Citrus Sinensis ID: 025670

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MQSMRNLLSRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGREGKEGKEGKEKGSN
cHHHHHHHHHccHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHcccHHHHHcccccccccccccccccccccccccccc
ccHHHHHHHHcHHHcccccHccccccccHcHcccccEEEEEcccccccccHHHHHHcccEEEEEccEcHHHHHHHHHHHHHHHHHcccccEEEEEEEccEcHHHHHHHHHHHHHccccEEEEEEEEEEcHHHHHHHccccccEEEccccEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEEHHHHHHHccccEEcccccHHHHHHcccccccccccccccccc
MQSMRNLLSRTSMATKFLQlskpsaqisarsfslipmviehssrgeRAYDIFSRLLKERIIcingpinddTAHVVVAQLLFlesenpskpihmylnspggqvtagLAIYDTMQYIRSPINTICLGQAASMGSLLLasgtkgerralpnstimihqpsggysgqakdmtiHTKQIVRVWDALNALYCKHTGQSIEVIQKNmdrdyfmtpeeakefgiidevidqrpmALVTDAvgregkegkegkekgsn
mqsmrnllSRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDavgregkegkegkekgsn
MQSMRNLLSRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGRegkegkegkekgSN
******************************SFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLA***************************AKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVT*******************
*******************************FSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVI****************************
********SRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGR**************
*********RT*M*TKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRP************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSMRNLLSRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGREGKEGKEGKEKGSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q9FN42241 ATP-dependent Clp proteas yes no 0.947 0.979 0.788 1e-110
Q6G178210 ATP-dependent Clp proteas yes no 0.779 0.923 0.634 5e-74
A9ISA4210 ATP-dependent Clp proteas yes no 0.779 0.923 0.639 6e-74
A1USA7210 ATP-dependent Clp proteas yes no 0.779 0.923 0.639 8e-74
Q6G3Z3210 ATP-dependent Clp proteas yes no 0.779 0.923 0.628 1e-73
Q5GS83208 ATP-dependent Clp proteas yes no 0.775 0.927 0.652 8e-73
Q73I59208 ATP-dependent Clp proteas yes no 0.775 0.927 0.658 2e-72
B6JGU7210 ATP-dependent Clp proteas yes no 0.775 0.919 0.621 2e-72
Q1RJH2227 ATP-dependent Clp proteas yes no 0.799 0.876 0.618 3e-72
C0R2W3208 ATP-dependent Clp proteas yes no 0.775 0.927 0.658 3e-72
>sp|Q9FN42|CLPP2_ARATH ATP-dependent Clp protease proteolytic subunit 2, mitochondrial OS=Arabidopsis thaliana GN=CLPP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  396 bits (1017), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/236 (78%), Positives = 205/236 (86%)

Query: 4   MRNLLSRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICI 63
           MR L+S   M +        S     RS+SLIPMVIEHSSRGERAYDIFSRLLKERIICI
Sbjct: 2   MRGLVSGAKMLSSTPSSMATSIATGRRSYSLIPMVIEHSSRGERAYDIFSRLLKERIICI 61

Query: 64  NGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTIC 123
           NGPINDDT+HVVVAQLL+LESENPSKPIHMYLNSPGG VTAGLAIYDTMQYIRSPI+TIC
Sbjct: 62  NGPINDDTSHVVVAQLLYLESENPSKPIHMYLNSPGGHVTAGLAIYDTMQYIRSPISTIC 121

Query: 124 LGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNA 183
           LGQAASM SLLLA+G KG+RR+LPN+T+MIHQPSGGYSGQAKD+TIHTKQIVRVWDALN 
Sbjct: 122 LGQAASMASLLLAAGAKGQRRSLPNATVMIHQPSGGYSGQAKDITIHTKQIVRVWDALNE 181

Query: 184 LYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGREGKE 239
           LY KHTGQ ++V+  NMDRD+FMTPEEAK FGIIDEVID+RP+ LV DAVG E K+
Sbjct: 182 LYVKHTGQPLDVVANNMDRDHFMTPEEAKAFGIIDEVIDERPLELVKDAVGNESKD 237
Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 9EC: 2
>sp|Q6G178|CLPP_BARQU ATP-dependent Clp protease proteolytic subunit OS=Bartonella quintana (strain Toulouse) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|A9ISA4|CLPP_BART1 ATP-dependent Clp protease proteolytic subunit OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|A1USA7|CLPP_BARBK ATP-dependent Clp protease proteolytic subunit OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|Q6G3Z3|CLPP_BARHE ATP-dependent Clp protease proteolytic subunit OS=Bartonella henselae (strain ATCC 49882 / Houston 1) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|Q5GS83|CLPP_WOLTR ATP-dependent Clp protease proteolytic subunit OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|Q73I59|CLPP_WOLPM ATP-dependent Clp protease proteolytic subunit OS=Wolbachia pipientis wMel GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|B6JGU7|CLPP_OLICO ATP-dependent Clp protease proteolytic subunit OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|Q1RJH2|CLPP_RICBR ATP-dependent Clp protease proteolytic subunit OS=Rickettsia bellii (strain RML369-C) GN=clpP PE=3 SV=2 Back     alignment and function description
>sp|C0R2W3|CLPP_WOLWR ATP-dependent Clp protease proteolytic subunit OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=clpP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
225423749241 PREDICTED: ATP-dependent Clp protease pr 0.959 0.991 0.829 1e-117
147797194221 hypothetical protein VITISV_024612 [Viti 0.875 0.986 0.883 1e-116
255565556296 ATP-dependent Clp protease proteolytic s 0.947 0.797 0.829 1e-116
224081363244 predicted protein [Populus trichocarpa] 0.943 0.963 0.821 1e-114
224094113244 predicted protein [Populus trichocarpa] 0.943 0.963 0.813 1e-113
297737943209 unnamed protein product [Vitis vinifera] 0.831 0.990 0.896 1e-111
388512413243 unknown [Lotus japonicus] 0.963 0.987 0.795 1e-111
449461681243 PREDICTED: ATP-dependent Clp protease pr 0.935 0.958 0.800 1e-111
356538559238 PREDICTED: ATP-dependent Clp protease pr 0.859 0.899 0.863 1e-110
356544357236 PREDICTED: ATP-dependent Clp protease pr 0.863 0.911 0.850 1e-109
>gi|225423749|ref|XP_002277069.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 2, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/246 (82%), Positives = 221/246 (89%), Gaps = 7/246 (2%)

Query: 4   MRNLLSRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICI 63
           MR L    S AT   +L   +  +S RS++LIPMVIEHSSRGERAYDIFSRLLKERI+CI
Sbjct: 1   MRALTKLCSAATG-RRLFPAATAVSTRSYALIPMVIEHSSRGERAYDIFSRLLKERIVCI 59

Query: 64  NGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTIC 123
           NGPI+DDTAHVVVAQLLFLESENPSKPIHMYLNSPGG V+AGLAIYDTMQYIRSP+NTIC
Sbjct: 60  NGPISDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGAVSAGLAIYDTMQYIRSPVNTIC 119

Query: 124 LGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNA 183
           LGQAASMGSLLLA+G KGERRALPN+TIMIHQPSGGYSGQAKDMTIHTKQI+RVWD+LNA
Sbjct: 120 LGQAASMGSLLLAAGAKGERRALPNATIMIHQPSGGYSGQAKDMTIHTKQIIRVWDSLNA 179

Query: 184 LYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGREGKEGKEG 243
           LY KHTGQS+++IQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAV      G EG
Sbjct: 180 LYAKHTGQSLDIIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAV------GNEG 233

Query: 244 KEKGSN 249
           K+KGSN
Sbjct: 234 KDKGSN 239

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147797194|emb|CAN64666.1| hypothetical protein VITISV_024612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565556|ref|XP_002523768.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223536980|gb|EEF38617.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224081363|ref|XP_002306383.1| predicted protein [Populus trichocarpa] gi|118481948|gb|ABK92906.1| unknown [Populus trichocarpa] gi|222855832|gb|EEE93379.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224094113|ref|XP_002310077.1| predicted protein [Populus trichocarpa] gi|222852980|gb|EEE90527.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297737943|emb|CBI27144.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388512413|gb|AFK44268.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449461681|ref|XP_004148570.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 2, mitochondrial-like [Cucumis sativus] gi|449522109|ref|XP_004168070.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356538559|ref|XP_003537770.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 2, mitochondrial-like isoform 1 [Glycine max] gi|356538561|ref|XP_003537771.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 2, mitochondrial-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356544357|ref|XP_003540619.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 2, mitochondrial-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2178282241 NCLPP7 "nuclear-encoded CLP pr 0.927 0.958 0.796 4.7e-96
ZFIN|ZDB-GENE-030131-7860266 clpp "ClpP caseinolytic peptid 0.887 0.830 0.580 5.2e-65
TIGR_CMR|ECH_0901199 ECH_0901 "ATP-dependent Clp pr 0.771 0.964 0.656 8.5e-65
FB|FBgn0032229253 CG5045 [Drosophila melanogaste 0.847 0.833 0.598 3.7e-64
UNIPROTKB|Q2KHU4272 CLPP "Putative ATP-dependent C 0.795 0.727 0.621 6e-64
MGI|MGI:1858213272 Clpp "ClpP caseinolytic peptid 0.795 0.727 0.621 9.7e-64
UNIPROTKB|F1SBT2273 CLPP "ATP-dependent Clp protea 0.791 0.721 0.624 1.2e-63
RGD|1588583272 Clpp "ClpP caseinolytic peptid 0.795 0.727 0.621 1.2e-63
UNIPROTKB|Q16740277 CLPP "Putative ATP-dependent C 0.795 0.714 0.621 1.6e-63
TIGR_CMR|SPO_1003209 SPO_1003 "ATP-dependent Clp pr 0.771 0.918 0.630 1.6e-63
TAIR|locus:2178282 NCLPP7 "nuclear-encoded CLP protease P7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 955 (341.2 bits), Expect = 4.7e-96, P = 4.7e-96
 Identities = 184/231 (79%), Positives = 202/231 (87%)

Query:     4 MRNLLSRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICI 63
             MR L+S   M +        S     RS+SLIPMVIEHSSRGERAYDIFSRLLKERIICI
Sbjct:     2 MRGLVSGAKMLSSTPSSMATSIATGRRSYSLIPMVIEHSSRGERAYDIFSRLLKERIICI 61

Query:    64 NGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTIC 123
             NGPINDDT+HVVVAQLL+LESENPSKPIHMYLNSPGG VTAGLAIYDTMQYIRSPI+TIC
Sbjct:    62 NGPINDDTSHVVVAQLLYLESENPSKPIHMYLNSPGGHVTAGLAIYDTMQYIRSPISTIC 121

Query:   124 LGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNA 183
             LGQAASM SLLLA+G KG+RR+LPN+T+MIHQPSGGYSGQAKD+TIHTKQIVRVWDALN 
Sbjct:   122 LGQAASMASLLLAAGAKGQRRSLPNATVMIHQPSGGYSGQAKDITIHTKQIVRVWDALNE 181

Query:   184 LYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVG 234
             LY KHTGQ ++V+  NMDRD+FMTPEEAK FGIIDEVID+RP+ LV DAVG
Sbjct:   182 LYVKHTGQPLDVVANNMDRDHFMTPEEAKAFGIIDEVIDERPLELVKDAVG 232
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006508 "proteolysis" evidence=IEA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009840 "chloroplastic endopeptidase Clp complex" evidence=IDA
GO:0005759 "mitochondrial matrix" evidence=IDA
GO:0009532 "plastid stroma" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
ZFIN|ZDB-GENE-030131-7860 clpp "ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0901 ECH_0901 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
FB|FBgn0032229 CG5045 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KHU4 CLPP "Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1858213 Clpp "ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBT2 CLPP "ATP-dependent Clp protease proteolytic subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1588583 Clpp "ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q16740 CLPP "Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1003 SPO_1003 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O88696CLPP_MOUSE3, ., 4, ., 2, 1, ., 9, 20.62120.79510.7279yesno
Q73I59CLPP_WOLPM3, ., 4, ., 2, 1, ., 9, 20.65800.77510.9278yesno
Q9FN42CLPP2_ARATH3, ., 4, ., 2, 1, ., 9, 20.78810.94770.9792yesno
Q5HBX5CLPP_EHRRW3, ., 4, ., 2, 1, ., 9, 20.64240.77510.9747yesno
Q1RJH2CLPP_RICBR3, ., 4, ., 2, 1, ., 9, 20.61800.79910.8766yesno
Q9X6W8CLPP_AZOBR3, ., 4, ., 2, 1, ., 9, 20.63730.77510.9190yesno
Q2W3H9CLPP_MAGSA3, ., 4, ., 2, 1, ., 9, 20.62170.77510.9507yesno
Q2RU45CLPP_RHORT3, ., 4, ., 2, 1, ., 9, 20.60.78310.9027yesno
B8GX16CLPP_CAUCN3, ., 4, ., 2, 1, ., 9, 20.59390.79110.9425yesno
Q6G178CLPP_BARQU3, ., 4, ., 2, 1, ., 9, 20.63400.77910.9238yesno
B6JGU7CLPP_OLICO3, ., 4, ., 2, 1, ., 9, 20.62170.77510.9190yesno
A1USA7CLPP_BARBK3, ., 4, ., 2, 1, ., 9, 20.63910.77910.9238yesno
Q2KHU4CLPP_BOVIN3, ., 4, ., 2, 1, ., 9, 20.62120.79510.7279yesno
Q2GFT8CLPP_EHRCR3, ., 4, ., 2, 1, ., 9, 20.65280.77510.9698yesno
Q6G3Z3CLPP_BARHE3, ., 4, ., 2, 1, ., 9, 20.62880.77910.9238yesno
B1Z9C7CLPP_METPB3, ., 4, ., 2, 1, ., 9, 20.61130.77510.9278yesno
B0SZQ2CLPP_CAUSK3, ., 4, ., 2, 1, ., 9, 20.60710.78710.9423yesno
Q1GGF6CLPP_RUEST3, ., 4, ., 2, 1, ., 9, 20.61020.78310.9285yesno
Q4FM94CLPP_PELUB3, ., 4, ., 2, 1, ., 9, 20.61970.77100.9458yesno
Q2YPX1CLPP_BRUA23, ., 4, ., 2, 1, ., 9, 20.60930.77100.9186yesno
Q3YSQ3CLPP_EHRCJ3, ., 4, ., 2, 1, ., 9, 20.65280.77510.965yesno
Q6N5L3CLPP_RHOPA3, ., 4, ., 2, 1, ., 9, 20.60620.77510.9103yesno
Q5GS83CLPP_WOLTR3, ., 4, ., 2, 1, ., 9, 20.65280.77510.9278yesno
Q5LUQ0CLPP_RUEPO3, ., 4, ., 2, 1, ., 9, 20.63020.77100.9186yesno
A5D447CLPP_PELTS3, ., 4, ., 2, 1, ., 9, 20.61970.77100.9896yesno
Q165F9CLPP_ROSDO3, ., 4, ., 2, 1, ., 9, 20.60620.77510.9278yesno
Q9L7X6CLPP_BRUAB3, ., 4, ., 2, 1, ., 9, 20.60930.77100.9186yesno
Q5FFG7CLPP_EHRRG3, ., 4, ., 2, 1, ., 9, 20.63730.77510.9747yesno
B0CGR1CLPP_BRUSI3, ., 4, ., 2, 1, ., 9, 20.60930.77100.9186yesno
A5CXJ8CLPP_VESOH3, ., 4, ., 2, 1, ., 9, 20.62120.79511.0yesno
Q4ULF0CLPP_RICFE3, ., 4, ., 2, 1, ., 9, 20.63730.77510.9601yesno
Q8YHC8CLPP_BRUME3, ., 4, ., 2, 1, ., 9, 20.59480.78310.9330yesno
B7KNT0CLPP_METC43, ., 4, ., 2, 1, ., 9, 20.61130.77510.9278yesno
A5EKA8CLPP_BRASB3, ., 4, ., 2, 1, ., 9, 20.62170.77510.9190yesno
O30612CLPP2_MYXXD3, ., 4, ., 2, 1, ., 9, 20.61570.76300.9359yesno
Q89KG1CLPP2_BRAJA3, ., 4, ., 2, 1, ., 9, 20.61450.77100.9099yesno
B9KHZ4CLPP_ANAMF3, ., 4, ., 2, 1, ., 9, 20.62690.77510.8976yesno
Q8G0I4CLPP_BRUSU3, ., 4, ., 2, 1, ., 9, 20.60930.77100.9186yesno
C0R2W3CLPP_WOLWR3, ., 4, ., 2, 1, ., 9, 20.65800.77510.9278yesno
B3Q7P5CLPP_RHOPT3, ., 4, ., 2, 1, ., 9, 20.60620.77510.9103yesno
A9W5F5CLPP_METEP3, ., 4, ., 2, 1, ., 9, 20.61130.77510.9278yesno
A8GNZ4CLPP_RICAH3, ., 4, ., 2, 1, ., 9, 20.62690.77510.9601yesno
B3CLB1CLPP_WOLPP3, ., 4, ., 2, 1, ., 9, 20.64240.77510.9278yesno
B2S5W1CLPP_BRUA13, ., 4, ., 2, 1, ., 9, 20.60930.77100.9186yesno
A9ISA4CLPP_BART13, ., 4, ., 2, 1, ., 9, 20.63910.77910.9238yesno
Q5PBD0CLPP_ANAMM3, ., 4, ., 2, 1, ., 9, 20.62690.77510.8976yesno
A9M5C2CLPP_BRUC23, ., 4, ., 2, 1, ., 9, 20.60930.77100.9186yesno
P0CAU1CLPP_CAUCR3, ., 4, ., 2, 1, ., 9, 20.59390.79110.9425yesno
Q1QL76CLPP_NITHX3, ., 4, ., 2, 1, ., 9, 20.60410.77100.9099yesno
Q16740CLPP_HUMAN3, ., 4, ., 2, 1, ., 9, 20.62120.79510.7148yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.983
3rd Layer3.4.21.920.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
PRK00277200 PRK00277, clpP, ATP-dependent Clp protease proteol 1e-130
pfam00574182 pfam00574, CLP_protease, Clp protease 1e-109
cd07017171 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) 1e-106
COG0740200 COG0740, ClpP, Protease subunit of ATP-dependent C 1e-105
TIGR00493192 TIGR00493, clpP, ATP-dependent Clp endopeptidase, 1e-100
PRK12553207 PRK12553, PRK12553, ATP-dependent Clp protease pro 7e-91
PRK12551196 PRK12551, PRK12551, ATP-dependent Clp protease pro 4e-83
PRK14513201 PRK14513, PRK14513, ATP-dependent Clp protease pro 2e-82
CHL00028200 CHL00028, clpP, ATP-dependent Clp protease proteol 1e-77
PRK14514221 PRK14514, PRK14514, ATP-dependent Clp protease pro 3e-68
PRK12552222 PRK12552, PRK12552, ATP-dependent Clp protease-lik 3e-64
cd07013162 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is 9e-59
PRK14512197 PRK14512, PRK14512, ATP-dependent Clp protease pro 2e-49
cd00394161 cd00394, Clp_protease_like, Caseinolytic protease 2e-40
cd07016160 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) 2e-33
cd07020187 cd07020, Clp_protease_NfeD_1, Nodulation formation 9e-05
cd07015172 cd07015, Clp_protease_NfeD, Nodulation formation e 5e-04
>gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information 
 Score =  364 bits (937), Expect = e-130
 Identities = 120/195 (61%), Positives = 160/195 (82%)

Query: 33  SLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIH 92
           +L+PMVIE +SRGER+YDI+SRLLKERII + G + D  A+++VAQLLFLE+E+P K I+
Sbjct: 6   NLVPMVIEQTSRGERSYDIYSRLLKERIIFLGGEVEDHMANLIVAQLLFLEAEDPDKDIY 65

Query: 93  MYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIM 152
           +Y+NSPGG VTAGLAIYDTMQ+I+  ++TIC+GQAASMG+ LLA+G KG+R ALPNS IM
Sbjct: 66  LYINSPGGSVTAGLAIYDTMQFIKPDVSTICIGQAASMGAFLLAAGAKGKRFALPNSRIM 125

Query: 153 IHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAK 212
           IHQP GG+ GQA D+ IH ++I+++   LN +  +HTGQ +E I+K+ DRD FM+ EEAK
Sbjct: 126 IHQPLGGFQGQATDIEIHAREILKLKKRLNEILAEHTGQPLEKIEKDTDRDNFMSAEEAK 185

Query: 213 EFGIIDEVIDQRPMA 227
           E+G+IDEV+ +R  A
Sbjct: 186 EYGLIDEVLTKRKEA 200

Length = 200
>gnl|CDD|201316 pfam00574, CLP_protease, Clp protease Back     alignment and domain information
>gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|223811 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic subunit ClpP Back     alignment and domain information
>gnl|CDD|237133 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237742 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|214340 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>gnl|CDD|184722 PRK14514, PRK14514, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|183588 PRK12552, PRK12552, ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|237741 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|132931 cd07020, Clp_protease_NfeD_1, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>gnl|CDD|132926 cd07015, Clp_protease_NfeD, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 100.0
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 100.0
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 100.0
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 100.0
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 100.0
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 100.0
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 100.0
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 100.0
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 100.0
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 100.0
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 100.0
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 100.0
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.96
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.95
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.88
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 99.88
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.87
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.86
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.86
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.85
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.82
PRK10949618 protease 4; Provisional 99.82
PRK11778330 putative inner membrane peptidase; Provisional 99.78
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 99.76
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 99.72
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 99.69
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 99.44
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 99.39
PRK10949 618 protease 4; Provisional 99.35
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 98.99
COG3904245 Predicted periplasmic protein [Function unknown] 98.9
PRK05869222 enoyl-CoA hydratase; Validated 98.79
PRK06688259 enoyl-CoA hydratase; Provisional 98.78
PRK07511260 enoyl-CoA hydratase; Provisional 98.77
PRK08258277 enoyl-CoA hydratase; Provisional 98.77
PRK06495257 enoyl-CoA hydratase; Provisional 98.77
PRK03580261 carnitinyl-CoA dehydratase; Provisional 98.75
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 98.7
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.7
PRK06190258 enoyl-CoA hydratase; Provisional 98.7
TIGR03200 360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 98.69
PRK06143256 enoyl-CoA hydratase; Provisional 98.69
PRK09076258 enoyl-CoA hydratase; Provisional 98.68
PRK05981266 enoyl-CoA hydratase; Provisional 98.66
PRK06210272 enoyl-CoA hydratase; Provisional 98.66
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 98.66
PRK07658257 enoyl-CoA hydratase; Provisional 98.65
PRK05980260 enoyl-CoA hydratase; Provisional 98.63
PRK07509262 enoyl-CoA hydratase; Provisional 98.63
PRK08150255 enoyl-CoA hydratase; Provisional 98.62
PRK08138261 enoyl-CoA hydratase; Provisional 98.61
PRK08260296 enoyl-CoA hydratase; Provisional 98.61
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 98.61
PLN02600251 enoyl-CoA hydratase 98.6
PLN02921327 naphthoate synthase 98.6
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.59
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 98.59
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 98.59
PRK06023251 enoyl-CoA hydratase; Provisional 98.59
PRK07468262 enoyl-CoA hydratase; Provisional 98.58
PLN02888265 enoyl-CoA hydratase 98.58
PRK07938249 enoyl-CoA hydratase; Provisional 98.58
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 98.57
PRK08139266 enoyl-CoA hydratase; Validated 98.57
PRK06142272 enoyl-CoA hydratase; Provisional 98.56
PRK09245266 enoyl-CoA hydratase; Provisional 98.56
PRK06127269 enoyl-CoA hydratase; Provisional 98.56
PRK06494259 enoyl-CoA hydratase; Provisional 98.55
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 98.55
PRK07854243 enoyl-CoA hydratase; Provisional 98.55
PRK05864276 enoyl-CoA hydratase; Provisional 98.54
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 98.54
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.54
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 98.54
PRK05995262 enoyl-CoA hydratase; Provisional 98.54
PRK07657260 enoyl-CoA hydratase; Provisional 98.54
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 98.53
PRK07260255 enoyl-CoA hydratase; Provisional 98.53
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.53
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.53
PRK06213229 enoyl-CoA hydratase; Provisional 98.53
PRK07327268 enoyl-CoA hydratase; Provisional 98.52
PRK06144262 enoyl-CoA hydratase; Provisional 98.51
PRK06563255 enoyl-CoA hydratase; Provisional 98.51
PRK08259254 enoyl-CoA hydratase; Provisional 98.5
PRK08252254 enoyl-CoA hydratase; Provisional 98.49
PRK06072248 enoyl-CoA hydratase; Provisional 98.49
PRK08140262 enoyl-CoA hydratase; Provisional 98.49
PRK08290288 enoyl-CoA hydratase; Provisional 98.49
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.48
PRK05862257 enoyl-CoA hydratase; Provisional 98.48
PRK08788287 enoyl-CoA hydratase; Validated 98.47
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 98.46
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.45
PRK07799263 enoyl-CoA hydratase; Provisional 98.45
PRK08321302 naphthoate synthase; Validated 98.44
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 98.43
PRK08272302 enoyl-CoA hydratase; Provisional 98.42
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 98.41
PRK05870249 enoyl-CoA hydratase; Provisional 98.4
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.4
PLN02267239 enoyl-CoA hydratase/isomerase family protein 98.38
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.38
PRK12478298 enoyl-CoA hydratase; Provisional 98.37
PRK07659260 enoyl-CoA hydratase; Provisional 98.36
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 98.29
PRK07827260 enoyl-CoA hydratase; Provisional 98.27
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 98.26
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 98.24
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.23
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 98.22
PRK05617 342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 98.21
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.2
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 98.2
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.18
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 98.17
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 98.15
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.12
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 98.05
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 97.96
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.91
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 97.84
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 97.51
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 97.47
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 97.42
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 97.4
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 97.38
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 97.31
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 96.71
PRK07189301 malonate decarboxylase subunit beta; Reviewed 96.45
PF06833234 MdcE: Malonate decarboxylase gamma subunit (MdcE); 96.42
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 96.3
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 96.28
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 96.21
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 95.75
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 95.53
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 95.15
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 94.89
KOG1684 401 consensus Enoyl-CoA hydratase [Lipid transport and 92.72
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 91.91
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 89.45
cd06567224 Peptidase_S41 C-terminal processing peptidase fami 89.39
cd07560211 Peptidase_S41_CPP C-terminal processing peptidase; 89.34
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 88.51
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 85.58
PLN00049389 carboxyl-terminal processing protease; Provisional 82.9
PRK11186667 carboxy-terminal protease; Provisional 82.05
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 80.35
cd07561256 Peptidase_S41_CPP_like C-terminal processing pepti 80.32
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-62  Score=426.40  Aligned_cols=207  Identities=60%  Similarity=0.993  Sum_probs=195.7

Q ss_pred             hccCCCCC-ceeeccCCC-CcccchhhhhccCcEEEEcceeCcchHHHHHHHHHHhhhcCCCCCeEEEEeCCCCcHHHHH
Q 025670           29 ARSFSLIP-MVIEHSSRG-ERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGL  106 (249)
Q Consensus        29 ~~~~~~~p-~~~~~~~~g-~~~~di~~~l~~~riI~L~g~Id~~~a~~i~a~L~~l~~~~~~~~I~l~INSPGG~V~ag~  106 (249)
                      .+....+| .+++...+| ++++|||++||++|||||+++||+++++.|++||+||+.+|+.++|++|||||||++++|+
T Consensus        61 ~~~~~~~p~~~~~~~~rG~~~~~Di~s~LlreRIi~lg~~Idd~va~~viaqlL~Ld~ed~~K~I~lyINSPGG~vtagl  140 (275)
T KOG0840|consen   61 LRAPILVPRFPIESPGRGRERPYDIYSRLLRERIVFLGQPIDDDVANLVIAQLLYLDSEDPKKPIYLYINSPGGSVTAGL  140 (275)
T ss_pred             ccccccCCcceeeccccCCCCcccHHHHHHHhheeeeCCcCcHHHHHHHHHHHHHhhccCCCCCeEEEEeCCCCccchhh
Confidence            34567888 777888888 8999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCEEEEEccccchHHHHHHhcCCCCcEEeccCceEeeecCCCCCCCchhhHHHHHHHHHHHHHHHHHHHH
Q 025670          107 AIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYC  186 (249)
Q Consensus       107 aIyd~i~~~~~pV~tv~~G~AASaa~~I~~ag~kg~R~a~p~s~imiHqp~~~~~G~~~di~~~a~~l~~~~~~~~~~ya  186 (249)
                      +|||+|++++.||.|+|.|+|||+|++|+++|.||+|+++|||++|||||.+++.|++.|+.++++|+.++++.+.++|+
T Consensus       141 AIYDtMq~ik~~V~Tic~G~Aas~aalLLaaG~KG~R~alPnsriMIhQP~gga~Gqa~Di~i~akE~~~~k~~l~~i~a  220 (275)
T KOG0840|consen  141 AIYDTMQYIKPDVSTICVGLAASMAALLLAAGAKGKRYALPNSRIMIHQPSGGAGGQATDIVIQAKELMRIKEYLNEIYA  220 (275)
T ss_pred             hHHHHHHhhCCCceeeehhhHHhHHHHHHhcCCCcceeecCCceeEEeccCCCcCccchHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhCCCHHHHHhhhcCCcccCHHHHHHcCCcceecCCCccccccccccC
Q 025670          187 KHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGR  235 (249)
Q Consensus       187 ~~tg~~~~~i~~~~~~d~~lsa~EA~e~GlID~I~~~~~~~~~~~~~~~  235 (249)
                      ++||++.++|+++++||+||+|+||+||||||+|++....++..+....
T Consensus       221 ~~Tgq~~e~i~~d~dRd~fmsa~EA~eyGliD~v~~~p~~~~~~~~~~~  269 (275)
T KOG0840|consen  221 KHTGQPLEVIEKDMDRDRFMSAEEAKEYGLIDKVIDHPPETRVDDGTLV  269 (275)
T ss_pred             HhcCCcHHHHHhhhcccccCCHHHHHHhcchhhhhcCCcccccccchhh
Confidence            9999999999999999999999999999999999997665555444333

>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>COG3904 Predicted periplasmic protein [Function unknown] Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>PF06833 MdcE: Malonate decarboxylase gamma subunit (MdcE); InterPro: IPR009648 This family consists of several bacterial malonate decarboxylase gamma subunit proteins Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>cd06567 Peptidase_S41 C-terminal processing peptidase family S41 Back     alignment and domain information
>cd07560 Peptidase_S41_CPP C-terminal processing peptidase; serine protease family S41 Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd07561 Peptidase_S41_CPP_like C-terminal processing peptidase-like; serine protease family S41 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1tg6_A277 Crystallography And Mutagenesis Point To An Essenti 6e-72
1tyf_A193 The Structure Of Clpp At 2.3 Angstrom Resolution Su 4e-66
3mt6_R207 Structure Of Clpp From Escherichia Coli In Complex 5e-66
3hln_A193 Crystal Structure Of Clpp A153c Mutant With Inter-H 6e-66
1yg8_A193 The Structure Of A V6a Variant Of Clpp. Length = 19 1e-65
3st9_A197 Crystal Structure Of Clpp In Heptameric Form From S 1e-63
3tt7_A197 Structure Of Clpp From Bacillus Subtilis In Complex 5e-63
3tt6_A196 Structure Of Clpp From Bacillus Subtilis In Compres 5e-63
3ktg_A199 Structure Of Clpp From Bacillus Subtilis In Monocli 7e-63
3qwd_A203 Crystal Structure Of Clpp From Staphylococcus Aureu 7e-63
2zl0_A196 Crystal Structure Of H.Pylori Clpp Length = 196 8e-63
3kti_A199 Structure Of Clpp In Complex With Adep1 Length = 19 1e-62
3v5i_A203 The Crystal Structure Of The Mutant Clpp S98a (Stap 2e-62
2zl3_A196 Crystal Structure Of H.Pylori Clpp S99a Length = 19 2e-62
3p2l_A201 Crystal Structure Of Atp-Dependent Clp Protease Sub 2e-60
3q7h_A195 Structure Of The Clpp Subunit Of The Atp-Dependent 2e-59
1y7o_A218 The Structure Of Streptococcus Pneumoniae A153p Clp 9e-47
2ce3_A200 Crystal Structure Of The Atp-Dependent Clp Protease 8e-42
2cby_A208 Crystal Structure Of The Atp-Dependent Clp Protease 9e-42
2c8t_A206 The 3.0 A Resolution Structure Of Caseinolytic Clp 1e-41
2f6i_A215 Crystal Structure Of The Clpp Protease Catalytic Do 2e-40
4gm2_A205 The Crystal Structure Of A Peptidase From Plasmodiu 8e-24
4hnk_A219 Crystal Structure Of An Enzyme Length = 219 9e-24
>pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N- Terminus Of Human Mitochondrial Clpp Length = 277 Back     alignment and structure 
Iteration: 1

 Score =  266 bits (681), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 159/198 (80%)
Query: 28  SARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENP 87
           + R+  LIP+V+E + RGERAYDI+SRLL+ERI+C+ GPI+D  A +V+AQLLFL+SE+ 
Sbjct: 52  ATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESN 111
Query: 88  SKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALP 147
            KPIHMY+NSPGG VTAGLAIYDTMQYI +PI T C+GQAASMGSLLLA+GT G R +LP
Sbjct: 112 KKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLP 171
Query: 148 NSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMT 207
           NS IMIHQPSGG  GQA D+ I  ++I+++   L  +Y KHT QS++VI+  M+RD +M+
Sbjct: 172 NSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMS 231
Query: 208 PEEAKEFGIIDEVIDQRP 225
           P EA+EFGI+D+V+   P
Sbjct: 232 PMEAQEFGILDKVLVHPP 249
>pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 Back     alignment and structure
>pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 Back     alignment and structure
>pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 Back     alignment and structure
>pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 Back     alignment and structure
>pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From Staphylococcus Aureus Length = 197 Back     alignment and structure
>pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With Dfp Length = 197 Back     alignment and structure
>pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed State Length = 196 Back     alignment and structure
>pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 Back     alignment and structure
>pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus Length = 203 Back     alignment and structure
>pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 Back     alignment and structure
>pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 Back     alignment and structure
>pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a (Staphylococcus Aureus) Length = 203 Back     alignment and structure
>pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 Back     alignment and structure
>pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 Back     alignment and structure
>pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 Back     alignment and structure
>pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 Back     alignment and structure
>pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 Back     alignment and structure
>pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 Back     alignment and structure
>pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 Back     alignment and structure
>pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 Back     alignment and structure
>pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium Falciparum Length = 205 Back     alignment and structure
>pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 1e-135
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 1e-135
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 1e-134
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 1e-134
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 1e-132
2f6i_A215 ATP-dependent CLP protease, putative; structural g 1e-128
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 1e-123
3viv_A230 441AA long hypothetical NFED protein; protein-pept 2e-40
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 Back     alignment and structure
 Score =  381 bits (981), Expect = e-135
 Identities = 129/236 (54%), Positives = 166/236 (70%), Gaps = 1/236 (0%)

Query: 9   SRTSMATKFLQLSKPSAQISARSFSLIPMVIEHSSRGERAYDIFSRLLKERIICINGPIN 68
                    L L +     + R+  LIP+V+E + RGERAYDI+SRLL+ERI+C+ GPI+
Sbjct: 33  PPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPID 92

Query: 69  DDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAA 128
           D  A +V+AQLLFL+SE+  KPIHMY+NSPGG VTAGLAIYDTMQYI +PI T C+GQAA
Sbjct: 93  DSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAA 152

Query: 129 SMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKH 188
           SMGSLLLA+GT G R +LPNS IMIHQPSGG  GQA D+ I  ++I+++   L  +Y KH
Sbjct: 153 SMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKH 212

Query: 189 TGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRPMALVTDAVGREGKEGKEGK 244
           T QS++VI+  M+RD +M+P EA+EFGI+D+V+   P     D      KE  E  
Sbjct: 213 TKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQD-GEDEPTLVQKEPVEAA 267
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Length = 193 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Length = 203 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 100.0
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 100.0
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 100.0
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 100.0
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 100.0
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 100.0
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 100.0
2f6i_A215 ATP-dependent CLP protease, putative; structural g 100.0
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.97
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 99.9
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.87
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.82
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 99.04
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 99.03
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 98.99
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 98.95
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 98.95
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 98.94
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 98.93
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 98.93
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 98.91
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 98.86
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 98.85
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 98.85
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 98.85
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 98.84
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 98.83
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 98.83
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 98.83
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 98.82
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 98.82
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 98.81
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 98.81
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 98.8
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 98.79
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 98.79
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 98.77
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 98.77
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 98.76
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 98.72
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 98.71
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 98.71
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 98.71
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 98.71
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 98.7
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 98.69
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 98.69
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 98.69
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 98.69
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 98.68
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 98.68
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 98.68
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.66
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 98.65
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.65
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 98.65
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 98.64
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 98.64
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 98.64
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 98.63
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 98.63
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 98.61
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 98.61
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 98.61
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 98.61
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 98.6
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 98.6
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 98.6
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 98.59
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 98.57
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 98.55
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 98.54
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 98.54
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 98.54
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 98.53
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 98.52
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 98.49
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.47
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 98.47
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 98.47
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 98.46
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 98.46
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 98.45
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 98.45
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 98.43
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 98.39
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 98.36
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 98.35
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.33
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 98.23
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 98.21
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 98.19
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.18
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 98.17
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 98.16
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 98.1
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 98.08
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 97.98
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 97.89
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 97.84
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 97.8
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 97.7
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 97.31
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 96.86
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 94.07
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 93.78
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 93.45
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 92.69
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 91.07
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 90.71
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 89.46
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 88.17
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 87.85
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 82.45
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
Probab=100.00  E-value=1.3e-57  Score=391.89  Aligned_cols=182  Identities=34%  Similarity=0.560  Sum_probs=169.9

Q ss_pred             cCCCCcccchhhhhccCcEEEEcceeCcchHHHHHHHHHHhhhcCCCCCeEEEEeCCC----------CcHHHHHHHHHH
Q 025670           42 SSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPG----------GQVTAGLAIYDT  111 (249)
Q Consensus        42 ~~~g~~~~di~~~l~~~riI~L~g~Id~~~a~~i~a~L~~l~~~~~~~~I~l~INSPG----------G~V~ag~aIyd~  111 (249)
                      +.++++++|||++||++|||||+|+|++++++.|++||++|+.+++.++|+|||||||          |+|++|++|||+
T Consensus        12 ~~~~~~~~di~s~Ll~~Riifl~~~I~d~~a~~iiaqLl~L~~ed~~k~I~lyINSpG~~~~~~~~~~G~v~aglaIyd~   91 (205)
T 4gm2_A           12 SGRENLYFQGPSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGITDVISIVDV   91 (205)
T ss_dssp             ----------CHHHHTTTEEEECSCCCHHHHHHHHHHHHHHHHHCTTCCEEEEEEECTTEETTEESCTTHHHHHHHHHHH
T ss_pred             cCCCCCCcCHHHHHhcCCEEEECCEEcHHHHHHHHHHHHHHHhcCCCCCEEEEEeCCCCCCcCCCCCCCCHHHHHHHHHH
Confidence            4678899999999999999999999999999999999999999999999999999999          999999999999


Q ss_pred             HHhcCCCEEEEEccccchHHHHHHhcCCCCcEEeccCceEeeecCCCCC-CCchhhHHHHHHHHHHHHHHHHHHHHHhhC
Q 025670          112 MQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGY-SGQAKDMTIHTKQIVRVWDALNALYCKHTG  190 (249)
Q Consensus       112 i~~~~~pV~tv~~G~AASaa~~I~~ag~kg~R~a~p~s~imiHqp~~~~-~G~~~di~~~a~~l~~~~~~~~~~ya~~tg  190 (249)
                      |+++++||+|+|.|+|||||++|+++|++|+|+++|||++|+|||+++. .|+++|++++++++.++++.+.++|+++||
T Consensus        92 m~~~~~~V~t~~~G~AaS~as~il~aG~~gkR~~lP~a~iMIHqP~~~~~~G~a~di~i~a~el~~~~~~i~~iya~~TG  171 (205)
T 4gm2_A           92 INYISSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIIPFNQATNIEIQNKEIMNTKKKVIEIISKNTE  171 (205)
T ss_dssp             HHHSSSCEEEEEEEEEETHHHHHHTTSCTTCEEECTTCEEEECCCCCCCCSSCCSCHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHhcCCCEEEEEEeeehhHHHHHHhcCCCCCEEecCCCEEEEecCcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            9999999999999999999999999999999999999999999999998 999999999999999999999999999999


Q ss_pred             CCHHHHHhhhcCCcccCHHHHHHcCCcceecCC
Q 025670          191 QSIEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQ  223 (249)
Q Consensus       191 ~~~~~i~~~~~~d~~lsa~EA~e~GlID~I~~~  223 (249)
                      ++.++|.+++++|+||+|+||++|||||+|++.
T Consensus       172 ~~~e~I~~~m~rd~~msa~EA~eyGlID~V~~~  204 (205)
T 4gm2_A          172 KDTNVISNVLERDKYFNADEAVDFKLIDHILEK  204 (205)
T ss_dssp             CCHHHHHHHTTSCEEEEHHHHHHTTSCSEECCC
T ss_pred             CCHHHHHHHhcCCcccCHHHHHHcCCccEeecC
Confidence            999999999999999999999999999999975
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1yg6a1183 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Es 8e-89
d1tg6a1193 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Hum 7e-86
d1y7oa1192 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str 9e-73
d2cbya1179 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {My 2e-70
d2f6ia1190 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {P 1e-60
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Escherichia coli [TaxId: 562]

 Score =  258 bits (661), Expect = 8e-89
 Identities = 100/182 (54%), Positives = 144/182 (79%)

Query: 43  SRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQV 102
           SRGER++DI+SRLLKER+I + G + D  A+++VAQ+LFLE+ENP K I++Y+NSPGG +
Sbjct: 1   SRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVI 60

Query: 103 TAGLAIYDTMQYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSG 162
           TAG++IYDTMQ+I+  ++TIC+GQAASMG+ LL +G KG+R  LPNS +MIHQP GGY G
Sbjct: 61  TAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQG 120

Query: 163 QAKDMTIHTKQIVRVWDALNALYCKHTGQSIEVIQKNMDRDYFMTPEEAKEFGIIDEVID 222
           QA D+ IH ++I++V   +N L   HTGQS+E I+++ +RD F++  EA E+G++D ++ 
Sbjct: 121 QATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILT 180

Query: 223 QR 224
            R
Sbjct: 181 HR 182
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 100.0
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 100.0
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 100.0
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 100.0
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 100.0
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 98.73
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 98.65
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.63
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 98.61
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.59
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 98.58
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 98.56
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.52
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 98.51
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 98.48
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 98.45
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 98.42
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 98.42
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 98.39
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 98.2
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 98.19
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 98.17
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 98.05
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 98.0
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 97.95
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 97.22
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 96.49
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 94.73
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 94.25
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 93.34
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 92.82
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 91.81
d1fc6a4294 Photosystem II D1 C-terminal processing protease { 89.23
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

Probab=100.00  E-value=2.2e-58  Score=392.16  Aligned_cols=193  Identities=63%  Similarity=1.055  Sum_probs=180.2

Q ss_pred             CCCCceeeccCCCCcccchhhhhccCcEEEEcceeCcchHHHHHHHHHHhhhcCCCCCeEEEEeCCCCcHHHHHHHHHHH
Q 025670           33 SLIPMVIEHSSRGERAYDIFSRLLKERIICINGPINDDTAHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTM  112 (249)
Q Consensus        33 ~~~p~~~~~~~~g~~~~di~~~l~~~riI~L~g~Id~~~a~~i~a~L~~l~~~~~~~~I~l~INSPGG~V~ag~aIyd~i  112 (249)
                      +++|.|++++++|++++|||++||++|||||+|+|++++++.++++|++|+.+++.++|.||||||||+|++|++|||+|
T Consensus         1 p~~p~~~~~~~~~~~~~Di~s~l~~~Riifl~g~I~~~~~~~~i~~l~~l~~~~~~~~I~l~InS~GG~v~~g~~i~d~i   80 (193)
T d1tg6a1           1 PLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTM   80 (193)
T ss_dssp             CCCCBCC---------CBHHHHHHTTTEEEEESSBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHHHHHHHH
T ss_pred             CCCCEEEeecCCCchhhhHhHHHhccCEEEECCEEchHHHHHHHHHHHHhcccCCCcEEEEEeecCcccHHHHHHHHHHH
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCEEEEEccccchHHHHHHhcCCCCcEEeccCceEeeecCCCCCCCchhhHHHHHHHHHHHHHHHHHHHHHhhCCC
Q 025670          113 QYIRSPINTICLGQAASMGSLLLASGTKGERRALPNSTIMIHQPSGGYSGQAKDMTIHTKQIVRVWDALNALYCKHTGQS  192 (249)
Q Consensus       113 ~~~~~pV~tv~~G~AASaa~~I~~ag~kg~R~a~p~s~imiHqp~~~~~G~~~di~~~a~~l~~~~~~~~~~ya~~tg~~  192 (249)
                      +.+++||+|+|.|.|+|||++|+++|++|+|+++|||++|+|||++++.|+.+|++.++++++++++.+.++|+++||++
T Consensus        81 ~~~~~~V~tv~~G~aaS~a~~il~aG~~g~R~~~pns~~miHq~~~~~~G~~~di~~~~~el~~~~~~i~~i~a~~Tg~~  160 (193)
T d1tg6a1          81 QYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQS  160 (193)
T ss_dssp             HHSCSCEEEEEEEEEETHHHHHHHTSCTTCEEECTTCEEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_pred             HhhcCceEEEEccchHHHHHHHhhcCccCccccCcccHHHhcCCccCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhcCCcccCHHHHHHcCCcceecCCCc
Q 025670          193 IEVIQKNMDRDYFMTPEEAKEFGIIDEVIDQRP  225 (249)
Q Consensus       193 ~~~i~~~~~~d~~lsa~EA~e~GlID~I~~~~~  225 (249)
                      .++|++++++|+||+|+||++|||||+|++.++
T Consensus       161 ~~~i~~~~~rD~~lta~EAl~yGliD~Ii~~~p  193 (193)
T d1tg6a1         161 LQVIESAMERDRYMSPMEAQEFGILDKVLVHPP  193 (193)
T ss_dssp             HHHHHHHHSSCEEECHHHHHHHTSCSEECSSCC
T ss_pred             HHHHHHHhccCccCCHHHHHHcCCCCEEccCCC
Confidence            999999999999999999999999999998753
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure