-43 | ||
| 1krj_A | 294 | Engineering Calcium-Binding Site Into Cytochrome C | 6e-43 | ||
| 2v2e_A | 294 | Structure Of Isoniazid (Inh) Bound To Cytochrome C | 1e-41 | ||
| 4a71_A | 296 | Cytochrome C Peroxidase In Complex With Phenol Leng | 1e-41 | ||
| 2v23_A | 296 | Structure Of Cytochrome C Peroxidase Mutant N184r Y | 1e-41 | ||
| 3m23_A | 291 | Crystallographic And Single Crystal Spectral Analys | 2e-41 | ||
| 4a78_A | 296 | Cytochrome C Peroxidase M119w In Complex With Guiac | 8e-41 | ||
| 2xil_A | 294 | The Structure Of Cytochrome C Peroxidase Compound I | 8e-41 | ||
| 2xj5_A | 294 | The Structure Of Cytochrome C Peroxidase Compound I | 9e-41 | ||
| 3r98_A | 293 | Joint Neutron And X-Ray Structure Of Cytochrome C P | 1e-40 | ||
| 1kok_A | 294 | Crystal Structure Of Mesopone Cytochrome C Peroxida | 1e-40 | ||
| 1ebe_A | 294 | Laue Diffraction Study On The Structure Of Cytochro | 1e-40 | ||
| 3e2o_A | 294 | Crystal Structure Of Cytochrome C Peroxidase, N184r | 1e-40 | ||
| 4a7m_A | 296 | Cytochrome C Peroxidase S81w Mutant Length = 296 | 2e-40 | ||
| 1s6v_A | 294 | Structure Of A Cytochrome C Peroxidase-Cytochrome C | 2e-40 | ||
| 2x07_A | 293 | Cytochrome C Peroxidase: Engineered Ascorbate Bindi | 4e-40 | ||
| 1mk8_A | 294 | Crystal Structure Of A Mutant Cytochrome C Peroxida | 4e-40 | ||
| 1cck_A | 291 | Altering Substrate Specificity Of Cytochrome C Pero | 6e-40 | ||
| 1a2f_A | 291 | Probing The Strength And Character Of An Asp-His-X | 1e-39 | ||
| 1bek_A | 291 | Effect Of Unnatural Heme Substitution On Kinetics O | 1e-39 | ||
| 1cyf_A | 296 | Identifying The Physiological Electron Transfer Sit | 2e-39 | ||
| 1cca_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 2e-39 | ||
| 2gb8_A | 294 | Solution Structure Of The Complex Between Yeast Iso | 2e-39 | ||
| 2pcb_A | 296 | Crystal Structure Of A Complex Between Electron Tra | 2e-39 | ||
| 1bep_A | 291 | Effect Of Unnatural Heme Substitution On Kinetics O | 2e-39 | ||
| 1a2g_A | 291 | Probing The Strength And Character Of An Asp-His-X | 2e-39 | ||
| 2cep_A | 296 | Role Of Met-230 In Intramolecular Electron Transfer | 2e-39 | ||
| 6ccp_A | 296 | Effect Of Arginine-48 Replacement On The Reaction B | 5e-39 | ||
| 4ccx_A | 294 | Altering Substrate Specificity At The Heme Edge Of | 6e-39 | ||
| 1ccb_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 6e-39 | ||
| 2ccp_A | 296 | X-Ray Structures Of Recombinant Yeast Cytochrome C | 6e-39 | ||
| 1ccl_A | 291 | Probing The Strength And Character Of An Asp-His-X | 6e-39 | ||
| 3ccx_A | 294 | Altering Substrate Specificity At The Heme Edge Of | 7e-39 | ||
| 1cci_A | 294 | How Flexible Are Proteins? Trapping Of A Flexible L | 9e-39 | ||
| 1dj1_A | 291 | Crystal Structure Of R48a Mutant Of Cytochrome C Pe | 1e-38 | ||
| 1ccc_A | 297 | The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con | 2e-38 | ||
| 7ccp_A | 296 | Effect Of Arginine-48 Replacement On The Reaction B | 2e-38 | ||
| 1cce_A | 291 | Construction Of A Bis-Aquo Heme Enzyme And Replacem | 2e-38 | ||
| 1ds4_A | 292 | Cytochrome C Peroxidase H175g Mutant, Imidazole Com | 2e-38 | ||
| 1bva_A | 294 | Manganese Binding Mutant In Cytochrome C Peroxidase | 3e-38 | ||
| 1beq_A | 291 | Interaction Between Proximal And Distals Regions Of | 3e-38 | ||
| 5ccp_A | 296 | Histidine 52 Is A Critical Residue For Rapid Format | 3e-38 | ||
| 4ccp_A | 296 | X-Ray Structures Of Recombinant Yeast Cytochrome C | 4e-38 | ||
| 1dcc_A | 296 | 2.2 Angstrom Structure Of Oxyperoxidase: A Model Fo | 4e-38 | ||
| 1dse_A | 292 | Cytochrome C Peroxidase H175g Mutant, Imidazole Com | 5e-38 | ||
| 2ia8_A | 291 | Kinetic And Crystallographic Studies Of A Redesigne | 5e-38 | ||
| 1cpg_A | 296 | A Cation Binding Motif Stabilizes The Compound I Ra | 6e-38 | ||
| 1kxm_A | 290 | Crystal Structure Of Cytochrome C Peroxidase With A | 8e-38 | ||
| 1kxn_A | 289 | Crystal Structure Of Cytochrome C Peroxidase With A | 9e-38 | ||
| 1bem_A | 291 | Interaction Between Proximal And Distals Regions Of | 9e-38 | ||
| 3exb_A | 295 | Crystal Structure Of Cytochrome C Peroxidase With A | 9e-38 | ||
| 2aqd_A | 294 | Cytochrome C Peroxidase (Ccp) In Complex With 2,5- | 9e-38 | ||
| 1cpd_A | 296 | A Cation Binding Motif Stabilizes The Compound I Ra | 1e-37 | ||
| 1bej_A | 291 | Interaction Between Proximal And Distals Regions Of | 1e-37 | ||
| 2anz_A | 294 | Cytochrome C Peroxidase In Complex With 2,6-Diamino | 1e-37 | ||
| 2rbu_X | 292 | Cytochrome C Peroxidase In Complex With Cyclopentan | 1e-37 | ||
| 1cmu_A | 294 | The Role Of Aspartate-235 In The Binding Of Cations | 3e-37 | ||
| 1ub2_A | 720 | Crystal Structure Of Catalase-Peroxidase From Synec | 6e-15 | ||
| 2dv1_A | 748 | Crystal Structure Of D141e Mutant Of Bpkatg Length | 5e-13 | ||
| 3n3s_A | 748 | Crystal Structure Of The E198a Variant Of Burkholde | 5e-13 | ||
| 1mwv_A | 714 | Crystal Structure Of Catalase-peroxidase Katg Of Bu | 5e-13 | ||
| 3rrw_A | 268 | Crystal Structure Of The Tl29 Protein From Arabidop | 5e-13 | ||
| 2fxg_A | 748 | Crystal Structure Of Katg At Ph 4.5 Length = 748 | 6e-13 | ||
| 3n3q_A | 748 | Crystal Structure Of The S324t Variant Of Burkholde | 6e-13 | ||
| 1x7u_A | 748 | Crystal Structure Of The S324t Of Catalase-Peroxida | 6e-13 | ||
| 3vlh_A | 737 | Crystal Structure Analysis Of The Arg409leu Variant | 5e-12 | ||
| 1itk_A | 731 | Crystal Structure Of Catalase-peroxidase From Haloa | 5e-12 | ||
| 4fef_A | 315 | The Crystal Structures Of Several Mutants Of Pleuro | 7e-12 | ||
| 2w23_A | 316 | Structure Of Mutant W169y Of Pleurotus Eryngii Vers | 9e-12 | ||
| 3uw8_A | 737 | Crystal Structure Analysis Of The Ser305thr Variant | 9e-12 | ||
| 3fm1_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 1e-11 | ||
| 3fmu_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 1e-11 | ||
