Citrus Sinensis ID: 025707

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFSSISVSFCFITQ
cccccccccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHcccccccEEEEEEcccEEcccccccccccHHHHHHHHHHHHcHHccccEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHccEEEEccccccccccccccccccccccccccccccccccccccc
ccccccccccEEEccccccEEEHcccccccccccccccccHHHHHHHHHHHHHccccEEccccccccccHHHHHHHHHccccccEEEEEEEccEEccccccccccccHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHcccEEEEccccccccccccccHcHccHHHccccHHHHHHHHHHHcc
maedkklqvprvklgtqglevsklgygcmslsgcynsplseedgISIIKHAFskgitffdtadkygpytNEILLGKALKELPRENIQVATKFGFVELGFtsvivkgtpeyvRSCCEASLRRLDVEYIDLYYQhrvdtsvpiEETIGEMKKLVEEGKIKyiglseaspdtiRRAHAVHPITAVQLEWSLWARDIENEIVPLCRelgigivpycplgrgffggkAVVESVPLDSFLVCFSSisvsfcfitq
maedkklqvprvklgtqglevskLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTsvivkgtpeyVRSCCEASLRRLDVEYIDLYYqhrvdtsvpieETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFSSISVSFCFITQ
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDsflvcfssisvsfcfiTQ
************KLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFSSISVSFCFI**
*************LGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFSSISVSF*FI**
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFSSISVSFCFITQ
*******QVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFSSISVSFCFITQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFSSISVSFCFITQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
C6TBN2346 Probable aldo-keto reduct no no 0.919 0.661 0.777 1e-106
Q3L181337 Perakine reductase OS=Rau N/A no 0.907 0.670 0.744 4e-97
Q84M96346 Probable aldo-keto reduct yes no 0.907 0.653 0.638 9e-82
Q93ZN2345 Probable aldo-keto reduct no no 0.899 0.649 0.654 6e-81
O22707345 Probable aldo-keto reduct no no 0.903 0.652 0.647 1e-80
P40691307 Auxin-induced protein PCN N/A no 0.851 0.690 0.671 2e-79
F4HPY8330 Probable aldo-keto reduct no no 0.879 0.663 0.645 2e-79
Q7XT99351 Probable aldo-keto reduct no no 0.895 0.635 0.643 1e-78
A2XRZ0351 Probable aldo-keto reduct N/A no 0.895 0.635 0.643 1e-78
Q9ASZ9345 Probable aldo-keto reduct no no 0.879 0.634 0.647 2e-78
>sp|C6TBN2|AKR1_SOYBN Probable aldo-keto reductase 1 OS=Glycine max GN=AKR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  384 bits (986), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/229 (77%), Positives = 201/229 (87%)

Query: 6   KLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKY 65
           + Q+  VKLGTQG EVSKLG+GCM L+G YN PL E+DGIS+IK+AFSKGITFFDTAD Y
Sbjct: 3   QAQIQPVKLGTQGFEVSKLGFGCMGLTGAYNDPLQEQDGISVIKYAFSKGITFFDTADVY 62

Query: 66  GPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVE 125
           G   NE+L+GKALK+LPRE IQ+ATKFG    GF  + ++G+PEYVRSCCE  L+RLDVE
Sbjct: 63  GANANELLVGKALKQLPREKIQIATKFGIASRGFPDMKIEGSPEYVRSCCETGLKRLDVE 122

Query: 126 YIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLE 185
           YIDLYYQHRVDTSVPIEET+GE+KKLVEEGK+KYIGLSEASPDTIRRAHA+HPITAVQ+E
Sbjct: 123 YIDLYYQHRVDTSVPIEETVGELKKLVEEGKVKYIGLSEASPDTIRRAHAIHPITAVQIE 182

Query: 186 WSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFL 234
           WSLW RDIE EIVPLCRELGIGIVPY PLGRGFFGGK VVE+VP +S L
Sbjct: 183 WSLWTRDIEEEIVPLCRELGIGIVPYSPLGRGFFGGKGVVENVPTNSSL 231
May interfere with the nodulation process and inhibits nodule development.
Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q3L181|PERR_RAUSE Perakine reductase OS=Rauvolfia serpentina GN=PR PE=1 SV=1 Back     alignment and function description
>sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 Back     alignment and function description
>sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 Back     alignment and function description
>sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|F4HPY8|AKR6_ARATH Probable aldo-keto reductase 6 OS=Arabidopsis thaliana GN=At1g60750 PE=3 SV=1 Back     alignment and function description
>sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 Back     alignment and function description
>sp|A2XRZ0|AKR2_ORYSI Probable aldo-keto reductase 2 OS=Oryza sativa subsp. indica GN=OsI_15387 PE=3 SV=1 Back     alignment and function description
>sp|Q9ASZ9|ALKR5_ARATH Probable aldo-keto reductase 5 OS=Arabidopsis thaliana GN=At1g60730 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
356571605345 PREDICTED: LOW QUALITY PROTEIN: auxin-in 0.931 0.672 0.775 1e-107
255542314343 aldo/keto reductase, putative [Ricinus c 0.947 0.688 0.755 1e-105
449445274347 PREDICTED: probable aldo-keto reductase 0.939 0.674 0.761 1e-105
225451316347 PREDICTED: auxin-induced protein PCNT115 0.931 0.668 0.774 1e-104
224125632348 predicted protein [Populus trichocarpa] 0.939 0.672 0.754 1e-104
378548275346 RecName: Full=Probable aldo-keto reducta 0.919 0.661 0.777 1e-104
356573095346 PREDICTED: LOW QUALITY PROTEIN: auxin-in 0.927 0.667 0.780 1e-104
356505965 351 PREDICTED: auxin-induced protein PCNT115 0.943 0.669 0.762 1e-104
225451312342 PREDICTED: auxin-induced protein PCNT115 0.911 0.663 0.780 1e-103
116781851339 unknown [Picea sitchensis] 0.907 0.666 0.810 1e-103
>gi|356571605|ref|XP_003553967.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] Back     alignment and taxonomy information
 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 180/232 (77%), Positives = 208/232 (89%)

Query: 5   KKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADK 64
           + +Q+PRVKLGTQGLEVSKLGYGCM L+G YN PL EE+GIS+IKHAFSKGITFFDT+D 
Sbjct: 3   QSVQMPRVKLGTQGLEVSKLGYGCMGLTGAYNDPLPEEEGISVIKHAFSKGITFFDTSDM 62

Query: 65  YGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDV 124
           YGP+ NEI+LGKA+K+LPRE IQ+ATKFG  ++  + ++VKGTPEY RSCCEASL+RL V
Sbjct: 63  YGPHANEIVLGKAIKQLPREKIQIATKFGITKIDSSGMVVKGTPEYARSCCEASLKRLGV 122

Query: 125 EYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQL 184
           EYIDLYYQHRVD SVPIEETIGE+KKLVEEGK++YIGLSEASPDTIRRAHAVHPITAVQ+
Sbjct: 123 EYIDLYYQHRVDLSVPIEETIGELKKLVEEGKVRYIGLSEASPDTIRRAHAVHPITAVQM 182

Query: 185 EWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVC 236
           EWSLW RDIE+EI+PLC+ELGIGIVPY PLGRGFFGGK V+E+V   S L+ 
Sbjct: 183 EWSLWTRDIEDEIIPLCKELGIGIVPYSPLGRGFFGGKGVLETVSTVSSLIT 234

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255542314|ref|XP_002512220.1| aldo/keto reductase, putative [Ricinus communis] gi|223548181|gb|EEF49672.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449445274|ref|XP_004140398.1| PREDICTED: probable aldo-keto reductase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225451316|ref|XP_002278850.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] gi|298204869|emb|CBI34176.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125632|ref|XP_002319637.1| predicted protein [Populus trichocarpa] gi|222858013|gb|EEE95560.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|378548275|sp|C6TBN2.1|AKR1_SOYBN RecName: Full=Probable aldo-keto reductase 1; Short=GmAKR1 gi|255637828|gb|ACU19234.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356573095|ref|XP_003554700.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] Back     alignment and taxonomy information
>gi|356505965|ref|XP_003521759.1| PREDICTED: auxin-induced protein PCNT115-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|225451312|ref|XP_002278643.1| PREDICTED: auxin-induced protein PCNT115 [Vitis vinifera] gi|298204874|emb|CBI34181.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|116781851|gb|ABK22267.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2036591346 AT1G60680 "AT1G60680" [Arabido 0.919 0.661 0.633 9.3e-75
TAIR|locus:2036504345 ATB2 [Arabidopsis thaliana (ta 0.891 0.643 0.656 9.3e-75
TAIR|locus:2036611345 AT1G60690 "AT1G60690" [Arabido 0.903 0.652 0.650 1.2e-74
TAIR|locus:2036551330 AT1G60750 [Arabidopsis thalian 0.879 0.663 0.645 1.7e-73
TAIR|locus:2196446344 AT1G10810 "AT1G10810" [Arabido 0.879 0.636 0.642 4.3e-70
TIGR_CMR|SPO_A0345327 SPO_A0345 "oxidoreductase, ald 0.839 0.639 0.549 2.9e-55
TIGR_CMR|GSU_3126334 GSU_3126 "oxidoreductase, aldo 0.835 0.622 0.516 3e-53
UNIPROTKB|G4NAH9341 MGG_09715 "Aldo-keto reductase 0.847 0.618 0.445 5.7e-43
POMBASE|SPAC1F7.12340 yak3 "aldose reductase ARK13 f 0.851 0.623 0.431 3.6e-41
ASPGD|ASPL0000051701339 AN10217 [Emericella nidulans ( 0.855 0.628 0.420 1.6e-38
TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 754 (270.5 bits), Expect = 9.3e-75, P = 9.3e-75
 Identities = 147/232 (63%), Positives = 180/232 (77%)

Query:     1 MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFD 60
             MAE    +V R+KLG+QGLEVS  G GCM+LS  Y +P  E D I+++ HA + G+TFFD
Sbjct:     1 MAE--ACRVRRMKLGSQGLEVSAQGLGCMALSARYGAPKPETDAIALLHHAINSGVTFFD 58

Query:    61 TADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLR 120
             T+D YGP TNE+LLGKALK+  +E +++ATKFGF  +      V+G PEYVR+ CEASL+
Sbjct:    59 TSDMYGPETNELLLGKALKDGVKEKVELATKFGFFIVEGEISEVRGDPEYVRAACEASLK 118

Query:   121 RLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIT 180
             RLD+  IDLYYQHR+DT VPIE T+ E+KKLVEEGKIKYIGLSEAS  TIRRAHAVHPIT
Sbjct:   119 RLDIACIDLYYQHRIDTRVPIEITMRELKKLVEEGKIKYIGLSEASASTIRRAHAVHPIT 178

Query:   181 AVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFG-GKAVVESVPLD 231
             AVQ+EWSLW+RD E +I+P+CRELGIGIV Y PLGRGF   G  + E++  D
Sbjct:   179 AVQIEWSLWSRDAEEDIIPICRELGIGIVAYSPLGRGFLAAGPKLAENLEND 230
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84M96ALKR2_ARATH1, ., 1, ., 1, ., -0.63870.90760.6531yesno
Q3L181PERR_RAUSE1, ., 1, ., 1, ., 3, 1, 70.74440.90760.6706N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 1e-86
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 2e-83
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 2e-69
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 2e-36
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 4e-30
PLN02587314 PLN02587, PLN02587, L-galactose dehydrogenase 6e-27
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 7e-26
PRK09912346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 1e-23
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 6e-22
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-20
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 6e-16
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 3e-10
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 1e-06
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information 
 Score =  258 bits (662), Expect = 1e-86
 Identities = 92/229 (40%), Positives = 128/229 (55%), Gaps = 11/229 (4%)

Query: 11  RVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTN 70
              LG  GL+VS+LG G   L G Y   + EE+  + ++ A   GI F DTAD YG   +
Sbjct: 1   YRTLGKTGLKVSRLGLGTWQLGGGY---VDEEEAAAAVRAALDAGINFIDTADVYGDGES 57

Query: 71  EILLGKALKELP-RENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDL 129
           E LLG+ALKE   RE + +ATK G             +PE++R   E SL+RL  +YIDL
Sbjct: 58  EELLGEALKERGPREEVFIATKVGPRPGDG----RDLSPEHIRRAVEESLKRLGTDYIDL 113

Query: 130 YYQHRVDTSVP-IEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAV--HPITAVQLEW 186
           Y  H  D   P IEET+  +++LV+EGKI+ IG+S  S + +  A A    P    Q+E+
Sbjct: 114 YLLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAAGVPPAVNQVEY 173

Query: 187 SLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLV 235
           +L  R  E E++P CRE GIG++ Y PL  G   GK +  + P +  L+
Sbjct: 174 NLLDRQAEEELLPYCREHGIGVIAYSPLAGGLLTGKYLPGAPPPEGDLL 222

AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
PLN02587314 L-galactose dehydrogenase 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
KOG1576342 consensus Predicted oxidoreductase [Energy product 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.88
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 95.6
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 92.94
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 91.36
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 91.16
KOG0259 447 consensus Tyrosine aminotransferase [Amino acid tr 90.41
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 90.24
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 90.12
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 89.93
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 89.37
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 89.28
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 88.87
PF00682237 HMGL-like: HMGL-like of this family is not conserv 88.43
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 88.37
PRK13796 365 GTPase YqeH; Provisional 88.18
PRK08609570 hypothetical protein; Provisional 85.63
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesi 85.27
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 85.07
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 84.64
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 83.72
cd03322361 rpsA The starvation sensing protein RpsA from E.co 83.67
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 83.5
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 83.27
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 83.1
cd00308229 enolase_like Enolase-superfamily, characterized by 82.07
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 82.06
PRK06294370 coproporphyrinogen III oxidase; Provisional 82.05
PRK07379400 coproporphyrinogen III oxidase; Provisional 81.86
PRK08392215 hypothetical protein; Provisional 81.69
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 81.41
PRK08446350 coproporphyrinogen III oxidase; Provisional 81.39
COG1140 513 NarY Nitrate reductase beta subunit [Energy produc 81.06
PRK07945335 hypothetical protein; Provisional 80.32
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 80.17
PRK05692 287 hydroxymethylglutaryl-CoA lyase; Provisional 80.06
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=4.2e-54  Score=374.34  Aligned_cols=217  Identities=44%  Similarity=0.719  Sum_probs=197.2

Q ss_pred             CCceecCCCCcccCcceeecccccCCCCCCCCHHHHHHHHHHHHHcCCCeEeCCCCcCCCchHHHHHHHHHcCC-CCCeE
Q 025707            9 VPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELP-RENIQ   87 (249)
Q Consensus         9 m~~~~lg~~g~~vs~lg~Gt~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~Dta~~Yg~g~se~~lg~~l~~~~-r~~~~   87 (249)
                      |++|++|++|++||+||||||++|+. ....+++++.++|++|+++||||||||+.||.|.||++||++|+..+ |++++
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~-~~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~sE~ilG~~l~~~~~Rd~vv   79 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGD-TDDEEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVV   79 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCC-CCchhhhHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHHhccCCCCeEE
Confidence            78999999999999999999999985 23335667888999999999999999999999999999999999744 89999


Q ss_pred             EEecccccccCCccc-ccCCCHHHHHHHHHHHHHHcCCCceeEEEeecCCCCCCHHHHHHHHHHHHHcCCeeEEEcCCCC
Q 025707           88 VATKFGFVELGFTSV-IVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEAS  166 (249)
Q Consensus        88 I~tK~~~~~~~~~~~-~~~~s~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~  166 (249)
                      |+||++.....+... ..+.++++|+++++.||+|||+||||+|++|++|...+.++++++|++|+++|+||+||+||++
T Consensus        80 IaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~~  159 (316)
T COG0667          80 IATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNYS  159 (316)
T ss_pred             EEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCCC
Confidence            999998765321111 2567999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhc-CCceEEeeecCccccchhhhHHHHHHHhCCcEEecccCcccccCCCCCCC
Q 025707          167 PDTIRRAHAV-HPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVE  226 (249)
Q Consensus       167 ~~~l~~~~~~-~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~v~a~spl~~G~l~g~~~~~  226 (249)
                      .++++++++. .+++++|.+||+++|..+.+++++|+++||++++||||++|+|+||+...
T Consensus       160 ~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~~spla~G~Ltgk~~~~  220 (316)
T COG0667         160 AEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLAYSPLASGLLTGKYLPG  220 (316)
T ss_pred             HHHHHHHHHhcCCceeecccCccccccchhHHHHHHHHcCCeEEEecCccccccCCCcCCC
Confidence            9999999999 69999999999999876677999999999999999999999999996653

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
3v0u_A338 Crystal Structure Of Perakine Reductase, Founder Me 6e-97
3v0t_A337 Crystal Structure Of Perakine Reductase, Founder Me 7e-97
3uyi_A337 Crystal Structure Of Perakine Reductase, Founder Me 1e-96
3v0s_A337 Crystal Structure Of Perakine Reductase, Founder Me 4e-94
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 2e-30
1ynp_A317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 7e-27
1pz1_A333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 4e-25
3n2t_A348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 5e-25
4aub_A366 The Complex Structure Of The Bacterial Aldo-Keto Re 2e-21
3n6q_A346 Crystal Structure Of Yghz From E. Coli Length = 346 2e-21
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 2e-21
3lut_A367 A Structural Model For The Full-Length Shaker Potas 1e-18
1qrq_A325 Structure Of A Voltage-Dependent K+ Channel Beta Su 2e-18
1zsx_A347 Crystal Structure Of Human Potassium Channel Kv Bet 2e-18
1exb_A332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 2e-18
2a79_A333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 2e-18
3eau_A327 Voltage-Dependent K+ Channel Beta Subunit In Comple 2e-18
3eb4_A327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 2e-18
3eb3_A327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 3e-18
2bp1_B360 Structure Of The Aflatoxin Aldehyde Reductase In Co 6e-12
2c91_A338 Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt 6e-12
2clp_A347 Crystal Structure Of Human Aflatoxin B1 Aldehyde Re 7e-12
1og6_A298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 1e-11
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 7e-11
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 7e-11
1ur3_M319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 8e-11
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 1e-10
1gve_A327 Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live 5e-10
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 2e-09
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 2e-09
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 2e-09
2alr_A324 Aldehyde Reductase Length = 324 5e-09
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 5e-09
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 5e-09
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 7e-09
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 7e-09
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 2e-08
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 2e-08
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 6e-08
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 2e-07
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 8e-07
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 3e-06
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 6e-06
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 6e-06
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 6e-06
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 6e-06
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 2e-05
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 2e-05
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 2e-04
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure 
Iteration: 1

 Score =  350 bits (897), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 167/223 (74%), Positives = 195/223 (87%), Gaps = 1/223 (0%)
Query: 8   QVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGP 67
            +PRVKLGTQGLEVSKLG+GCM LSG YN  L EE GI++IK AF+ GITFFDT+D YG 
Sbjct: 1   HMPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGE 60
Query: 68  Y-TNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEY 126
             +NE LLGKALK+LPRE IQV TKFG  E+GF+ V  KGTP+YVRSCCEASL+RLDV+Y
Sbjct: 61  NGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDY 120
Query: 127 IDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEW 186
           IDL+Y HR+DT+VPIE T+GE+KKLVEEGKIKY+GLSEASPDTIRRAHAVHP+TA+Q+E+
Sbjct: 121 IDLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEY 180
Query: 187 SLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVP 229
           SLW RDIE+EIVPLCR+LGIGIVPY P+GRG F GKA+ ES+P
Sbjct: 181 SLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKESLP 223
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 Back     alignment and structure
>pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 1e-136
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 1e-136
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 1e-120
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 1e-113
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 1e-107
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 1e-102
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 6e-68
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 2e-65
3erp_A353 Putative oxidoreductase; funded by the national in 3e-63
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 5e-61
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 4e-60
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 2e-59
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 8e-48
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 6e-24
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-23
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 1e-22
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 6e-22
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 3e-21
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 3e-21
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 4e-21
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 6e-21
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 7e-21
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 8e-21
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-20
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 1e-20
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 2e-20
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 2e-20
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 2e-20
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-20
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 3e-20
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 7e-20
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 8e-20
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 3e-19
4gie_A290 Prostaglandin F synthase; structural genomics, nia 3e-19
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 4e-19
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 6e-19
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 3e-18
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 1e-14
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
 Score =  386 bits (993), Expect = e-136
 Identities = 68/213 (31%), Positives = 116/213 (54%), Gaps = 2/213 (0%)

Query: 11  RVKLGTQGLEVSKLGYGCMSLSG-CYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYT 69
           + KLG   L+V  +G G  ++ G      L+EE G  +++ A   G+T  DTA  YG   
Sbjct: 3   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGR 62

Query: 70  NEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDL 129
           +E L+G+ L+E  RE++ +ATK    + G    +   +P++++   + SL+RL+ +YIDL
Sbjct: 63  SEELIGEVLREFNREDVVIATKAAHRKQG-NDFVFDNSPDFLKKSVDESLKRLNTDYIDL 121

Query: 130 YYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLW 189
           +Y H  D   P +E +  + ++ + GKI+ IG+S  S + ++ A+    +  +Q E++L 
Sbjct: 122 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 181

Query: 190 ARDIENEIVPLCRELGIGIVPYCPLGRGFFGGK 222
            R+ E    P  +E  I  +PY PL  G   GK
Sbjct: 182 NREAEKTFFPYTKEHNISFIPYFPLVSGLLAGK 214
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.83
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 94.28
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 93.82
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 93.64
2o56_A407 Putative mandelate racemase; dehydratase, structur 93.61
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 93.54
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 93.48
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 93.44
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 93.43
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 93.31
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 93.31
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 93.17
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 92.93
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 92.67
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 92.51
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 92.31
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 92.3
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 92.29
2qgy_A391 Enolase from the environmental genome shotgun sequ 92.23
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 92.2
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 91.93
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 91.8
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 91.75
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 91.67
3eez_A378 Putative mandelate racemase/muconate lactonizing e 91.42
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 91.42
3r0u_A379 Enzyme of enolase superfamily; structural genomics 91.27
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 91.16
2gl5_A410 Putative dehydratase protein; structural genomics, 90.95
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 90.9
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 90.79
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 90.73
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 90.66
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 90.53
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 90.52
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 90.39
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 90.22
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 90.12
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 90.11
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 89.97
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 89.97
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 89.74
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 89.63
2poz_A392 Putative dehydratase; octamer, structural genomics 89.52
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 89.15
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 88.85
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 88.54
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 88.49
1tzz_A392 Hypothetical protein L1841; structural genomics, m 88.49
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 88.23
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 87.86
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 87.82
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 87.59
3va8_A445 Probable dehydratase; enolase, magnesium binding s 87.53
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 87.28
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 86.57
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 86.41
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 86.39
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 86.37
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 86.01
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 85.91
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 85.49
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 85.14
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 84.82
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 84.62
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 84.59
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 84.2
2oz8_A389 MLL7089 protein; structural genomics, unknown func 83.99
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 83.88
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 82.35
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 82.08
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 81.99
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 81.82
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 81.81
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 81.61
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 81.4
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 81.24
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 81.01
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-56  Score=394.29  Aligned_cols=230  Identities=72%  Similarity=1.201  Sum_probs=194.7

Q ss_pred             CCceecCCCCcccCcceeecccccCCCCCCCCHHHHHHHHHHHHHcCCCeEeCCCCcCC-CchHHHHHHHHHcCCCCCeE
Q 025707            9 VPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGP-YTNEILLGKALKELPRENIQ   87 (249)
Q Consensus         9 m~~~~lg~~g~~vs~lg~Gt~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~Dta~~Yg~-g~se~~lg~~l~~~~r~~~~   87 (249)
                      |+||+||++|++||+||||||++|+.|+...+++++.++|+.|+++|||+||||+.||+ |.+|+.+|++|+..+|++++
T Consensus         1 M~~~~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~~G~sE~~lG~al~~~~R~~~~   80 (337)
T 3v0s_A            1 MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREXIQ   80 (337)
T ss_dssp             CCEEECSSSSCEEESSCEECGGGC-------CHHHHHHHHHHHHHTTCCEEECCTTSSSTTHHHHHHHHHHTTSCGGGCE
T ss_pred             CCeeecCCCCceecCeeecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEEChhhhCCCCcHHHHHHHHHhhcCCcceE
Confidence            89999999999999999999999987876668999999999999999999999999997 58999999999866899999


Q ss_pred             EEecccccccCCcccccCCCHHHHHHHHHHHHHHcCCCceeEEEeecCCCCCCHHHHHHHHHHHHHcCCeeEEEcCCCCH
Q 025707           88 VATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASP  167 (249)
Q Consensus        88 I~tK~~~~~~~~~~~~~~~s~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~~  167 (249)
                      |+||++......+....+.+++.+++++++||++||+||||+|++|+|+...+++++|++|++|+++|+||+||||||++
T Consensus        81 i~TK~~~~~~~~~~~~~~~~~~~i~~~~~~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~  160 (337)
T 3v0s_A           81 VGTKFGIHEIGFSGVKAXGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXXLVEEGKIXYVGLSEASP  160 (337)
T ss_dssp             EEEEECEEEEETTEEEECCCHHHHHHHHHHHHHHHTCSCEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEEEESCCH
T ss_pred             EEeeeccccCCCCcccCCCCHHHHHHHHHHHHHHhCCCCeeEEEecCCCCCCCHHHHHHHHHHHHHCCCeeEEeccCCCH
Confidence            99999875422222334678999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCCceEEeeecCccccchhhhHHHHHHHhCCcEEecccCcccccCCCCCCCCCCCCcccccCC
Q 025707          168 DTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLVCFS  238 (249)
Q Consensus       168 ~~l~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~v~a~spl~~G~l~g~~~~~~~~~~~~~~~~~  238 (249)
                      ++++++++..+++++|++||++++..+.+++++|+++||+|++|+||++|+|+|+.....+++++++...|
T Consensus       161 ~~l~~~~~~~~~~~~Q~~~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G~L~g~~~~~~~~~~~~~~~~~  231 (337)
T 3v0s_A          161 DTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKESLPENSVLTSHP  231 (337)
T ss_dssp             HHHHHHHHHSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTHHHHHHHHHHHC------------
T ss_pred             HHHHHHhccCCceEEEeeccccccchhHHHHHHHHHcCceEEEeccccCcccCCCCCCCCCCCcchhhccc
Confidence            99999999999999999999999987778999999999999999999999999873333444444444433
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 1e-48
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 9e-48
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 6e-42
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 2e-36
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 4e-36
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-35
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 5e-34
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 6e-33
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 6e-33
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 4e-32
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 6e-31
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 5e-29
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 1e-28
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 4e-28
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 1e-25
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-23
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

 Score =  160 bits (405), Expect = 1e-48
 Identities = 70/213 (32%), Positives = 117/213 (54%), Gaps = 2/213 (0%)

Query: 11  RVKLGTQGLEVSKLGYGCMSLSGCYNSP-LSEEDGISIIKHAFSKGITFFDTADKYGPYT 69
           + KLG   L+V  +G G  ++ G    P L+EE G  +++ A   G+T  DTA  YG   
Sbjct: 2   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGR 61

Query: 70  NEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDL 129
           +E L+G+ L+E  RE++ +ATK    + G   V    +P++++   + SL+RL+ +YIDL
Sbjct: 62  SEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDN-SPDFLKKSVDESLKRLNTDYIDL 120

Query: 130 YYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLW 189
           +Y H  D   P +E +  + ++ + GKI+ IG+S  S + ++ A+    +  +Q E++L 
Sbjct: 121 FYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLL 180

Query: 190 ARDIENEIVPLCRELGIGIVPYCPLGRGFFGGK 222
            R+ E    P  +E  I  +PY PL  G   GK
Sbjct: 181 NREAEKTFFPYTKEHNISFIPYFPLVSGLLAGK 213
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 94.07
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 93.74
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 93.43
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 92.77
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 91.59
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 90.52
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 89.66
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 89.21
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 88.85
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 87.93
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 87.61
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 85.41
d1j32a_ 388 Aspartate aminotransferase, AAT {Phormidium lapide 84.76
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 84.07
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase 83.07
d1b5pa_ 382 Aspartate aminotransferase, AAT {Thermus thermophi 80.13
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=1.4e-50  Score=349.28  Aligned_cols=225  Identities=31%  Similarity=0.571  Sum_probs=203.4

Q ss_pred             CceecCCCCcccCcceeecccccCC-CCCCCCHHHHHHHHHHHHHcCCCeEeCCCCcCCCchHHHHHHHHHcCCCCCeEE
Q 025707           10 PRVKLGTQGLEVSKLGYGCMSLSGC-YNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQV   88 (249)
Q Consensus        10 ~~~~lg~~g~~vs~lg~Gt~~~~~~-~~~~~~~~~~~~~l~~A~~~Gi~~~Dta~~Yg~g~se~~lg~~l~~~~r~~~~I   88 (249)
                      ++|+||+||++||+||||||++|+. ++...+++++.++|++|++.|||+||||+.||+|.+|+.+|++|+..+|++++|
T Consensus         1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~sE~~lg~~l~~~~r~~~~i   80 (311)
T d1pyfa_           1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVI   80 (311)
T ss_dssp             CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEE
T ss_pred             CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCccHHHHhhhhhcccccceec
Confidence            5899999999999999999999873 334468999999999999999999999999999999999999999888999999


Q ss_pred             EecccccccCCcccccCCCHHHHHHHHHHHHHHcCCCceeEEEeecCCCCCCHHHHHHHHHHHHHcCCeeEEEcCCCCHH
Q 025707           89 ATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPD  168 (249)
Q Consensus        89 ~tK~~~~~~~~~~~~~~~s~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~~~  168 (249)
                      +||++...... ....+.+++.+++++++||+||++||+|++++|+++...+.++++++|++|+++|+||+||+|+++++
T Consensus        81 ~tK~~~~~~~~-~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~~  159 (311)
T d1pyfa_          81 ATKAAHRKQGN-DFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLE  159 (311)
T ss_dssp             EEEECEEEETT-EEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHH
T ss_pred             ceeccCCCCCc-ccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcHH
Confidence            99998765332 23457889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCceEEeeecCccccchhhhHHHHHHHhCCcEEecccCcccccCCCCC-CCCCCCCcccc
Q 025707          169 TIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAV-VESVPLDSFLV  235 (249)
Q Consensus       169 ~l~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~gi~v~a~spl~~G~l~g~~~-~~~~~~~~~~~  235 (249)
                      .+.++.+..+++++|++||++++....+++++|+++||++++++||++|+|++++. ...++....+.
T Consensus       160 ~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~l~~~~~~~~~~~~~~~~~  227 (311)
T d1pyfa_         160 QLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGDLRN  227 (311)
T ss_dssp             HHHHHTTTSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGGTCCCTTCCCCTTCGGG
T ss_pred             HHHHHhhcCCcceEeeeecccchhhhHHHHHHHHHCCceEEEeccccCCccCCCcCcCCCCccccccc
Confidence            99999999999999999999999877889999999999999999999999999944 34455544443
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure