Citrus Sinensis ID: 025650
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 250 | ||||||
| 255552053 | 200 | acireductone dioxygenase, putative [Rici | 0.74 | 0.925 | 0.793 | 1e-81 | |
| 158325159 | 200 | acireductone dioxygenase [Solanum tubero | 0.608 | 0.76 | 0.894 | 3e-78 | |
| 297737108 | 212 | unnamed protein product [Vitis vinifera] | 0.624 | 0.735 | 0.871 | 4e-78 | |
| 407930079 | 200 | acireductone dioxygenase [Capsicum annuu | 0.608 | 0.76 | 0.881 | 6e-78 | |
| 363805401 | 199 | RecName: Full=1,2-dihydroxy-3-keto-5-met | 0.624 | 0.783 | 0.871 | 6e-78 | |
| 359477561 | 373 | PREDICTED: 1,2-dihydroxy-3-keto-5-methyl | 0.62 | 0.415 | 0.877 | 8e-78 | |
| 297800752 | 199 | ATARD2 [Arabidopsis lyrata subsp. lyrata | 0.608 | 0.763 | 0.888 | 9e-78 | |
| 147858661 | 195 | hypothetical protein VITISV_012500 [Viti | 0.604 | 0.774 | 0.894 | 1e-77 | |
| 37791221 | 195 | ARD-like protein [Brassica juncea] | 0.616 | 0.789 | 0.876 | 2e-77 | |
| 297800748 | 192 | ATARD1 [Arabidopsis lyrata subsp. lyrata | 0.616 | 0.802 | 0.876 | 6e-77 |
| >gi|255552053|ref|XP_002517071.1| acireductone dioxygenase, putative [Ricinus communis] gi|223543706|gb|EEF45234.1| acireductone dioxygenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 308 bits (790), Expect = 1e-81, Method: Compositional matrix adjust.
Identities = 150/189 (79%), Positives = 162/189 (85%), Gaps = 4/189 (2%)
Query: 1 MVAP-QDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETD 59
MVAP +DPREEVIQAWYMD SDEDQRLPHHKDPKEFVSLDQLSELGVLSWRL+ADNYETD
Sbjct: 1 MVAPNKDPREEVIQAWYMDTSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLNADNYETD 60
Query: 60 EELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRD 119
EELKKIRE+RGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRD
Sbjct: 61 EELKKIREERGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRD 120
Query: 120 RNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKVIPFGLHSTVPMIIYPQGRDMFKIS 179
N++WIR+WVKKGGMIVLPAG YHRFTLDTDNYIK + + I P R +
Sbjct: 121 HNDRWIRVWVKKGGMIVLPAGIYHRFTLDTDNYIKAMRLFVGDP---IWTPFNRPHDHLP 177
Query: 180 CRRKLVTAL 188
R++ + A
Sbjct: 178 ARKEYIKAF 186
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|158325159|gb|ABW34717.1| acireductone dioxygenase [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|297737108|emb|CBI26309.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|407930079|gb|AFU51538.1| acireductone dioxygenase [Capsicum annuum] | Back alignment and taxonomy information |
|---|
| >gi|363805401|sp|F6HDT7.1|MTND2_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 2; Short=ARD 2; Short=Fe-ARD 2 | Back alignment and taxonomy information |
|---|
| >gi|359477561|ref|XP_003631995.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297800752|ref|XP_002868260.1| ATARD2 [Arabidopsis lyrata subsp. lyrata] gi|297314096|gb|EFH44519.1| ATARD2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|147858661|emb|CAN80823.1| hypothetical protein VITISV_012500 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|37791221|gb|AAR03591.1| ARD-like protein [Brassica juncea] | Back alignment and taxonomy information |
|---|
| >gi|297800748|ref|XP_002868258.1| ATARD1 [Arabidopsis lyrata subsp. lyrata] gi|297314094|gb|EFH44517.1| ATARD1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 250 | ||||||
| TAIR|locus:505006465 | 192 | ARD1 "acireductone dioxygenase | 0.616 | 0.802 | 0.870 | 2.5e-74 | |
| TAIR|locus:2066321 | 199 | ARD3 "acireductone dioxygenase | 0.616 | 0.773 | 0.798 | 5.5e-70 | |
| TAIR|locus:2170842 | 187 | ARD4 [Arabidopsis thaliana (ta | 0.58 | 0.775 | 0.703 | 2.2e-59 | |
| UNIPROTKB|I3LEI8 | 179 | ADI1 "Uncharacterized protein" | 0.584 | 0.815 | 0.630 | 3.1e-51 | |
| MGI|MGI:2144929 | 179 | Adi1 "acireductone dioxygenase | 0.584 | 0.815 | 0.643 | 9.5e-50 | |
| RGD|727828 | 179 | Adi1 "acireductone dioxygenase | 0.584 | 0.815 | 0.630 | 1.2e-49 | |
| UNIPROTKB|Q9BV57 | 179 | ADI1 "1,2-dihydroxy-3-keto-5-m | 0.584 | 0.815 | 0.616 | 2e-49 | |
| UNIPROTKB|Q5ZL43 | 180 | ADI1 "1,2-dihydroxy-3-keto-5-m | 0.584 | 0.811 | 0.636 | 2.5e-49 | |
| UNIPROTKB|Q3ZBL1 | 179 | ADI1 "1,2-dihydroxy-3-keto-5-m | 0.584 | 0.815 | 0.616 | 5.2e-49 | |
| UNIPROTKB|Q6DIY2 | 179 | adi1 "1,2-dihydroxy-3-keto-5-m | 0.704 | 0.983 | 0.541 | 8.5e-49 |
| TAIR|locus:505006465 ARD1 "acireductone dioxygenase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 750 (269.1 bits), Expect = 2.5e-74, P = 2.5e-74
Identities = 134/154 (87%), Positives = 146/154 (94%)
Query: 3 APQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEEL 62
A +D REEVIQAWYMDDS+EDQRLPHHKDPKEFVSLD+L+ELGVLSWRLDADNYETDE+L
Sbjct: 4 AVKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETDEDL 63
Query: 63 KKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNE 122
KKIRE RGYSYMDFCEVCPEKLPNYE K+K+FFEEHLHTDEEIRYCVAG+GYFDVRDRNE
Sbjct: 64 KKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGTGYFDVRDRNE 123
Query: 123 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKVI 156
WIR+ VKKGGMIVLPAG YHRFT+D+DNYIK +
Sbjct: 124 AWIRVLVKKGGMIVLPAGIYHRFTVDSDNYIKAM 157
|
|
| TAIR|locus:2066321 ARD3 "acireductone dioxygenase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170842 ARD4 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LEI8 ADI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2144929 Adi1 "acireductone dioxygenase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|727828 Adi1 "acireductone dioxygenase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BV57 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZL43 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBL1 ADI1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DIY2 adi1 "1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| scaffold_703119.1 | annotation not avaliable (199 aa) | ||||||||||
(Arabidopsis lyrata) | |||||||||||
| fgenesh1_pm.C_scaffold_8001076 | • | • | • | • | • | 0.744 | |||||
| fgenesh2_kg.3__2898__AT2G05830.1 | • | • | • | 0.626 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 250 | |||
| pfam03079 | 157 | pfam03079, ARD, ARD/ARD' family | 4e-77 | |
| COG1791 | 181 | COG1791, COG1791, Uncharacterized conserved protei | 2e-32 | |
| pfam07883 | 70 | pfam07883, Cupin_2, Cupin domain | 4e-06 | |
| pfam02311 | 134 | pfam02311, AraC_binding, AraC-like ligand binding | 0.003 |
| >gnl|CDD|217357 pfam03079, ARD, ARD/ARD' family | Back alignment and domain information |
|---|
Score = 229 bits (586), Expect = 4e-77
Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
Query: 13 QAWYMDDS-DEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGY 71
QAW MDDS DQRLPHH PKE D+L++LGVL W+LDAD+ ET EEL +IR+ + Y
Sbjct: 1 QAWIMDDSPCGDQRLPHHTFPKEKAETDELAKLGVLYWKLDADDEETAEELLRIRKYKHY 60
Query: 72 SYMDF-CEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVK 130
+D VCPE PN++EK+K FFEEHLHTDEEIRY V G+GYFDVRD+++ WIR++V+
Sbjct: 61 DDVDIDVTVCPETTPNFDEKLKKFFEEHLHTDEEIRYIVEGTGYFDVRDKDDVWIRVFVE 120
Query: 131 KGGMIVLPAGCYHRFTLDTDNYIKVIPF 158
KG +I LPAG YHRFT DNY+K +
Sbjct: 121 KGDLISLPAGIYHRFTTTPDNYVKALRL 148
|
The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+. ARD and ARD' can be experimentally interconverted by removal of the bound metal ion and reconstitution with the appropriate metal ion. The two enzymes share the same substrate, 1,2-dihydroxy-3-keto-5-(methylthio)pentene, but yield different products. ARD' yields the alpha-keto precursor of methionine (and formate), thus forming part of the ubiquitous methionine salvage pathway that converts 5'-methylthioadenosine (MTA) to methionine. This pathway is responsible for the tight control of the concentration of MTA, which is a powerful inhibitor of polyamine biosynthesis and transmethylation reactions. ARD yields methylthiopropanoate, carbon monoxide and formate, and thus prevents the conversion of MTA to methionine. The role of the ARD catalyzed reaction is unclear: methylthiopropanoate is cytotoxic, and carbon monoxide can activate guanylyl cyclase, leading to increased intracellular cGMP levels. This family also contains other members, whose functions are not well characterized. Length = 157 |
| >gnl|CDD|224704 COG1791, COG1791, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain | Back alignment and domain information |
|---|
| >gnl|CDD|145456 pfam02311, AraC_binding, AraC-like ligand binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 100.0 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 100.0 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 98.74 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 98.71 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 98.71 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 98.66 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 98.65 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 98.62 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.55 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 98.51 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 98.34 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 98.33 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 98.29 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.1 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 98.01 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.01 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 98.0 | |
| PLN00212 | 493 | glutelin; Provisional | 97.96 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 97.93 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 97.89 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 97.87 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 97.83 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 97.8 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 97.79 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 97.76 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 97.75 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 97.69 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 97.62 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 97.58 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 97.54 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 97.54 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 97.51 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 97.41 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 97.39 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 97.31 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 97.27 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 97.24 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 97.22 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 97.11 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 97.05 | |
| PLN00212 | 493 | glutelin; Provisional | 97.01 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 96.89 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 96.88 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 96.6 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 96.56 | |
| PF12852 | 186 | Cupin_6: Cupin | 96.3 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 96.26 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 96.22 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 96.13 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 95.75 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 95.73 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 94.86 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 94.1 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 94.04 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 93.82 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 93.14 | |
| KOG3995 | 279 | consensus 3-hydroxyanthranilate oxygenase HAAO [Am | 91.87 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 91.83 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 90.77 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 90.45 | |
| PF14525 | 172 | AraC_binding_2: AraC-binding-like domain | 90.03 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 88.53 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 87.94 | |
| PF04962 | 261 | KduI: KduI/IolB family; InterPro: IPR021120 The Kd | 87.91 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 86.83 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 86.78 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 85.64 | |
| PF02678 | 107 | Pirin: Pirin; InterPro: IPR003829 This entry repre | 85.24 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 85.16 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 84.58 | |
| COG3508 | 427 | HmgA Homogentisate 1,2-dioxygenase [Secondary meta | 83.87 | |
| COG3822 | 225 | ABC-type sugar transport system, auxiliary compone | 83.09 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 82.57 |
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-65 Score=436.12 Aligned_cols=177 Identities=60% Similarity=1.099 Sum_probs=173.2
Q ss_pred heeeEEecCC-CCCCCCCCCCCCCCcCCHhHHhhcCeEEEEeCCCCcCChHHHHHHHHhcCCCeeeEEEECCCCCCChHH
Q 025650 11 VIQAWYMDDS-DEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEE 89 (250)
Q Consensus 11 mv~aw~~d~~-~~d~rl~h~~~p~~~vs~~~L~~lGV~~~~~~~~~~e~~~~l~~L~~erGY~~~Dvi~l~p~~~Pn~e~ 89 (250)
|||||||++. ++|||+|||.+|++.+|+++|+++||.||++++++++.+++|++|++++||+++|+++++|+++|||++
T Consensus 1 m~qaw~mdd~~~~D~RlPhh~~p~~~vs~d~L~~lGVly~kld~D~~e~~~~L~~lr~e~~~~~~d~~~~~~e~~~nfde 80 (179)
T KOG2107|consen 1 MMQAWYMDDSPCEDQRLPHHKDPKKEVSLDELARLGVLYWKLDADNYELDEELDRLREERGYSYMDICTVCPETLPNFDE 80 (179)
T ss_pred CeeEEEcCCCCcccccCCCCCCCcccCCHHHHHhhCcEEEEecCchHHHHHHHHHHHHHcCCceeeEEEEchhhcccHHH
Confidence 8999999996 599999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhccccccccCcceEEEEEeceEEEEEEeCCCeEEEEEEecCCEEEeCCCCccccccCCCCcEEEEEeeecCCCcccee
Q 025650 90 KIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKVIPFGLHSTVPMIIY 169 (250)
Q Consensus 90 kl~~F~~EH~H~ddEIr~IleGsG~Fdvrd~~d~wirI~~e~GDLI~VPAG~~HrF~l~~~~~vkA~RlF~~~~~P~GWv 169 (250)
|+++||+||+|+|||||||++|+||||||+++|.||||.|++||||++||||+||||+++++++|||||| +++|+ |+
T Consensus 81 Kvk~FfEEhlh~deeiR~il~GtgYfDVrd~dd~WIRi~vekGDlivlPaGiyHRFTtt~~n~vkamRlF--~~~p~-wt 157 (179)
T KOG2107|consen 81 KVKSFFEEHLHEDEEIRYILEGTGYFDVRDKDDQWIRIFVEKGDLIVLPAGIYHRFTTTPSNYVKAMRLF--VGEPK-WT 157 (179)
T ss_pred HHHHHHHHhcCchhheEEEeecceEEeeccCCCCEEEEEEecCCEEEecCcceeeeecCchHHHHHHHHh--cCCcc-cc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999 99999 99
Q ss_pred ecCCCCcchHHHHHHHHHHHH
Q 025650 170 PQGRDMFKISCRRKLVTALSM 190 (250)
Q Consensus 170 ~~~R~~D~~~~R~~yl~~l~~ 190 (250)
|+|||+|+.++|++||..+++
T Consensus 158 a~nR~~d~l~~r~~yl~~i~~ 178 (179)
T KOG2107|consen 158 AYNRPHDELPARKQYLNFISQ 178 (179)
T ss_pred cCCCccccchhHHHHHhhccc
Confidence 999999999999999998753
|
|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PF14525 AraC_binding_2: AraC-binding-like domain | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only] | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 250 | ||||
| 1vr3_A | 191 | Crystal Structure Of Acireductone Dioxygenase (1354 | 2e-49 |
| >pdb|1VR3|A Chain A, Crystal Structure Of Acireductone Dioxygenase (13543033) From Mus Musculus At 2.06 A Resolution Length = 191 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 250 | |||
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 6e-71 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 2e-51 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 6e-07 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 9e-06 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 1e-06 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 4e-06 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 2e-06 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 2e-06 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-06 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 4e-05 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 5e-05 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 6e-05 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 6e-05 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 7e-05 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 9e-05 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 1e-04 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 1e-04 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 2e-04 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 2e-04 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 2e-04 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 2e-04 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 3e-04 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 3e-04 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 5e-04 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 7e-04 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 9e-04 |
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Length = 191 | Back alignment and structure |
|---|
Score = 214 bits (547), Expect = 6e-71
Identities = 94/154 (61%), Positives = 111/154 (72%)
Query: 3 APQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEEL 62
++QAWYMD+S D R PH P VSL+QL LGVL W+LDAD YE D EL
Sbjct: 5 KIHHHHHHMVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPEL 64
Query: 63 KKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNE 122
+KIR+ R YS+MD +C + LPNYEEKIK FFEEHLH DEEIRY + GSGYFDVRD+ +
Sbjct: 65 EKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKED 124
Query: 123 KWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKVI 156
KWIRI ++KG MI LPAG YHRFTLD NY+K +
Sbjct: 125 KWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAM 158
|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Length = 179 | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Length = 102 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Length = 107 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126 | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156 | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Length = 115 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166 | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Length = 110 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 100.0 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 100.0 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 98.92 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 98.84 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 98.81 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 98.79 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 98.75 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 98.74 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 98.72 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 98.71 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.7 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 98.7 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 98.68 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 98.68 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 98.68 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 98.67 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 98.66 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 98.66 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.63 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 98.63 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 98.63 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 98.63 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 98.61 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 98.61 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 98.6 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 98.6 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 98.55 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 98.55 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 98.54 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 98.51 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.51 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 98.49 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 98.48 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 98.48 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.47 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 98.47 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 98.46 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 98.46 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.46 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 98.45 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 98.45 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 98.44 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 98.43 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.41 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 98.4 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 98.39 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 98.39 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 98.37 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 98.37 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 98.35 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 98.31 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.3 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 98.29 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 98.28 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 98.27 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 98.27 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 98.25 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 98.24 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 98.23 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 98.22 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 98.22 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 98.21 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 98.21 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 98.2 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.2 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 98.18 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 98.18 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 98.17 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.16 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 98.16 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 98.16 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 98.16 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 98.16 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 98.15 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 98.11 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 98.08 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 98.07 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 98.07 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 98.07 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 98.04 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 98.01 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.0 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 97.99 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 97.99 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 97.95 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 97.95 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 97.9 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 97.89 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 97.85 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 97.85 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 97.84 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 97.8 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 97.8 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 97.79 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 97.77 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 97.75 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 97.72 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 97.71 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 97.67 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 97.67 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 97.6 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 97.56 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 97.53 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 97.52 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 97.45 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 97.43 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 97.42 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 97.37 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 97.33 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 97.3 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 97.15 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 97.1 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 97.04 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 97.0 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 96.9 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 96.88 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 96.54 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 95.82 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 95.35 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 94.02 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 93.89 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 93.79 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 93.49 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 93.33 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 92.9 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 92.73 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 92.71 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 92.66 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 92.46 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 92.03 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 91.69 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 91.68 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 91.68 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 91.61 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 90.79 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 90.61 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 90.05 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 89.91 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 89.58 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 88.86 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 88.79 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 86.13 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 85.77 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 84.5 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 81.76 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 81.04 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 80.04 |
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.9e-53 Score=367.33 Aligned_cols=178 Identities=56% Similarity=0.962 Sum_probs=169.7
Q ss_pred hheeeEEecCCCCCCCCCCCCCCCCcCCHhHHhhcCeEEEEeCCCCcCChHHHHHHHHhcCCCeeeEEEECCCCCCChHH
Q 025650 10 EVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEE 89 (250)
Q Consensus 10 ~mv~aw~~d~~~~d~rl~h~~~p~~~vs~~~L~~lGV~~~~~~~~~~e~~~~l~~L~~erGY~~~Dvi~l~p~~~Pn~e~ 89 (250)
-||||||||++++|||+||+++|++.||+++|+++||+||+++++.++.+.+|++|++++||.+.|+++++|+++||+++
T Consensus 12 ~~~~~~~~~~~~~d~~~ph~~~~~~~v~~~~L~~~GV~~w~~~~~~~~~~~~l~~l~~~~gy~~~D~v~~~p~~~p~~~~ 91 (191)
T 1vr3_A 12 HMVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEE 91 (191)
T ss_dssp -CCEEEEBCSCCSCTTSCCBCSSCCBCCHHHHHHTTCEEEECCGGGTTSCHHHHHHHHHHTCCEEEEEEESTTTSTTHHH
T ss_pred hhheeeeccCCccccCcccccCCCCccCHHHHHhcCcEEEECCCccccccHHHHHHHHhcCCCceeEEEECCCcCcchhh
Confidence 39999999999999999999999999999999999999999998777778999999999999999999999997799999
Q ss_pred HHhccccccccCcceEEEEEeceEEEEEEeCCCeEEEEEEecCCEEEeCCCCccccccCCCCcEEEEEeeecCCCcccee
Q 025650 90 KIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKVIPFGLHSTVPMIIY 169 (250)
Q Consensus 90 kl~~F~~EH~H~ddEIr~IleGsG~Fdvrd~~d~wirI~~e~GDLI~VPAG~~HrF~l~~~~~vkA~RlF~~~~~P~GWv 169 (250)
|+++||.||+|+++|++||++|+|+|.+++.+|+|+++.+++||+|+||+|++|||++++++++++||+| ..+|+ |+
T Consensus 92 k~~~~~~~H~H~~~Ei~yVleG~G~f~i~d~~d~~~~i~v~~GDlIiIPaG~~H~f~~~~~~~~~airlF--~~~~~-W~ 168 (191)
T 1vr3_A 92 KIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLF--VGEPV-WT 168 (191)
T ss_dssp HHHHHHSCEECSSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEECTTCCEEEEECTTCCEEEEEEE--SSSCC-CC
T ss_pred hhccCCcceECCcceEEEEEeceEEEEECCCCCeEEEEEECCCCEEEECcCCcCCcccCCCCCEEEEEEE--CCCCC-cc
Confidence 9999999999999999999999999999987788999999999999999999999999999999999999 66666 99
Q ss_pred ecCCCCcchHHHHHHHHHHHH
Q 025650 170 PQGRDMFKISCRRKLVTALSM 190 (250)
Q Consensus 170 ~~~R~~D~~~~R~~yl~~l~~ 190 (250)
|+|||+|++++|++||++|..
T Consensus 169 ~~~r~~~~~~~r~~y~~~~~~ 189 (191)
T 1vr3_A 169 PYNRPADHFDARVQYMSFLEG 189 (191)
T ss_dssp CEESCCTTSHHHHHHHHHHHH
T ss_pred CCCCchhccHHHHHHHHHhhh
Confidence 999999999999999999864
|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 250 | ||||
| d1vr3a1 | 179 | b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse | 3e-74 | |
| d1zrra1 | 179 | b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebs | 8e-44 | |
| d2phda1 | 351 | b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps | 5e-10 | |
| d2phda1 | 351 | b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps | 0.001 | |
| d3bu7a1 | 355 | b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si | 4e-08 | |
| d3bu7a1 | 355 | b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si | 4e-04 | |
| d2d40a1 | 308 | b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es | 5e-07 | |
| d2d40a1 | 308 | b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es | 1e-04 | |
| d1juha_ | 348 | b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill | 2e-04 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 2e-04 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 6e-04 | |
| d1sq4a_ | 273 | b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { | 7e-04 | |
| d1sfna_ | 245 | b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc | 8e-04 | |
| d1x82a_ | 190 | b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { | 0.001 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 0.001 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 0.002 | |
| d2f4pa1 | 134 | b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Th | 0.002 | |
| d2arca_ | 161 | b.82.4.1 (A:) Regulatory protein AraC {Escherichia | 0.003 |
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Acireductone dioxygenase domain: Acireductone dioxygenase species: Mouse (Mus musculus) [TaxId: 10090]
Score = 221 bits (565), Expect = 3e-74
Identities = 94/145 (64%), Positives = 110/145 (75%)
Query: 12 IQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGY 71
+QAWYMD+S D R PH P VSL+QL LGVL W+LDAD YE D EL+KIR+ R Y
Sbjct: 2 VQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNY 61
Query: 72 SYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKK 131
S+MD +C + LPNYEEKIK FFEEHLH DEEIRY + GSGYFDVRD+ +KWIRI ++K
Sbjct: 62 SWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEK 121
Query: 132 GGMIVLPAGCYHRFTLDTDNYIKVI 156
G MI LPAG YHRFTLD NY+K +
Sbjct: 122 GDMITLPAGIYHRFTLDEKNYVKAM 146
|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Length = 134 | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 250 | |||
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 100.0 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 100.0 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.02 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 98.96 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 98.86 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 98.82 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 98.75 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 98.71 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 98.71 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 98.69 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 98.6 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 98.59 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 98.55 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.52 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 98.49 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 98.47 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 98.47 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 98.46 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 98.45 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 98.43 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 98.43 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 98.4 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 98.4 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 98.4 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 98.36 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 98.35 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 98.35 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 98.33 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 98.26 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 98.2 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 98.19 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 98.18 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 98.14 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 98.12 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 97.99 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 97.98 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 97.94 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 97.87 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 97.85 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 97.82 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 97.8 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 97.72 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 97.68 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 97.68 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 97.6 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 97.36 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 97.26 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 96.96 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 96.83 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 96.76 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 96.1 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 95.41 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 91.46 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 88.89 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 87.99 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 87.21 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 86.01 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 85.64 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 85.27 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 85.07 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 84.18 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 83.61 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 83.56 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 83.54 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 80.38 |
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Acireductone dioxygenase domain: Acireductone dioxygenase species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=8.1e-65 Score=435.57 Aligned_cols=177 Identities=56% Similarity=0.966 Sum_probs=172.9
Q ss_pred heeeEEecCCCCCCCCCCCCCCCCcCCHhHHhhcCeEEEEeCCCCcCChHHHHHHHHhcCCCeeeEEEECCCCCCChHHH
Q 025650 11 VIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEK 90 (250)
Q Consensus 11 mv~aw~~d~~~~d~rl~h~~~p~~~vs~~~L~~lGV~~~~~~~~~~e~~~~l~~L~~erGY~~~Dvi~l~p~~~Pn~e~k 90 (250)
||+|||||++++|||+||+++|+++||+++|+++||.||++++++++++++|++|+++|||+++|+|+|+|+++|||++|
T Consensus 1 m~~aw~~d~~~~d~r~ph~~~p~~~v~~~~L~~lGV~y~~~~~~~~~~~~~l~~l~~ergY~~~D~i~l~p~~~pn~~~~ 80 (179)
T d1vr3a1 1 MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEK 80 (179)
T ss_dssp CCEEEEBCSCCSCTTSCCBCSSCCBCCHHHHHHTTCEEEECCGGGTTSCHHHHHHHHHHTCCEEEEEEESTTTSTTHHHH
T ss_pred CceEEEecCCCcccccCcccCCCCccCHHHHHhhCCEEEEecCccccccHHHHHHHHhcCCCceEEEEECCccCCCHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhccccccccCcceEEEEEeceEEEEEEeCCCeEEEEEEecCCEEEeCCCCccccccCCCCcEEEEEeeecCCCccceee
Q 025650 91 IKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKVIPFGLHSTVPMIIYP 170 (250)
Q Consensus 91 l~~F~~EH~H~ddEIr~IleGsG~Fdvrd~~d~wirI~~e~GDLI~VPAG~~HrF~l~~~~~vkA~RlF~~~~~P~GWv~ 170 (250)
+++||.||+|+++|||||++|+|+|++++.+++|++|.|++||+|+||||++|||+++++++|+||||| +++|+ |+|
T Consensus 81 ~~~F~~EH~H~~~Evr~vl~G~G~f~v~~~~~~~iri~~~~GDli~iPag~~HwFtl~~~~~v~aiRlF--~~~~~-W~~ 157 (179)
T d1vr3a1 81 IKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLF--VGEPV-WTP 157 (179)
T ss_dssp HHHHHSCEECSSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEECTTCCEEEEECTTCCEEEEEEE--SSSCC-CCC
T ss_pred HHHHhhceeCCCcEEEEEEeCcEEEEEECCCCcEEEEEEeCCCEEEeCCCccEeccCCCCCCEEEEEEE--CCCCe-eeE
Confidence 999999999999999999999999999999999999999999999999999999999999999999999 77777 999
Q ss_pred cCCCCcchHHHHHHHHHHHH
Q 025650 171 QGRDMFKISCRRKLVTALSM 190 (250)
Q Consensus 171 ~~R~~D~~~~R~~yl~~l~~ 190 (250)
+||++|++++|++||++|+.
T Consensus 158 ~~r~ad~~~~R~~Y~~~l~~ 177 (179)
T d1vr3a1 158 YNRPADHFDARVQYMSFLEG 177 (179)
T ss_dssp EESCCTTSHHHHHHHHHHHH
T ss_pred cCCChhhchHHHHHHHHhhc
Confidence 99999999999999998865
|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|