| 4fdq_A | 315 | The Crystal Structures Of Several Mutants Of Pleuro | 1e-11 | ||
| 4g05_A | 317 | The Crystal Structures Of Several Mutants Of Pleuro | 1e-11 | ||
| 3vlk_A | 737 | Crystal Structure Analysis Of The Ser305ala Variant | 1e-11 | ||
| 3fm6_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 1e-11 | ||
| 2vka_A | 317 | Site-directed Mutagenesis Of The Catalytic Tryptoph | 1e-11 | ||
| 2boq_A | 331 | Crystal Structure Of Versatile Peroxidase Length = | 1e-11 | ||
| 3fkg_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 1e-11 | ||
| 3fjw_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 2e-11 | ||
| 3fm4_A | 331 | Crystal Structure Analysis Of Fungal Versatile Pero | 2e-11 | ||
| 2dv2_A | 748 | Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8 | 2e-11 | ||
| 3n3r_A | 748 | Crystal Structure Of The E198a Variant Of Catalase- | 3e-11 | ||
| 2fxj_A | 748 | Crystal Structure Of Katg At Ph 8.5 Length = 748 | 3e-11 | ||
| 3vlm_A | 737 | Crystal Structure Analysis Of The Met244ala Variant | 3e-11 | ||
| 4fcs_A | 315 | The Crystal Structures Of Several Mutants Of Pleuro | 6e-11 | ||
| 4fcn_A | 319 | The Crystal Structures Of Several Mutants Of Pleuro | 6e-11 | ||
| 3q3u_A | 338 | Trametes Cervina Lignin Peroxidase Length = 338 | 2e-10 | ||
| 1mn2_A | 357 | Manganese Peroxidase Substrate Binding Site Mutant | 1e-09 | ||
| 1mn1_A | 357 | Manganese Peroxidase Substrate Binding Site Mutant | 1e-09 | ||
| 1yyd_A | 357 | High Resolution Crystal Structure Of Manganese Pero | 3e-09 | ||
| 2cca_A | 740 | Crystal Structure Of The Catalase-Peroxidase (Katg) | 2e-08 | ||
| 1sj2_A | 743 | Crystal Structure Of Mycobacterium Tuberculosis Cat | 2e-08 | ||
| 2ccd_A | 740 | Crystal Structure Of The Catalase-Peroxidase (Katg) | 4e-08 | ||
| 1b85_A | 351 | Lignin Peroxidase Length = 351 | 1e-07 | ||
| 3ut2_A | 764 | Crystal Structure Of Fungal Magkatg2 Length = 764 | 1e-07 | ||
| 1b80_A | 351 | Rec. Lignin Peroxidase H8 Oxidatively Processed Len | 2e-07 | ||
| 1b82_A | 351 | Pristine Recomb. Lignin Peroxidase H8 Length = 351 | 2e-07 | ||
| 4a5g_A | 308 | Raphanus Sativus Anionic Peroxidase. Length = 308 | 6e-07 | ||
| 1lga_A | 343 | Crystallographic Refinement Of Lignin Peroxidase At | 2e-06 | ||
| 1ly8_A | 343 | The Crystal Structure Of A Mutant Enzyme Of Coprinu | 1e-05 | ||
| 1fhf_A | 304 | The Structure Of Soybean Peroxidase Length = 304 | 4e-05 | ||
| 1qpa_A | 345 | Lignin Peroxidase Isozyme Lip4.65 (Pi 4.65) Length | 4e-05 | ||
| 1ly9_A | 343 | The Impact Of The Physical And Chemical Environment | 8e-05 | ||
| 1lyk_A | 343 | The Impact Of The Physical And Chemical Enviroment | 9e-05 | ||
| 1ck6_A | 344 | Binding Mode Of Salicylhydroxamic Acid To Arthromyc | 1e-04 | ||
| 1pa2_A | 306 | Arabidopsis Thaliana Peroxidase A2 Length = 306 | 1e-04 | ||
| 1gx2_A | 309 | Recombinant Horseradish Peroxidase Phe209ser Comple | 4e-04 | ||
| 1gwo_A | 309 | Recombinant Horseradish Peroxidase C1a Ala170gln Le | 6e-04 | ||
| 1atj_A | 306 | Recombinant Horseradish Peroxidase C1a Length = 306 | 6e-04 | ||
| 2atj_A | 308 | Recombinant Horseradish Peroxidase Complex With Ben | 6e-04 | ||
| 6atj_A | 308 | Recombinant Horseradish Peroxidase C Complex With F | 6e-04 | ||
| 3atj_A | 309 | Heme Ligand Mutant Of Recombinant Horseradish Perox | 6e-04 | ||
| 1kzm_A | 308 | Distal Heme Pocket Mutant (r38s/h42e) Of Recombinan | 6e-04 | ||
| 4atj_A | 309 | Distal Heme Pocket Mutant (H42e) Of Recombinant Hor | 7e-04 | ||
| 1u2k_A | 309 | Crystal Structure Of The C-Terminal Domain From The | 7e-04 | ||
| 1gwu_A | 309 | Recombinant Horseradish Peroxidase C1a Ala140gly Le | 8e-04 | ||
| 1u2j_A | 326 | Crystal Structure Of The C-Terminal Domain From The | 9e-04 | ||
| 1h3j_A | 342 | Structure Of Recombinant Coprinus Cinereus Peroxida | 9e-04 |
| >pdb|2XIF|A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii Length = 249 | Back alignment and structure |
|
| >pdb|1APX|A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase Length = 249 | Back alignment and structure |
| >pdb|2Y6B|A Chain A, Ascorbate Peroxidase R38k Mutant Length = 249 | Back alignment and structure |
| >pdb|1OAF|A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex With Ascorbate Length = 261 | Back alignment and structure |
| >pdb|2VCF|X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Length = 264 | Back alignment and structure |
| >pdb|2Y6A|A Chain A, Ascorbate Peroxidase R38a Mutant Length = 249 | Back alignment and structure |
| >pdb|2CL4|X Chain X, Ascorbate Peroxidase R172a Mutant Length = 261 | Back alignment and structure |
| >pdb|2VCS|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Mutant H42a Length = 261 | Back alignment and structure |
| >pdb|3ZCY|A Chain A, Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | Back alignment and structure |
| >pdb|2GGN|X Chain X, Conformational Mobility In The Active Site Of A Heme Peroxidase Length = 261 | Back alignment and structure |
| >pdb|3ZCH|A Chain A, Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | Back alignment and structure |
| >pdb|3ZCG|A Chain A, Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | Back alignment and structure |
| >pdb|1IYN|A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability Length = 295 | Back alignment and structure |
| >pdb|1JCI|A Chain A, Stabilization Of The Engineered Cation-Binding Loop In Cytochrome C Peroxidase (Ccp) Length = 294 | Back alignment and structure |
| >pdb|4GED|A Chain A, Crystal Structure Of The Leishmania Major Peroxidase-Cytochrome C Complex Length = 268 | Back alignment and structure |
| >pdb|3RIV|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Length = 271 | Back alignment and structure |
| >pdb|1STQ|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m3 Length = 294 | Back alignment and structure |
| >pdb|1JDR|A Chain A, Crystal Structure Of A Proximal Domain Potassium Binding Variant Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1SOG|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m2 Length = 294 | Back alignment and structure |
| >pdb|3RIW|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Mutant C197t Length = 271 | Back alignment and structure |
| >pdb|3E2N|A Chain A, Engineering Ascorbate Peroxidase Activity Into Cytochrome C Peroxidase Length = 287 | Back alignment and structure |
| >pdb|1KRJ|A Chain A, Engineering Calcium-Binding Site Into Cytochrome C Peroxidase (Ccp) Length = 294 | Back alignment and structure |
| >pdb|2V2E|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytochrome C Peroxidase Mutant N184r Y36a Length = 294 | Back alignment and structure |
| >pdb|4A71|A Chain A, Cytochrome C Peroxidase In Complex With Phenol Length = 296 | Back alignment and structure |
| >pdb|2V23|A Chain A, Structure Of Cytochrome C Peroxidase Mutant N184r Y36a Length = 296 | Back alignment and structure |
| >pdb|3M23|A Chain A, Crystallographic And Single Crystal Spectral Analysis Of The Peroxidase Ferryl Intermediate Length = 291 | Back alignment and structure |
| >pdb|4A78|A Chain A, Cytochrome C Peroxidase M119w In Complex With Guiacol Length = 296 | Back alignment and structure |
| >pdb|2XIL|A Chain A, The Structure Of Cytochrome C Peroxidase Compound I Length = 294 | Back alignment and structure |
| >pdb|2XJ5|A Chain A, The Structure Of Cytochrome C Peroxidase Compound Ii Length = 294 | Back alignment and structure |
| >pdb|3R98|A Chain A, Joint Neutron And X-Ray Structure Of Cytochrome C Peroxidase Length = 293 | Back alignment and structure |
| >pdb|1KOK|A Chain A, Crystal Structure Of Mesopone Cytochrome C Peroxidase (Mpccp) Length = 294 | Back alignment and structure |
| >pdb|1EBE|A Chain A, Laue Diffraction Study On The Structure Of Cytochrome C Peroxidase Compound I Length = 294 | Back alignment and structure |
| >pdb|3E2O|A Chain A, Crystal Structure Of Cytochrome C Peroxidase, N184r Mutant Length = 294 | Back alignment and structure |
| >pdb|4A7M|A Chain A, Cytochrome C Peroxidase S81w Mutant Length = 296 | Back alignment and structure |
| >pdb|1S6V|A Chain A, Structure Of A Cytochrome C Peroxidase-Cytochrome C Site Specific Cross-Link Length = 294 | Back alignment and structure |
| >pdb|2X07|A Chain A, Cytochrome C Peroxidase: Engineered Ascorbate Binding Site Length = 293 | Back alignment and structure |
| >pdb|1MK8|A Chain A, Crystal Structure Of A Mutant Cytochrome C Peroxidase Showing A Novel Trp-Tyr Covalent Cross-Link Length = 294 | Back alignment and structure |
| >pdb|1CCK|A Chain A, Altering Substrate Specificity Of Cytochrome C Peroxidase Towards A Small Molecular Substrate Peroxidase By Substituting Tyrosine For Phe 202 Length = 291 | Back alignment and structure |
| >pdb|1A2F|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|1BEK|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1CYF|A Chain A, Identifying The Physiological Electron Transfer Site Of Cytochrome C Peroxidase By Structure-Based Engineering Length = 296 | Back alignment and structure |
| >pdb|1CCA|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|2GB8|A Chain A, Solution Structure Of The Complex Between Yeast Iso-1- Cytochrome C And Yeast Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|2PCB|A Chain A, Crystal Structure Of A Complex Between Electron Transfer Partners, Cytochrome C Peroxidase And Cytochrome C Length = 296 | Back alignment and structure |
| >pdb|1BEP|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1A2G|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|2CEP|A Chain A, Role Of Met-230 In Intramolecular Electron Transfer Between The Oxyferryl Heme And Trp 191 In Cytochrome C Peroxidase Compound Ii Length = 296 | Back alignment and structure |
| >pdb|6CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 | Back alignment and structure |
| >pdb|4CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1CCB|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|2CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 | Back alignment and structure |
| >pdb|1CCL|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 | Back alignment and structure |
| >pdb|3CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1CCI|A Chain A, How Flexible Are Proteins? Trapping Of A Flexible Loop Length = 294 | Back alignment and structure |
| >pdb|1DJ1|A Chain A, Crystal Structure Of R48a Mutant Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1CCC|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 | Back alignment and structure |
| >pdb|7CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 | Back alignment and structure |
| >pdb|1CCE|A Chain A, Construction Of A Bis-Aquo Heme Enzyme And Replacement With Exogenous Ligand Length = 291 | Back alignment and structure |
| >pdb|1DS4|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, Ph 6, 100k Length = 292 | Back alignment and structure |
| >pdb|1BVA|A Chain A, Manganese Binding Mutant In Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1BEQ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|5CCP|A Chain A, Histidine 52 Is A Critical Residue For Rapid Formation Of Cytochrome C Peroxidase Compound I Length = 296 | Back alignment and structure |
| >pdb|4CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 | Back alignment and structure |
| >pdb|1DCC|A Chain A, 2.2 Angstrom Structure Of Oxyperoxidase: A Model For The Enzyme:peroxide Complex Length = 296 | Back alignment and structure |
| >pdb|1DSE|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, With Phosphate Bound, Ph 6, 100k Length = 292 | Back alignment and structure |
| >pdb|2IA8|A Chain A, Kinetic And Crystallographic Studies Of A Redesigned Manganese-Binding Site In Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|1CPG|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 | Back alignment and structure |
| >pdb|1KXM|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 290 | Back alignment and structure |
| >pdb|1KXN|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 289 | Back alignment and structure |
| >pdb|1BEM|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|3EXB|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Pathway Excised In A Complex With A Peptide Wire Length = 295 | Back alignment and structure |
| >pdb|2AQD|A Chain A, Cytochrome C Peroxidase (Ccp) In Complex With 2,5- Diaminopyridine Length = 294 | Back alignment and structure |
| >pdb|1CPD|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 | Back alignment and structure |
| >pdb|1BEJ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 | Back alignment and structure |
| >pdb|2ANZ|A Chain A, Cytochrome C Peroxidase In Complex With 2,6-Diaminopyridine Length = 294 | Back alignment and structure |
| >pdb|2RBU|X Chain X, Cytochrome C Peroxidase In Complex With Cyclopentane-Carboximidamide Length = 292 | Back alignment and structure |
| >pdb|1CMU|A Chain A, The Role Of Aspartate-235 In The Binding Of Cations To An Artificial Cavity At The Radical Site Of Cytochrome C Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1UB2|A Chain A, Crystal Structure Of Catalase-Peroxidase From Synechococcus Pcc 7942 Length = 720 | Back alignment and structure |
| >pdb|2DV1|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg Length = 748 | Back alignment and structure |
| >pdb|3N3S|A Chain A, Crystal Structure Of The E198a Variant Of Burkholderia Pseudomallei Catalase-Peroxidase Katg With Inh Length = 748 | Back alignment and structure |
| >pdb|1MWV|A Chain A, Crystal Structure Of Catalase-peroxidase Katg Of Burkholderia Pseudomallei Length = 714 | Back alignment and structure |
| >pdb|3RRW|A Chain A, Crystal Structure Of The Tl29 Protein From Arabidopsis Thaliana Length = 268 | Back alignment and structure |
| >pdb|2FXG|A Chain A, Crystal Structure Of Katg At Ph 4.5 Length = 748 | Back alignment and structure |
| >pdb|3N3Q|A Chain A, Crystal Structure Of The S324t Variant Of Burkholderia Pseudomallei Katg With Isonicotinic Acid Hydrazide Bound Length = 748 | Back alignment and structure |
| >pdb|1X7U|A Chain A, Crystal Structure Of The S324t Of Catalase-Peroxidase Katg Length = 748 | Back alignment and structure |
| >pdb|3VLH|A Chain A, Crystal Structure Analysis Of The Arg409leu Variants Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|1ITK|A Chain A, Crystal Structure Of Catalase-peroxidase From Haloarcula Marismortui Length = 731 | Back alignment and structure |
| >pdb|4FEF|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 | Back alignment and structure |
| >pdb|2W23|A Chain A, Structure Of Mutant W169y Of Pleurotus Eryngii Versatile Peroxidase (Vp) Length = 316 | Back alignment and structure |
| >pdb|3UW8|A Chain A, Crystal Structure Analysis Of The Ser305thr Variants Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|3FM1|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|3FMU|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|4FDQ|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 | Back alignment and structure |
| >pdb|4G05|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 317 | Back alignment and structure |
| >pdb|3VLK|A Chain A, Crystal Structure Analysis Of The Ser305ala Variant Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|3FM6|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|2VKA|A Chain A, Site-directed Mutagenesis Of The Catalytic Tryptophan Environment In Pleurotus Eryngii Versatile Peroxidase Length = 317 | Back alignment and structure |
| >pdb|2BOQ|A Chain A, Crystal Structure Of Versatile Peroxidase Length = 331 | Back alignment and structure |
| >pdb|3FKG|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|3FJW|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|3FM4|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 | Back alignment and structure |
| >pdb|2DV2|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8.0 Length = 748 | Back alignment and structure |
| >pdb|3N3R|A Chain A, Crystal Structure Of The E198a Variant Of Catalase-Peroxidase Katg Of Burkholderia Pseudomallei Length = 748 | Back alignment and structure |
| >pdb|2FXJ|A Chain A, Crystal Structure Of Katg At Ph 8.5 Length = 748 | Back alignment and structure |
| >pdb|3VLM|A Chain A, Crystal Structure Analysis Of The Met244ala Variant Of Katg From Haloarcula Marismortui Length = 737 | Back alignment and structure |
| >pdb|4FCS|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 | Back alignment and structure |
| >pdb|4FCN|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 319 | Back alignment and structure |
| >pdb|3Q3U|A Chain A, Trametes Cervina Lignin Peroxidase Length = 338 | Back alignment and structure |
| >pdb|1MN2|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant E35q, D179n Length = 357 | Back alignment and structure |
| >pdb|1MN1|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant D179n Length = 357 | Back alignment and structure |
| >pdb|1YYD|A Chain A, High Resolution Crystal Structure Of Manganese Peroxidase Length = 357 | Back alignment and structure |
| >pdb|2CCA|A Chain A, Crystal Structure Of The Catalase-Peroxidase (Katg) And S315t Mutant From Mycobacterium Tuberculosis Length = 740 | Back alignment and structure |
| >pdb|1SJ2|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Catalase-Peroxidase Length = 743 | Back alignment and structure |
| >pdb|2CCD|A Chain A, Crystal Structure Of The Catalase-Peroxidase (Katg) And S315t Mutant From Mycobacterium Tuberculosis Length = 740 | Back alignment and structure |
| >pdb|1B85|A Chain A, Lignin Peroxidase Length = 351 | Back alignment and structure |
| >pdb|3UT2|A Chain A, Crystal Structure Of Fungal Magkatg2 Length = 764 | Back alignment and structure |
| >pdb|1B80|A Chain A, Rec. Lignin Peroxidase H8 Oxidatively Processed Length = 351 | Back alignment and structure |
| >pdb|1B82|A Chain A, Pristine Recomb. Lignin Peroxidase H8 Length = 351 | Back alignment and structure |
| >pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase. Length = 308 | Back alignment and structure |
| >pdb|1LGA|A Chain A, Crystallographic Refinement Of Lignin Peroxidase At 2 Angstroms Length = 343 | Back alignment and structure |
| >pdb|1LY8|A Chain A, The Crystal Structure Of A Mutant Enzyme Of Coprinus Cinereus Peroxidase Provides An Understanding Of Its Increased Thermostability And Insight Into Modelling Of Protein Structures Length = 343 | Back alignment and structure |
| >pdb|1FHF|A Chain A, The Structure Of Soybean Peroxidase Length = 304 | Back alignment and structure |
| >pdb|1QPA|A Chain A, Lignin Peroxidase Isozyme Lip4.65 (Pi 4.65) Length = 345 | Back alignment and structure |
| >pdb|1LY9|A Chain A, The Impact Of The Physical And Chemical Environment On The Molecular Structure Of Coprinus Cinereus Peroxidase Length = 343 | Back alignment and structure |
| >pdb|1LYK|A Chain A, The Impact Of The Physical And Chemical Enviroment On The Molecular Structure Of Coprinus Cinereus Peroxidase Length = 343 | Back alignment and structure |
| >pdb|1CK6|A Chain A, Binding Mode Of Salicylhydroxamic Acid To Arthromyces Ramosus Peroxidase Length = 344 | Back alignment and structure |
| >pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2 Length = 306 | Back alignment and structure |
| >pdb|1GX2|A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|1GWO|A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln Length = 309 | Back alignment and structure |
| >pdb|1ATJ|A Chain A, Recombinant Horseradish Peroxidase C1a Length = 306 | Back alignment and structure |
| >pdb|2ATJ|A Chain A, Recombinant Horseradish Peroxidase Complex With Benzhydroxamic Acid Length = 308 | Back alignment and structure |
| >pdb|6ATJ|A Chain A, Recombinant Horseradish Peroxidase C Complex With Ferulic Acid Length = 308 | Back alignment and structure |
| >pdb|3ATJ|A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|1KZM|A Chain A, Distal Heme Pocket Mutant (r38s/h42e) Of Recombinant Horseradish Peroxidase C (hrp C) Length = 308 | Back alignment and structure |
| >pdb|4ATJ|A Chain A, Distal Heme Pocket Mutant (H42e) Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|1U2K|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase- Peroxidase Katg Of Escherichia Coli (I41) Length = 309 | Back alignment and structure |
| >pdb|1GWU|A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly Length = 309 | Back alignment and structure |
| >pdb|1U2J|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase-Peroxidase Katg Of Escherichia Coli (P21 21 21) Length = 326 | Back alignment and structure |
| >pdb|1H3J|A Chain A, Structure Of Recombinant Coprinus Cinereus Peroxidase Determined To 2.0 A Length = 342 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 250 | |||
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 1e-142 | |
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 1e-133 | |
| 3e2o_A | 294 | CCP, cytochrome C peroxidase; cytochrome C peroxid | 1e-129 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 1e-126 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 1e-101 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 2e-98 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 2e-98 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 5e-97 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 8e-96 | |
| 3rrw_A | 268 | Thylakoid lumenal 29 kDa protein, chloroplastic; c | 3e-82 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 7e-34 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 7e-12 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 3e-32 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 5e-13 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 8e-32 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 4e-08 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 2e-30 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 4e-06 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 3e-28 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 1e-10 | |
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 6e-24 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 6e-24 | |
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 1e-22 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 5e-22 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 6e-22 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 3e-21 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 4e-20 | |
| 1u2k_A | 309 | Peroxidase/catalase HPI; KATG, catalase-peroxidase | 2e-08 |
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* Length = 271 | Back alignment and structure |
|---|
Score = 397 bits (1023), Expect = e-142
Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 21/258 (8%)
Query: 9 SDEYQKAVEKCKRKLRGLIAEK-HCAPIILRLAWHSAGTYDVNTKTGGP-FGTIRHPDEL 66
S+E + + + +I+EK P ++RLAWH A +YD K G P ++R E
Sbjct: 2 SEEPPFDIRALRADIEDMISEKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPEC 61
Query: 67 AHEANNGLDIAVRLLEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRPDKSDP- 125
+ N GLDI + LE +++++P +SYAD + LA VA+E GGP IPF GR D D
Sbjct: 62 LYAGNKGLDIPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGS 121
Query: 126 --PPEGRLPNATKGSDHLRDVFGHMGLSDKEIVVLSGGHTLGRCHKERSGFEGPWTNNPL 183
P+GRLP+ +K H+R+VF +G +D+E V L G HT G CH E SG+ GPWT++
Sbjct: 122 VCGPDGRLPDGSKTQSHVREVFRRLGFNDQETVALIGAHTCGECHIEFSGYHGPWTHDKN 181
Query: 184 IFDNSYFKELLSGE----------------KEGLLQLPSDKALLEDPVFRPLVEKYAADE 227
FDNS+F +LL + L+ LPSD LL DP +R VE YA D
Sbjct: 182 GFDNSFFTQLLDEDWVLNPKVEQMQLMDRATTKLMMLPSDVCLLLDPSYRKYVELYAKDN 241
Query: 228 DAVFADYAEAHLKLSELG 245
D D+A A KL+ELG
Sbjct: 242 DRFNKDFANAFKKLTELG 259
|
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Length = 261 | Back alignment and structure |
|---|
| >3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} PDB: 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* 1mk8_A* 1mkq_A* ... Length = 294 | Back alignment and structure |
|---|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Length = 295 | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* Length = 331 | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Length = 357 | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} Length = 338 | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Length = 344 | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Length = 343 | Back alignment and structure |
|---|
| >3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Length = 268 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 | Back alignment and structure |
|---|
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Length = 309 | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Length = 294 | Back alignment and structure |
|---|
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} Length = 304 | Back alignment and structure |
|---|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Length = 304 | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Length = 300 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Length = 306 | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Length = 309 | Back alignment and structure |
|---|
| >1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Length = 309 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 100.0 | |
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 100.0 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 100.0 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 100.0 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 100.0 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 100.0 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 100.0 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 100.0 | |
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 100.0 | |
| 3e2o_A | 294 | CCP, cytochrome C peroxidase; cytochrome C peroxid | 100.0 | |
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 100.0 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 100.0 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 100.0 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 100.0 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 100.0 | |
| 1u2k_A | 309 | Peroxidase/catalase HPI; KATG, catalase-peroxidase | 100.0 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 100.0 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 100.0 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 100.0 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 100.0 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 100.0 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 100.0 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 100.0 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 100.0 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 100.0 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 100.0 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 100.0 | |
| 3rrw_A | 268 | Thylakoid lumenal 29 kDa protein, chloroplastic; c | 100.0 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 100.0 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 100.0 |
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-79 Score=543.19 Aligned_cols=248 Identities=83% Similarity=1.350 Sum_probs=240.5
Q ss_pred CCCCCChhHHHHHHHHHHHHHHHHHHhcCCchhHHHHHhhccccccccCCCCCCCCCcccCcccccccccCchHHHHHHH
Q 025588 2 GKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTIRHPDELAHEANNGLDIAVRLL 81 (250)
Q Consensus 2 ~~~cp~~~~~~~~~v~~~~~~~~~~~~~~~~a~~~lRl~FHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~i 81 (250)
+++.|.+..+|+++++++|++|++++++++++|++|||+||||++||+|++.||+||||++.+|+++++|.+|.+++++|
T Consensus 13 ~~~~~~~~~~y~~~~~~~r~~v~~~~~d~~~aa~llRL~FHDc~gcD~s~~~gg~~gsi~~~~E~~~~~N~~l~~g~~~i 92 (261)
T 2vcn_A 13 GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL 92 (261)
T ss_dssp CCCCCCCCHHHHHC-CHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHH
T ss_pred CCcCCCCcHHHHHHHHHHHHHHHHHHhCCCchHHHHHHHHccCCCCCcccCCCCCCccccchhhccCccccCHHHHHHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999998899999
Q ss_pred HHHHhhCCCCcHHHHHHhhhhhhhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHH-hhcCCChhhhhHhhc
Q 025588 82 EPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRPDKSDPPPEGRLPNATKGSDHLRDVF-GHMGLSDKEIVVLSG 160 (250)
Q Consensus 82 ~~ik~~~~~vS~ADiialaa~~av~~~GGP~~~~~~GR~D~~~~~~~~~lP~~~~~~~~l~~~F-~~~Gl~~~e~VaL~G 160 (250)
++||+++++|||||||+|||++||+.+|||.|+|++||+|++++.+.++||.|+.++++|++.| +++||+++|||||+|
T Consensus 93 ~~iK~~~~~VScADilalAardaV~~~GGP~~~v~~GRrD~~~s~~~~~lP~p~~~~~~l~~~F~~~~Gl~~~d~VaLsG 172 (261)
T 2vcn_A 93 EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSG 172 (261)
T ss_dssp HHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHHTTTTCCCHHHHHHHHG
T ss_pred HHHHHHhCCCCHHHHHHHHhhhheeeccCCcccCcCCCCCCCCCCcccccCCcccCHHHHHHHHHhhCCCChHHheeecc
Confidence 9999999999999999999999999999999999999999999998899999999999999999 999999999999999
Q ss_pred cccccccccCCCCCCCCCCCCCCccChHHHHHHhccccCCccccchhhhcccCCCcHHHHHHhhcChHHHHHHHHHHHHH
Q 025588 161 GHTLGRCHKERSGFEGPWTNNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLK 240 (250)
Q Consensus 161 aHtiG~~~~~~~~~~g~~~~tp~~fDN~Yy~~ll~~~~~gll~l~sD~~L~~d~~t~~~v~~yA~~~~~F~~~Fa~am~K 240 (250)
|||||++||.+++|.|+|+.||.+|||+||++|+.++.+|+++|+||++|++|++|+++|+.||.||+.|+++|++||+|
T Consensus 173 aHTiG~ahc~r~~f~g~~~~tp~~FDN~Yy~~Ll~~~~~gll~L~SD~~L~~d~~t~~~V~~ya~~~~~F~~~Fa~Am~K 252 (261)
T 2vcn_A 173 GHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLVDKYAADEDAFFADYAEAHQK 252 (261)
T ss_dssp GGGSCEECTTTTSCCEESSSCTTSCSTHHHHHHHHCCCTTCCCCHHHHHHHHCTTHHHHHHHHHHCHHHHHHHHHHHHHH
T ss_pred CcccccccccCCCCCCCCCCcccccchHHHHHhhccCcCCcccchhhHHHhcCccHHHHHHHHhhCHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999866799989999999999999999999999999999999999999
Q ss_pred HHhCCCCCC
Q 025588 241 LSELGFADA 249 (250)
Q Consensus 241 m~~~gv~~~ 249 (250)
|+++|++++
T Consensus 253 m~~lg~~~~ 261 (261)
T 2vcn_A 253 LSELGFADA 261 (261)
T ss_dssp HHTTTSSCC
T ss_pred HHhcCCCCC
Confidence 999999974
|
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} SCOP: a.93.1.0 | Back alignment and structure |
|---|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} SCOP: a.93.1.1 PDB: 4a71_A* 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 4a6z_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* ... | Back alignment and structure |
|---|
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* 4ged_A* | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* 4fcn_A* 4g05_A* 4fcs_A* 4fef_A* 4fdq_A* | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} SCOP: a.93.1.0 | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* | Back alignment and structure |
|---|
| >1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 250 | ||||
| d1oafa_ | 250 | a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glyci | 1e-101 | |
| d2euta1 | 291 | a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {B | 3e-75 | |
| d1iyna_ | 275 | a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco | 2e-73 | |
| d2e39a1 | 336 | a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) { | 8e-65 | |
| d1yyda1 | 357 | a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) { | 2e-63 | |
| d1llpa_ | 343 | a.93.1.1 (A:) Fungal peroxidase (ligninase) {White | 3e-59 | |
| d1ub2a1 | 406 | a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Syne | 5e-54 | |
| d1mwva1 | 406 | a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burk | 4e-52 | |
| d1scha_ | 294 | a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hy | 9e-51 | |
| d1itka1 | 406 | a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Arch | 3e-50 | |
| d1pa2a_ | 306 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 4e-50 | |
| d1fhfa_ | 304 | a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine m | 1e-49 | |
| d1u2ka_ | 292 | a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholder | 6e-49 | |
| d1qgja_ | 300 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 4e-48 | |
| d1bgpa_ | 309 | a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vu | 5e-48 | |
| d1gwua_ | 307 | a.93.1.1 (A:) Plant peroxidase {Horseradish (Armor | 3e-47 | |
| d2ccaa1 | 410 | a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Myco | 6e-47 | |
| d1ub2a2 | 294 | a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Syn | 5e-46 | |
| d1itka2 | 308 | a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Arc | 4e-45 | |
| d1mwva2 | 308 | a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Bur | 4e-43 | |
| d2ccaa2 | 285 | a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Myc | 3e-40 |
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Ascorbate peroxidase species: Soybean (Glycine max) [TaxId: 3847]
Score = 292 bits (747), Expect = e-101
Identities = 209/249 (83%), Positives = 227/249 (91%), Gaps = 1/249 (0%)
Query: 2 GKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTIR 61
GK YP VS +YQKAVEK K+KLRG IAEK CAP++LRLAWHSAGT+D TKTGGPFGTI+
Sbjct: 2 GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIK 61
Query: 62 HPDELAHEANNGLDIAVRLLEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRPD 121
HP ELAH ANNGLDIAVRLLEP++ +FPILSYADFYQLAGVVAVEVTGGPE+PFHPGR D
Sbjct: 62 HPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRED 121
Query: 122 KSDPPPEGRLPNATKGSDHLRDVFGH-MGLSDKEIVVLSGGHTLGRCHKERSGFEGPWTN 180
K +PPPEGRLP+ATKGSDHLRDVFG MGL+D++IV LSGGHT+G HKERSGFEGPWT+
Sbjct: 122 KPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTS 181
Query: 181 NPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLK 240
NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPLV+KYAADEDA FADYAEAH K
Sbjct: 182 NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLVDKYAADEDAFFADYAEAHQK 241
Query: 241 LSELGFADA 249
LSELGFADA
Sbjct: 242 LSELGFADA 250
|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 291 | Back information, alignment and structure |
|---|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 275 | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Length = 336 | Back information, alignment and structure |
|---|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 357 | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 343 | Back information, alignment and structure |
|---|
| >d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 406 | Back information, alignment and structure |
|---|
| >d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 406 | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 294 | Back information, alignment and structure |
|---|
| >d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 406 | Back information, alignment and structure |
|---|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Length = 306 | Back information, alignment and structure |
|---|
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 304 | Back information, alignment and structure |
|---|
| >d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 292 | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Length = 300 | Back information, alignment and structure |
|---|
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Length = 309 | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Length = 307 | Back information, alignment and structure |
|---|
| >d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 410 | Back information, alignment and structure |
|---|
| >d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 294 | Back information, alignment and structure |
|---|
| >d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 308 | Back information, alignment and structure |
|---|
| >d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 308 | Back information, alignment and structure |
|---|
| >d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 285 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| d1oafa_ | 250 | Ascorbate peroxidase {Soybean (Glycine max) [TaxId | 100.0 | |
| d1iyna_ | 275 | Ascorbate peroxidase {Common tobacco (Nicotiana ta | 100.0 | |
| d1fhfa_ | 304 | Plant peroxidase {Soybean (Glycine max) [TaxId: 38 | 100.0 | |
| d1pa2a_ | 306 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1qgja_ | 300 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1bgpa_ | 309 | Plant peroxidase {Barley (Hordeum vulgare), peroxi | 100.0 | |
| d2euta1 | 291 | Cytochrome c peroxidase, CCP {Baker's yeast (Sacch | 100.0 | |
| d1scha_ | 294 | Plant peroxidase {Peanut (Arachis hypogaea) [TaxId | 100.0 | |
| d1gwua_ | 307 | Plant peroxidase {Horseradish (Armoracia rusticana | 100.0 | |
| d2e39a1 | 336 | Fungal peroxidase (ligninase) {Arthromyces ramosus | 100.0 | |
| d1yyda1 | 357 | Fungal peroxidase (ligninase) {Basidomycetos fungu | 100.0 | |
| d1llpa_ | 343 | Fungal peroxidase (ligninase) {White rot basidiomy | 100.0 | |
| d1itka1 | 406 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 100.0 | |
| d1mwva1 | 406 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d1mwva2 | 308 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d1u2ka_ | 292 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 100.0 | |
| d2ccaa1 | 410 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 100.0 | |
| d1ub2a2 | 294 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 100.0 | |
| d1ub2a1 | 406 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 100.0 | |
| d1itka2 | 308 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 100.0 | |
| d2ccaa2 | 285 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 100.0 |
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Ascorbate peroxidase species: Soybean (Glycine max) [TaxId: 3847]
Probab=100.00 E-value=2.9e-77 Score=524.30 Aligned_cols=248 Identities=84% Similarity=1.384 Sum_probs=240.9
Q ss_pred CCCCCChhHHHHHHHHHHHHHHHHHHhcCCchhHHHHHhhccccccccCCCCCCCCCcccCcccccccccCchHHHHHHH
Q 025588 2 GKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTIRHPDELAHEANNGLDIAVRLL 81 (250)
Q Consensus 2 ~~~cp~~~~~~~~~v~~~~~~~~~~~~~~~~a~~~lRl~FHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~i 81 (250)
+++||.++++|+++|+++++.|++++.++.++|++|||+||||++|+.++..||+|||+++.+|+++++|.||+.+.+++
T Consensus 2 ~ks~p~~~~~~~~~~~~~~~~~~~~~~~~~~ap~llRl~FHDc~tf~~~~~~gg~~gs~~~~~E~~~~~N~Gl~~i~~~~ 81 (250)
T d1oafa_ 2 GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL 81 (250)
T ss_dssp CCCCCCCCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHH
T ss_pred CCCCCCchHHHHHHHHHHHHHHHHHHhccCcHHHHHHHHHcccccccCCCCCCCCCcccccccccccccccCHHHHHHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhCCCCcHHHHHHhhhhhhhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHHh-hcCCChhhhhHhhc
Q 025588 82 EPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRPDKSDPPPEGRLPNATKGSDHLRDVFG-HMGLSDKEIVVLSG 160 (250)
Q Consensus 82 ~~ik~~~~~vS~ADiialaa~~av~~~GGP~~~~~~GR~D~~~~~~~~~lP~~~~~~~~l~~~F~-~~Gl~~~e~VaL~G 160 (250)
+.+|++||.|||||||+||+++||+.+|||.|+|++||+|+..+.+.+.+|.|..+++++++.|. ++||+++|||||+|
T Consensus 82 ~~~~~~~p~VS~ADiialAa~~Av~~~GGp~~~~~~GR~D~~~~~~~g~~P~p~~~~~~l~~~F~~~~Gl~~~e~VaL~G 161 (250)
T d1oafa_ 82 EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSG 161 (250)
T ss_dssp HHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHHTTTTCCCHHHHHHHHG
T ss_pred HHHHhccCcccHHHHHHHHHHHHHHhcCCceeccCCCCccccCCCCcccCCChHHHHHHHHHHHHHhcCCCHHHHHHHhh
Confidence 99999999999999999999999999999999999999999999999999999999999999996 68999999999999
Q ss_pred cccccccccCCCCCCCCCCCCCCccChHHHHHHhccccCCccccchhhhcccCCCcHHHHHHhhcChHHHHHHHHHHHHH
Q 025588 161 GHTLGRCHKERSGFEGPWTNNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLK 240 (250)
Q Consensus 161 aHtiG~~~~~~~~~~g~~~~tp~~fDN~Yy~~ll~~~~~gll~l~sD~~L~~d~~t~~~v~~yA~~~~~F~~~Fa~am~K 240 (250)
|||||++||..+++.|+|+.+|.+|||+||++|+.++++|+++|+||+.|+.|++|+.+|+.||.|+++|+++|+.||+|
T Consensus 162 aHTiG~~h~~~s~~~~~~~~tP~~fDN~Yf~~ll~~~~~gl~~l~SD~~L~~d~~t~~~v~~~A~d~~~F~~~Fa~Am~K 241 (250)
T d1oafa_ 162 GHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLVDKYAADEDAFFADYAEAHQK 241 (250)
T ss_dssp GGGSCEECTTTTSCCEESSSCTTCCSTHHHHHHHHCCCTTCCCCHHHHHHHHSTTHHHHHHHHHHCHHHHHHHHHHHHHH
T ss_pred hhhhhhhcccccccccccccccchhhhHHHHHHHhccccccccCHHHHHHhhCHHHHHHHHHHhcCHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999977899999999999999999999999999999999999999999
Q ss_pred HHhCCCCCC
Q 025588 241 LSELGFADA 249 (250)
Q Consensus 241 m~~~gv~~~ 249 (250)
|+++||+.+
T Consensus 242 m~~lGv~~~ 250 (250)
T d1oafa_ 242 LSELGFADA 250 (250)
T ss_dssp HHTTTSSCC
T ss_pred HHhcCCCCC
Confidence 999999863
|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} | Back information, alignment and structure |
|---|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|