Citrus Sinensis ID: 025716
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| 225431090 | 249 | PREDICTED: proteasome subunit alpha type | 1.0 | 1.0 | 0.955 | 1e-129 | |
| 225428005 | 249 | PREDICTED: proteasome subunit alpha type | 1.0 | 1.0 | 0.947 | 1e-128 | |
| 82621184 | 249 | proteasome-like protein alpha subunit-li | 1.0 | 1.0 | 0.935 | 1e-126 | |
| 449434142 | 249 | PREDICTED: proteasome subunit alpha type | 0.915 | 0.915 | 0.942 | 1e-124 | |
| 15239271 | 250 | proteasome subunit alpha type-7-B [Arabi | 1.0 | 0.996 | 0.928 | 1e-124 | |
| 76160964 | 249 | proteasome, alpha subunit-like protein [ | 0.915 | 0.915 | 0.938 | 1e-124 | |
| 449456827 | 251 | PREDICTED: proteasome subunit alpha type | 0.915 | 0.908 | 0.938 | 1e-124 | |
| 356502736 | 249 | PREDICTED: proteasome subunit alpha type | 0.915 | 0.915 | 0.938 | 1e-124 | |
| 2511580 | 235 | multicatalytic endopeptidase [Arabidopsi | 0.939 | 0.995 | 0.923 | 1e-124 | |
| 297794401 | 250 | hypothetical protein ARALYDRAFT_920118 [ | 1.0 | 0.996 | 0.928 | 1e-124 |
| >gi|225431090|ref|XP_002264052.1| PREDICTED: proteasome subunit alpha type-7 [Vitis vinifera] gi|297734987|emb|CBI17349.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 466 bits (1199), Expect = e-129, Method: Compositional matrix adjust.
Identities = 238/249 (95%), Positives = 247/249 (99%)
Query: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTVKLQDSRSV 60
MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKST KLQDSR+V
Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTAKLQDSRTV 60
Query: 61 RKIVSLDNHIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120
RKIV+LD+HIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT
Sbjct: 61 RKIVNLDDHIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120
Query: 121 QSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKE 180
QSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKE
Sbjct: 121 QSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKE 180
Query: 181 TSGQETIKLAIRALLEVVESGGKNIEVAVMTREKGLKQLDEAEIDAMVAEIEAKKAAAEA 240
TSGQET+KLAIRALLEVVESGGKNIE+AVMTRE GL+QLDEAEIDA+VAEIEA+KAAAEA
Sbjct: 181 TSGQETVKLAIRALLEVVESGGKNIEIAVMTREHGLRQLDEAEIDAIVAEIEAEKAAAEA 240
Query: 241 AKKGPPKET 249
AKKGPPK+T
Sbjct: 241 AKKGPPKDT 249
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225428005|ref|XP_002278162.1| PREDICTED: proteasome subunit alpha type-7 [Vitis vinifera] gi|297744621|emb|CBI37883.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|82621184|gb|ABB86280.1| proteasome-like protein alpha subunit-like [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|449434142|ref|XP_004134855.1| PREDICTED: proteasome subunit alpha type-7-like [Cucumis sativus] gi|449491326|ref|XP_004158862.1| PREDICTED: proteasome subunit alpha type-7-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15239271|ref|NP_201415.1| proteasome subunit alpha type-7-B [Arabidopsis thaliana] gi|12229893|sp|O24616.2|PSA7B_ARATH RecName: Full=Proteasome subunit alpha type-7-B; AltName: Full=20S proteasome alpha subunit D-2; AltName: Full=Proteasome component 6B; AltName: Full=Proteasome component 6C; AltName: Full=Proteasome subunit alpha type-4 gi|3421082|gb|AAC32059.1| 20S proteasome subunit PAD2 [Arabidopsis thaliana] gi|10177129|dbj|BAB10419.1| 20S proteasome subunit PAD2 [Arabidopsis thaliana] gi|332010781|gb|AED98164.1| proteasome subunit alpha type-7-B [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|76160964|gb|ABA40445.1| proteasome, alpha subunit-like protein [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|449456827|ref|XP_004146150.1| PREDICTED: proteasome subunit alpha type-7-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356502736|ref|XP_003520172.1| PREDICTED: proteasome subunit alpha type-7-like isoform 1 [Glycine max] gi|356502738|ref|XP_003520173.1| PREDICTED: proteasome subunit alpha type-7-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|2511580|emb|CAA73622.1| multicatalytic endopeptidase [Arabidopsis thaliana] gi|2511582|emb|CAA73623.1| multicatalytic endopeptidase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297794401|ref|XP_002865085.1| hypothetical protein ARALYDRAFT_920118 [Arabidopsis lyrata subsp. lyrata] gi|297310920|gb|EFH41344.1| hypothetical protein ARALYDRAFT_920118 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| TAIR|locus:2156962 | 250 | PAD2 "proteasome alpha subunit | 1.0 | 0.996 | 0.876 | 1.6e-111 | |
| TAIR|locus:2080833 | 250 | PAD1 "20S proteasome alpha sub | 1.0 | 0.996 | 0.86 | 7.8e-110 | |
| DICTYBASE|DDB_G0272831 | 250 | psmA7 "proteasome subunit alph | 0.907 | 0.904 | 0.709 | 1.7e-82 | |
| ZFIN|ZDB-GENE-040426-2194 | 251 | psma8 "proteasome (prosome, ma | 0.907 | 0.900 | 0.704 | 1.7e-82 | |
| UNIPROTKB|E2RF52 | 250 | PSMA8 "Proteasome subunit alph | 0.907 | 0.904 | 0.704 | 2.8e-82 | |
| UNIPROTKB|Q9PTW9 | 251 | psma7 "Proteasome subunit alph | 0.907 | 0.900 | 0.7 | 4.5e-82 | |
| UNIPROTKB|F1SBA5 | 250 | PSMA8 "Proteasome subunit alph | 0.907 | 0.904 | 0.7 | 1.2e-81 | |
| MGI|MGI:1920927 | 250 | Psma8 "proteasome (prosome, ma | 0.907 | 0.904 | 0.691 | 4.1e-81 | |
| UNIPROTKB|O14818 | 248 | PSMA7 "Proteasome subunit alph | 0.899 | 0.903 | 0.706 | 6.6e-81 | |
| UNIPROTKB|Q3ZBG0 | 248 | PSMA7 "Proteasome subunit alph | 0.899 | 0.903 | 0.706 | 1.1e-80 |
| TAIR|locus:2156962 PAD2 "proteasome alpha subunit D2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1101 (392.6 bits), Expect = 1.6e-111, P = 1.6e-111
Identities = 219/250 (87%), Positives = 230/250 (92%)
Query: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTVKLQDSRSV 60
MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDT+VL VEKKST KLQDSRS
Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSA 60
Query: 61 RKIVSLDNHIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120
RKIVSLDNHIALACAGLKADARVLIN+ARIECQSHRLT+EDPVTVEYITRYIAGLQQKYT
Sbjct: 61 RKIVSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYT 120
Query: 121 QSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKE 180
QSGGVRPFGLSTLIVGFDPY+ +PSLYQTDPSGTFSAWKANATGRNSNS+REFLEKNYKE
Sbjct: 121 QSGGVRPFGLSTLIVGFDPYSRLPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE 180
Query: 181 TSGQETIKLAIRALLEVVESGGKNIEVAVMTREK-GLKQLDEAEIDAMVXXXXXXXXXXX 239
+SGQETIKLAIRALLEVVESGGKNIEVAVMTRE+ GL+QL+EAEIDA+V
Sbjct: 181 SSGQETIKLAIRALLEVVESGGKNIEVAVMTREETGLRQLEEAEIDAIVAKIEAEKAAAE 240
Query: 240 XXXXGPPKET 249
GPPKET
Sbjct: 241 AAKKGPPKET 250
|
|
| TAIR|locus:2080833 PAD1 "20S proteasome alpha subunit PAD1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272831 psmA7 "proteasome subunit alpha type 7" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2194 psma8 "proteasome (prosome, macropain) subunit, alpha type, 8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RF52 PSMA8 "Proteasome subunit alpha type" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9PTW9 psma7 "Proteasome subunit alpha type-7" [Carassius auratus (taxid:7957)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBA5 PSMA8 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1920927 Psma8 "proteasome (prosome, macropain) subunit, alpha type, 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O14818 PSMA7 "Proteasome subunit alpha type-7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBG0 PSMA7 "Proteasome subunit alpha type-7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 249 | |||
| cd03755 | 207 | cd03755, proteasome_alpha_type_7, proteasome_alpha | 1e-145 | |
| cd01911 | 209 | cd01911, proteasome_alpha, proteasome alpha subuni | 1e-111 | |
| PRK03996 | 241 | PRK03996, PRK03996, proteasome subunit alpha; Prov | 4e-95 | |
| TIGR03633 | 224 | TIGR03633, arc_protsome_A, proteasome endopeptidas | 4e-85 | |
| cd03756 | 211 | cd03756, proteasome_alpha_archeal, proteasome_alph | 7e-81 | |
| COG0638 | 236 | COG0638, PRE1, 20S proteasome, alpha and beta subu | 1e-75 | |
| cd03750 | 227 | cd03750, proteasome_alpha_type_2, proteasome_alpha | 9e-72 | |
| cd03752 | 213 | cd03752, proteasome_alpha_type_4, proteasome_alpha | 3e-65 | |
| pfam00227 | 188 | pfam00227, Proteasome, Proteasome subunit | 9e-61 | |
| PTZ00246 | 253 | PTZ00246, PTZ00246, proteasome subunit alpha; Prov | 1e-60 | |
| cd03753 | 213 | cd03753, proteasome_alpha_type_5, proteasome_alpha | 3e-60 | |
| cd01906 | 182 | cd01906, proteasome_protease_HslV, proteasome_prot | 6e-58 | |
| cd03749 | 211 | cd03749, proteasome_alpha_type_1, proteasome_alpha | 3e-56 | |
| cd03751 | 212 | cd03751, proteasome_alpha_type_3, proteasome_alpha | 7e-51 | |
| cd03754 | 215 | cd03754, proteasome_alpha_type_6, proteasome_alpha | 7e-50 | |
| cd01901 | 164 | cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term | 2e-36 | |
| cd01912 | 189 | cd01912, proteasome_beta, proteasome beta subunit | 5e-21 | |
| cd03764 | 188 | cd03764, proteasome_beta_archeal, Archeal proteaso | 8e-18 | |
| TIGR03634 | 185 | TIGR03634, arc_protsome_B, proteasome endopeptidas | 1e-16 | |
| pfam10584 | 23 | pfam10584, Proteasome_A_N, Proteasome subunit A N- | 9e-12 | |
| smart00948 | 23 | smart00948, Proteasome_A_N, Proteasome subunit A N | 2e-11 | |
| cd03763 | 189 | cd03763, proteasome_beta_type_7, proteasome beta t | 2e-07 | |
| COG0064 | 483 | COG0064, GatB, Asp-tRNAAsn/Glu-tRNAGln amidotransf | 4e-05 | |
| cd03758 | 193 | cd03758, proteasome_beta_type_2, proteasome beta t | 1e-04 | |
| cd03757 | 212 | cd03757, proteasome_beta_type_1, proteasome beta t | 4e-04 | |
| PRK05477 | 474 | PRK05477, gatB, aspartyl/glutamyl-tRNA amidotransf | 7e-04 | |
| smart00845 | 147 | smart00845, GatB_Yqey, GatB domain | 8e-04 | |
| PTZ00488 | 247 | PTZ00488, PTZ00488, Proteasome subunit beta type-5 | 0.001 | |
| cd03761 | 188 | cd03761, proteasome_beta_type_5, proteasome beta t | 0.003 |
| >gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 | Back alignment and domain information |
|---|
Score = 402 bits (1036), Expect = e-145
Identities = 169/208 (81%), Positives = 184/208 (88%), Gaps = 2/208 (0%)
Query: 4 YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTVKLQDSRSVRKI 63
YDRAITVFSPDGHLFQVEYA EAVRKG AVGVRG D +VLGVEKKS KLQD R+VRKI
Sbjct: 1 YDRAITVFSPDGHLFQVEYAQEAVRKGTTAVGVRGKDCVVLGVEKKSVAKLQDPRTVRKI 60
Query: 64 VSLDNHIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSG 123
LD+H+ LA AGL ADARVLINRAR+ECQSHRLTVEDPVTVEYITRYIAGLQQ+YTQSG
Sbjct: 61 CMLDDHVCLAFAGLTADARVLINRARLECQSHRLTVEDPVTVEYITRYIAGLQQRYTQSG 120
Query: 124 GVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKET-S 182
GVRPFG+STLIVGFDP G P LYQTDPSGT+SAWKANA GRNS ++REFLEKNYKE +
Sbjct: 121 GVRPFGISTLIVGFDPD-GTPRLYQTDPSGTYSAWKANAIGRNSKTVREFLEKNYKEEMT 179
Query: 183 GQETIKLAIRALLEVVESGGKNIEVAVM 210
+TIKLAI+ALLEVV+SG KNIE+AVM
Sbjct: 180 RDDTIKLAIKALLEVVQSGSKNIELAVM 207
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 207 |
| >gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 | Back alignment and domain information |
|---|
| >gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit | Back alignment and domain information |
|---|
| >gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV | Back alignment and domain information |
|---|
| >gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|204518 pfam10584, Proteasome_A_N, Proteasome subunit A N-terminal signature | Back alignment and domain information |
|---|
| >gnl|CDD|198016 smart00948, Proteasome_A_N, Proteasome subunit A N-terminal signature Add an annotation | Back alignment and domain information |
|---|
| >gnl|CDD|239732 cd03763, proteasome_beta_type_7, proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223142 COG0064, GatB, Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239727 cd03758, proteasome_beta_type_2, proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235489 PRK05477, gatB, aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|197913 smart00845, GatB_Yqey, GatB domain | Back alignment and domain information |
|---|
| >gnl|CDD|185666 PTZ00488, PTZ00488, Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239730 cd03761, proteasome_beta_type_5, proteasome beta type-5 subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| KOG0183 | 249 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd03750 | 227 | proteasome_alpha_type_2 proteasome_alpha_type_2. T | 100.0 | |
| PTZ00246 | 253 | proteasome subunit alpha; Provisional | 100.0 | |
| KOG0176 | 241 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| PRK03996 | 241 | proteasome subunit alpha; Provisional | 100.0 | |
| cd03755 | 207 | proteasome_alpha_type_7 proteasome_alpha_type_7. T | 100.0 | |
| TIGR03633 | 224 | arc_protsome_A proteasome endopeptidase complex, a | 100.0 | |
| cd03751 | 212 | proteasome_alpha_type_3 proteasome_alpha_type_3. T | 100.0 | |
| cd03752 | 213 | proteasome_alpha_type_4 proteasome_alpha_type_4. T | 100.0 | |
| cd03754 | 215 | proteasome_alpha_type_6 proteasome_alpha_type_6. T | 100.0 | |
| KOG0181 | 233 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd03749 | 211 | proteasome_alpha_type_1 proteasome_alpha_type_1. T | 100.0 | |
| cd03756 | 211 | proteasome_alpha_archeal proteasome_alpha_archeal. | 100.0 | |
| COG0638 | 236 | PRE1 20S proteasome, alpha and beta subunits [Post | 100.0 | |
| cd01911 | 209 | proteasome_alpha proteasome alpha subunit. The 20S | 100.0 | |
| KOG0182 | 246 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd03753 | 213 | proteasome_alpha_type_5 proteasome_alpha_type_5. T | 100.0 | |
| KOG0184 | 254 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| KOG0178 | 249 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| KOG0863 | 264 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| TIGR03691 | 228 | 20S_bact_alpha proteasome, alpha subunit, bacteria | 100.0 | |
| TIGR03690 | 219 | 20S_bact_beta proteasome, beta subunit, bacterial | 100.0 | |
| PTZ00488 | 247 | Proteasome subunit beta type-5; Provisional | 100.0 | |
| cd03758 | 193 | proteasome_beta_type_2 proteasome beta type-2 subu | 100.0 | |
| cd03760 | 197 | proteasome_beta_type_4 proteasome beta type-4 subu | 100.0 | |
| cd03759 | 195 | proteasome_beta_type_3 proteasome beta type-3 subu | 100.0 | |
| cd03761 | 188 | proteasome_beta_type_5 proteasome beta type-5 subu | 100.0 | |
| TIGR03634 | 185 | arc_protsome_B proteasome endopeptidase complex, a | 100.0 | |
| cd03757 | 212 | proteasome_beta_type_1 proteasome beta type-1 subu | 100.0 | |
| cd03765 | 236 | proteasome_beta_bacterial Bacterial proteasome, be | 100.0 | |
| cd03764 | 188 | proteasome_beta_archeal Archeal proteasome, beta s | 100.0 | |
| cd03763 | 189 | proteasome_beta_type_7 proteasome beta type-7 subu | 100.0 | |
| cd03762 | 188 | proteasome_beta_type_6 proteasome beta type-6 subu | 100.0 | |
| PF00227 | 190 | Proteasome: Proteasome subunit; InterPro: IPR00135 | 100.0 | |
| cd01912 | 189 | proteasome_beta proteasome beta subunit. The 20S p | 100.0 | |
| cd01906 | 182 | proteasome_protease_HslV proteasome_protease_HslV. | 100.0 | |
| KOG0177 | 200 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0179 | 235 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0175 | 285 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0173 | 271 | consensus 20S proteasome, regulatory subunit beta | 99.97 | |
| KOG0174 | 224 | consensus 20S proteasome, regulatory subunit beta | 99.97 | |
| KOG0185 | 256 | consensus 20S proteasome, regulatory subunit beta | 99.97 | |
| PRK05456 | 172 | ATP-dependent protease subunit HslV; Provisional | 99.97 | |
| cd01901 | 164 | Ntn_hydrolase The Ntn hydrolases (N-terminal nucle | 99.97 | |
| KOG0180 | 204 | consensus 20S proteasome, regulatory subunit beta | 99.96 | |
| cd01913 | 171 | protease_HslV Protease HslV and the ATPase/chapero | 99.96 | |
| TIGR03692 | 171 | ATP_dep_HslV ATP-dependent protease HslVU, peptida | 99.95 | |
| PF10584 | 23 | Proteasome_A_N: Proteasome subunit A N-terminal si | 99.53 | |
| COG5405 | 178 | HslV ATP-dependent protease HslVU (ClpYQ), peptida | 99.44 | |
| COG3484 | 255 | Predicted proteasome-type protease [Posttranslatio | 99.4 | |
| PF09894 | 194 | DUF2121: Uncharacterized protein conserved in arch | 95.4 | |
| COG4079 | 293 | Uncharacterized protein conserved in archaea [Func | 81.02 | |
| KOG3361 | 157 | consensus Iron binding protein involved in Fe-S cl | 80.74 |
| >KOG0183 consensus 20S proteasome, regulatory subunit alpha type PSMA7/PRE6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-63 Score=399.95 Aligned_cols=245 Identities=74% Similarity=1.103 Sum_probs=233.4
Q ss_pred CCCCCCCCcccCCCCcchhhhhHHHHHccCCcEEEEEeCCEEEEEEeccCCcccccCCcccceEEecCCEEEEEecChhh
Q 025716 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTVKLQDSRSVRKIVSLDNHIALACAGLKAD 80 (249)
Q Consensus 1 ~~~yd~~~~~fsp~G~l~Qveya~kav~~G~t~igi~~~dgVvla~d~~~~~~l~~~~~~~Ki~~I~~~i~~~~sG~~~D 80 (249)
|++||+.+|+|||||+|||||||++|+.+|+|+||++++|+|||+.++++..+|++.+...||..+++|++|+++|+.+|
T Consensus 1 msrydraltvFSPDGhL~QVEYAqEAvrkGstaVgvrg~~~vvlgvEkkSv~~Lq~~r~~rkI~~ld~hV~mafaGl~aD 80 (249)
T KOG0183|consen 1 MSRYDRALTVFSPDGHLFQVEYAQEAVRKGSTAVGVRGNNCVVLGVEKKSVPKLQDERTVRKISMLDDHVVMAFAGLTAD 80 (249)
T ss_pred CCccccceEEECCCCCEEeeHhHHHHHhcCceEEEeccCceEEEEEeecchhhhhhhhhhhhheeecceeeEEecCCCcc
Confidence 78899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhhhcCCCCCHHHHHHHHHHHHHhhhccCCCccceeEEEEEeeeCCCCCceEEEECCCCceeccce
Q 025716 81 ARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKA 160 (249)
Q Consensus 81 ~~~l~~~~~~~~~~~~~~~~~~i~~~~la~~ls~~~~~~t~~~~~rP~gv~~ivaG~d~~~~gp~Ly~iDp~G~~~~~~~ 160 (249)
++.+++++|.+|+.|+++.+.+++++.++++++.+.|.|||.++.||||++++|+|+|+ ++.|.||++||+|.+.+|++
T Consensus 81 ArilinrArvecqShrlt~edpvtveyitRyiA~~kQrYTqs~grRPFGvs~Li~GfD~-~g~p~lyqtePsG~f~ewka 159 (249)
T KOG0183|consen 81 ARILINRARVECQSHRLTLEDPVTVEYITRYIAGLKQRYTQSNGRRPFGVSTLIGGFDP-DGTPRLYQTEPSGIFSEWKA 159 (249)
T ss_pred ceeehhhHhHhhhhhhcccCCCcHHHHHHHHHHHhhhhhhccCCcccccceEEEEeeCC-CCCeeeEeeCCCcchhhhhc
Confidence 99999999999999999999999999999999999999999999999999999999998 78899999999999999999
Q ss_pred EeecCCchHHHHHHHhhhccC--Cc-HHHHHHHHHHHHHHHhcCCCcEEEEEEEcCCCEEEcCHHHHHHHHHHHHHHHHH
Q 025716 161 NATGRNSNSMREFLEKNYKET--SG-QETIKLAIRALLEVVESGGKNIEVAVMTREKGLKQLDEAEIDAMVAEIEAKKAA 237 (249)
Q Consensus 161 ~aiG~g~~~a~~~Le~~~~~~--~s-eeai~la~~~l~~~~~~~~~~iei~~v~~~g~~~~~~~~ei~~~l~~i~~~~~~ 237 (249)
.|+|.++..++.+|||+|.+. .+ .+++++++++|.++.++++.++|++++++++.+++++.++|+.++..|+.+ .+
T Consensus 160 ~aiGr~sk~VrEflEK~y~e~~~~~~~~~ikL~ir~LleVvqs~~~nie~aVm~~~~~~~~l~~~~I~~~v~~ie~E-~e 238 (249)
T KOG0183|consen 160 NAIGRSSKTVREFLEKNYKEEAIATEGETIKLAIRALLEVVQSGGKNIEVAVMKRRKDLKMLESEEIDDIVKEIEQE-EE 238 (249)
T ss_pred cccccccHHHHHHHHHhcccccccccccHHHHHHHHHHHHhhcCCCeeEEEEEecCCceeecCHHHHHHHHHHHHHH-HH
Confidence 999999999999999999876 56 899999999999999999999999999998779999999999999999988 55
Q ss_pred HHHhhcCCCC
Q 025716 238 AEAAKKGPPK 247 (249)
Q Consensus 238 ~~~~~~~~~~ 247 (249)
+++.++..++
T Consensus 239 ~e~~~~~~~~ 248 (249)
T KOG0183|consen 239 AEAEKKKKKK 248 (249)
T ss_pred HHHHhhcccC
Confidence 5555555443
|
|
| >cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 | Back alignment and domain information |
|---|
| >PTZ00246 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0176 consensus 20S proteasome, regulatory subunit alpha type PSMA5/PUP2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03996 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >KOG0181 consensus 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >cd03756 proteasome_alpha_archeal proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01911 proteasome_alpha proteasome alpha subunit | Back alignment and domain information |
|---|
| >KOG0182 consensus 20S proteasome, regulatory subunit alpha type PSMA6/SCL1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >KOG0184 consensus 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0178 consensus 20S proteasome, regulatory subunit alpha type PSMA4/PRE9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type | Back alignment and domain information |
|---|
| >TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type | Back alignment and domain information |
|---|
| >PTZ00488 Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
| >cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit | Back alignment and domain information |
|---|
| >cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit | Back alignment and domain information |
|---|
| >cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit | Back alignment and domain information |
|---|
| >TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit | Back alignment and domain information |
|---|
| >PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins | Back alignment and domain information |
|---|
| >cd01912 proteasome_beta proteasome beta subunit | Back alignment and domain information |
|---|
| >cd01906 proteasome_protease_HslV proteasome_protease_HslV | Back alignment and domain information |
|---|
| >KOG0177 consensus 20S proteasome, regulatory subunit beta type PSMB2/PRE1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0179 consensus 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0175 consensus 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0173 consensus 20S proteasome, regulatory subunit beta type PSMB7/PSMB10/PUP1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0174 consensus 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0185 consensus 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05456 ATP-dependent protease subunit HslV; Provisional | Back alignment and domain information |
|---|
| >cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >KOG0180 consensus 20S proteasome, regulatory subunit beta type PSMB3/PUP3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome | Back alignment and domain information |
|---|
| >TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit | Back alignment and domain information |
|---|
| >PF10584 Proteasome_A_N: Proteasome subunit A N-terminal signature; InterPro: IPR000426 The proteasome (or macropain) (3 | Back alignment and domain information |
|---|
| >COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09894 DUF2121: Uncharacterized protein conserved in archaea (DUF2121); InterPro: IPR016754 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG4079 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >KOG3361 consensus Iron binding protein involved in Fe-S cluster formation [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 249 | ||||
| 1iru_D | 248 | Crystal Structure Of The Mammalian 20s Proteasome A | 2e-91 | ||
| 3une_C | 248 | Mouse Constitutive 20s Proteasome Length = 248 | 5e-91 | ||
| 3unb_C | 248 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-90 | ||
| 1g0u_C | 243 | A Gated Channel Into The Proteasome Core Particle L | 4e-80 | ||
| 1fnt_D | 254 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-80 | ||
| 1ryp_D | 241 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-79 | ||
| 1vsy_D | 227 | Proteasome Activator Complex Length = 227 | 1e-71 | ||
| 3h4p_A | 264 | Proteasome 20s Core Particle From Methanocaldococcu | 9e-49 | ||
| 1j2q_A | 237 | 20s Proteasome In Complex With Calpain-inhibitor I | 2e-48 | ||
| 1j2p_A | 246 | Alpha-Ring From The Proteasome From Archaeoglobus F | 9e-48 | ||
| 3unb_A | 234 | Mouse Constitutive 20s Proteasome In Complex With P | 3e-43 | ||
| 1iru_B | 233 | Crystal Structure Of The Mammalian 20s Proteasome A | 3e-43 | ||
| 2ku1_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 7e-43 | ||
| 3jrm_A | 227 | Crystal Structure Of Archaeal 20s Proteasome In Com | 8e-43 | ||
| 1pma_A | 233 | Proteasome From Thermoplasma Acidophilum Length = 2 | 8e-43 | ||
| 1yar_A | 233 | Structure Of Archeabacterial 20s Proteasome Mutant | 5e-42 | ||
| 1yau_A | 233 | Structure Of Archeabacterial 20s Proteasome- Pa26 C | 3e-41 | ||
| 2ku2_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 3e-41 | ||
| 1iru_C | 261 | Crystal Structure Of The Mammalian 20s Proteasome A | 8e-41 | ||
| 3unb_B | 261 | Mouse Constitutive 20s Proteasome In Complex With P | 1e-40 | ||
| 1z7q_C | 258 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-40 | ||
| 1ryp_C | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-40 | ||
| 1g0u_B | 245 | A Gated Channel Into The Proteasome Core Particle L | 2e-40 | ||
| 3oeu_B | 235 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 1e-38 | ||
| 3unb_D | 241 | Mouse Constitutive 20s Proteasome In Complex With P | 9e-38 | ||
| 1iru_E | 241 | Crystal Structure Of The Mammalian 20s Proteasome A | 5e-37 | ||
| 1vsy_C | 232 | Proteasome Activator Complex Length = 232 | 6e-37 | ||
| 1g0u_D | 241 | A Gated Channel Into The Proteasome Core Particle L | 9e-37 | ||
| 4g4s_E | 261 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 1e-36 | ||
| 1fnt_E | 260 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-36 | ||
| 2z5c_C | 262 | Crystal Structure Of A Novel Chaperone Complex For | 1e-36 | ||
| 1vsy_E | 250 | Proteasome Activator Complex Length = 250 | 2e-36 | ||
| 1ryp_B | 250 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-36 | ||
| 1ryp_E | 242 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-35 | ||
| 1iru_A | 246 | Crystal Structure Of The Mammalian 20s Proteasome A | 5e-34 | ||
| 3unb_G | 246 | Mouse Constitutive 20s Proteasome In Complex With P | 8e-34 | ||
| 1iru_F | 263 | Crystal Structure Of The Mammalian 20s Proteasome A | 5e-32 | ||
| 3unb_E | 263 | Mouse Constitutive 20s Proteasome In Complex With P | 5e-32 | ||
| 1vsy_B | 231 | Proteasome Activator Complex Length = 231 | 4e-31 | ||
| 1g0u_F | 248 | A Gated Channel Into The Proteasome Core Particle L | 6e-27 | ||
| 1z7q_G | 288 | Crystal Structure Of The 20s Proteasome From Yeast | 6e-27 | ||
| 1fnt_G | 287 | Crystal Structure Of The 20s Proteasome From Yeast | 6e-27 | ||
| 3oeu_F | 242 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 6e-27 | ||
| 1ryp_G | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 6e-27 | ||
| 3unb_F | 255 | Mouse Constitutive 20s Proteasome In Complex With P | 9e-27 | ||
| 1iru_G | 254 | Crystal Structure Of The Mammalian 20s Proteasome A | 2e-26 | ||
| 3sdi_E | 233 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 1e-25 | ||
| 1g0u_E | 234 | A Gated Channel Into The Proteasome Core Particle L | 1e-25 | ||
| 1ryp_A | 243 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-25 | ||
| 1g0u_G | 252 | A Gated Channel Into The Proteasome Core Particle L | 2e-25 | ||
| 1fnt_F | 234 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-25 | ||
| 4g4s_F | 235 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 3e-25 | ||
| 1ryp_F | 233 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-25 | ||
| 1ya7_H | 217 | Implications For Interactions Of Proteasome With Pa | 2e-10 | ||
| 1pma_B | 211 | Proteasome From Thermoplasma Acidophilum Length = 2 | 2e-10 | ||
| 3c91_H | 203 | Thermoplasma Acidophilum 20s Proteasome With An Ope | 8e-10 | ||
| 1j2q_H | 202 | 20s Proteasome In Complex With Calpain-inhibitor I | 2e-07 | ||
| 3nzj_K | 287 | Crystal Structure Of Yeast 20s Proteasome In Comple | 3e-05 | ||
| 1ryp_K | 198 | Crystal Structure Of The 20s Proteasome From Yeast | 6e-05 | ||
| 4b4t_5 | 287 | Near-Atomic Resolution Structural Model Of The Yeas | 7e-05 | ||
| 3unf_H | 234 | Mouse 20s Immunoproteasome In Complex With Pr-957 L | 1e-04 | ||
| 1g0u_K | 212 | A Gated Channel Into The Proteasome Core Particle L | 1e-04 | ||
| 1ryp_M | 222 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-04 | ||
| 1g0u_L | 241 | A Gated Channel Into The Proteasome Core Particle L | 2e-04 | ||
| 1ryp_L | 212 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-04 |
| >pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 | Back alignment and structure |
|
| >pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 | Back alignment and structure |
| >pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 | Back alignment and structure |
| >pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 | Back alignment and structure |
| >pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 | Back alignment and structure |
| >pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 | Back alignment and structure |
| >pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 | Back alignment and structure |
| >pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 | Back alignment and structure |
| >pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 | Back alignment and structure |
| >pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 | Back alignment and structure |
| >pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 | Back alignment and structure |
| >pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 | Back alignment and structure |
| >pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 | Back alignment and structure |
| >pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 | Back alignment and structure |
| >pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 | Back alignment and structure |
| >pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 | Back alignment and structure |
| >pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 | Back alignment and structure |
| >pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 | Back alignment and structure |
| >pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 | Back alignment and structure |
| >pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 | Back alignment and structure |
| >pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 | Back alignment and structure |
| >pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 | Back alignment and structure |
| >pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 | Back alignment and structure |
| >pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 | Back alignment and structure |
| >pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 | Back alignment and structure |
| >pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 | Back alignment and structure |
| >pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 | Back alignment and structure |
| >pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 | Back alignment and structure |
| >pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 | Back alignment and structure |
| >pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 | Back alignment and structure |
| >pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 | Back alignment and structure |
| >pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 | Back alignment and structure |
| >pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 | Back alignment and structure |
| >pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 | Back alignment and structure |
| >pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 | Back alignment and structure |
| >pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 | Back alignment and structure |
| >pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 | Back alignment and structure |
| >pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 | Back alignment and structure |
| >pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 | Back alignment and structure |
| >pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 | Back alignment and structure |
| >pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 | Back alignment and structure |
| >pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 | Back alignment and structure |
| >pdb|1RYP|A Chain A, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 243 | Back alignment and structure |
| >pdb|1G0U|G Chain G, A Gated Channel Into The Proteasome Core Particle Length = 252 | Back alignment and structure |
| >pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 | Back alignment and structure |
| >pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 | Back alignment and structure |
| >pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 | Back alignment and structure |
| >pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 | Back alignment and structure |
| >pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 | Back alignment and structure |
| >pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 | Back alignment and structure |
| >pdb|1J2Q|H Chain H, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 202 | Back alignment and structure |
| >pdb|3NZJ|K Chain K, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 287 | Back alignment and structure |
| >pdb|1RYP|K Chain K, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 198 | Back alignment and structure |
| >pdb|4B4T|5 Chain 5, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 287 | Back alignment and structure |
| >pdb|3UNF|H Chain H, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 234 | Back alignment and structure |
| >pdb|1G0U|K Chain K, A Gated Channel Into The Proteasome Core Particle Length = 212 | Back alignment and structure |
| >pdb|1RYP|M Chain M, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 222 | Back alignment and structure |
| >pdb|1G0U|L Chain L, A Gated Channel Into The Proteasome Core Particle Length = 241 | Back alignment and structure |
| >pdb|1RYP|L Chain L, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 212 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 249 | |||
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 1e-127 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 1e-121 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 1e-119 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 1e-115 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 1e-115 | |
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 1e-113 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 1e-113 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 1e-111 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 1e-111 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 1e-109 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 1e-109 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 1e-109 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 1e-108 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 1e-108 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 1e-107 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 1e-106 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 1e-106 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 1e-103 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 5e-56 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 9e-54 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 2e-42 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 4e-42 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 2e-41 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 2e-38 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 4e-35 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 6e-35 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 1e-34 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 2e-33 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 5e-31 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 6e-31 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 3e-28 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 7e-28 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 9e-28 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 6e-26 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 2e-24 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 2e-23 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 8e-22 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 1e-21 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 1e-21 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 2e-21 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 9e-21 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 2e-20 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 3e-20 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 3e-19 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 2e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 |
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 | Back alignment and structure |
|---|
Score = 360 bits (927), Expect = e-127
Identities = 168/243 (69%), Positives = 197/243 (81%), Gaps = 4/243 (1%)
Query: 4 YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTVKLQDSRSVRKI 63
YDRAITVFSPDGHLFQVEYA EAV+KG+ AVGVRG D +VLGVEKKS KLQD R+VRKI
Sbjct: 3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKI 62
Query: 64 VSLDNHIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSG 123
+LD+++ +A AGL ADAR++INRAR+ECQSHRLTVEDPVTVEYITRYIA L+Q+YTQS
Sbjct: 63 CALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSN 122
Query: 124 GVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKE--- 180
G RPFG+S LIVGFD G P LYQTDPSGT+ AWKANA GR + S+REFLEKNY +
Sbjct: 123 GRRPFGISALIVGFDF-DGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAI 181
Query: 181 TSGQETIKLAIRALLEVVESGGKNIEVAVMTREKGLKQLDEAEIDAMVAEIEAKKAAAEA 240
+ TIKL I+ALLEVV+SGGKNIE+AVM R++ LK L+ EI+ VAEIE +K E
Sbjct: 182 ETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEK 241
Query: 241 AKK 243
K+
Sbjct: 242 KKQ 244
|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 | Back alignment and structure |
|---|
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 100.0 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 100.0 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 100.0 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 100.0 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 100.0 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 100.0 | |
| 3h4p_a | 219 | Proteasome subunit beta; core particle, cytoplasm, | 100.0 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 100.0 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 100.0 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 100.0 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 100.0 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 100.0 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 100.0 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 100.0 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 100.0 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 2z3b_A | 180 | ATP-dependent protease HSLV; N-terminal nucleophIl | 100.0 | |
| 1g3k_A | 174 | ATP-dependent protease HSLV; hydrolase; 1.90A {Hae | 100.0 | |
| 1m4y_A | 171 | ATP-dependent protease HSLV; N-terminal catalytic | 100.0 |
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=5e-63 Score=424.62 Aligned_cols=230 Identities=32% Similarity=0.529 Sum_probs=222.0
Q ss_pred CCCCCCCcccCCCCcchhhhhHHHHHcc-CCcEEEEEeCCEEEEEEeccCCcccccCCcccceEEecCCEEEEEecChhh
Q 025716 2 ARYDRAITVFSPDGHLFQVEYALEAVRK-GNAAVGVRGTDTIVLGVEKKSTVKLQDSRSVRKIVSLDNHIALACAGLKAD 80 (249)
Q Consensus 2 ~~yd~~~~~fsp~G~l~Qveya~kav~~-G~t~igi~~~dgVvla~d~~~~~~l~~~~~~~Ki~~I~~~i~~~~sG~~~D 80 (249)
++||+.+|+|||||||+|||||+||+++ |+|+|||+++||||||+|+|.+.+++.+++.+||++|++|++|+++|+.+|
T Consensus 1 ~~yd~~~t~fsp~Grl~QvEYA~~av~~~Gtt~vgi~~~dgVvlaad~r~~~~l~~~~~~~Ki~~i~~~i~~~~aG~~aD 80 (243)
T 1ryp_A 1 AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPD 80 (243)
T ss_dssp CGGGGTSSSCCTTSCCHHHHHHHHHTTTTCCCEEEEECSSEEEEEEECCCCCTTBCGGGCCSEEECSSSCEEEEESCHHH
T ss_pred CCCCCCCceECCCCeeHHHHHHHHHHhcCCCcEEEEEeCCEEEEEEEecCCccccCCCcCCceEEECCCEEEEEEecHHH
Confidence 4799999999999999999999999999 999999999999999999999988888889999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhhhcCCCCCHHHHHHHHHHHHHhhhccCCCccceeEEEEEeeeCCCCCceEEEECCCCceeccce
Q 025716 81 ARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKA 160 (249)
Q Consensus 81 ~~~l~~~~~~~~~~~~~~~~~~i~~~~la~~ls~~~~~~t~~~~~rP~gv~~ivaG~d~~~~gp~Ly~iDp~G~~~~~~~ 160 (249)
++.|+++++.++..|+++++++++++.+++++++++|.|+++++.|||+|++||||||+ ++||+||.+||+|++.++++
T Consensus 81 ~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~l~~y~~~~~~rP~~v~~lvaG~D~-~~gp~Ly~~dp~G~~~~~~~ 159 (243)
T 1ryp_A 81 ARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDE-ELGPSIYKTDPAGYYVGYKA 159 (243)
T ss_dssp HHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHHHHBTTSCCCSCEEEEEEEET-TTEEEEEEECTTSCEEEBSE
T ss_pred HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHhccCCccccceEEEEEEEcC-CCCcEEEEEcCCCCEEEEEE
Confidence 99999999999999999999999999999999999999999988999999999999996 58999999999999999999
Q ss_pred EeecCCchHHHHHHHhhhcc-------CCc-HHHHHHHHHHHHHHHhc--CCCcEEEEEEEcCCCEEEcCHHHHHHHHHH
Q 025716 161 NATGRNSNSMREFLEKNYKE-------TSG-QETIKLAIRALLEVVES--GGKNIEVAVMTREKGLKQLDEAEIDAMVAE 230 (249)
Q Consensus 161 ~aiG~g~~~a~~~Le~~~~~-------~~s-eeai~la~~~l~~~~~~--~~~~iei~~v~~~g~~~~~~~~ei~~~l~~ 230 (249)
+++|+++..++++||+.|++ +|+ +||++++++||..+.++ ++++++|++|+++| +++++++||++++.+
T Consensus 160 ~a~G~gs~~a~~~Le~~~~~~~~~~~~~ms~eea~~l~~~al~~~~~rd~s~~~iev~vi~~~g-~~~l~~~ei~~~~~~ 238 (243)
T 1ryp_A 160 TATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDK-FFTLSAENIEERLVA 238 (243)
T ss_dssp EEESTTHHHHHHHHHHHHHHHCSSSCCCSSHHHHHHHHHHHHHHHHTCCCCTTSEEEEEEETTE-EEECCHHHHHHHHHH
T ss_pred EEECCCcHHHHHHHHHHhhhcccccccCCCHHHHHHHHHHHHHHHhcccCCCCcEEEEEEECCC-eEECCHHHHHHHHHH
Confidence 99999999999999999999 999 99999999999999875 47799999999998 999999999999999
Q ss_pred HHH
Q 025716 231 IEA 233 (249)
Q Consensus 231 i~~ 233 (249)
|++
T Consensus 239 ~~~ 241 (243)
T 1ryp_A 239 IAE 241 (243)
T ss_dssp HTT
T ss_pred hhc
Confidence 865
|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D | Back alignment and structure |
|---|
| >3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H | Back alignment and structure |
|---|
| >2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A | Back alignment and structure |
|---|
| >1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A | Back alignment and structure |
|---|
| >1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 249 | ||||
| d1irud_ | 243 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 2e-84 | |
| d1rypd_ | 241 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 8e-80 | |
| d1irua_ | 244 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 2e-79 | |
| d1iruf_ | 238 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 9e-77 | |
| d1irue_ | 234 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 4e-76 | |
| d1irug_ | 245 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 2e-75 | |
| d1iruc_ | 250 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 5e-75 | |
| d1rypf_ | 233 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 4e-74 | |
| d1rypa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 4e-73 | |
| d1rype_ | 242 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 7e-72 | |
| d1j2pa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 2e-71 | |
| d1rypb_ | 250 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 5e-71 | |
| d1rypg_ | 244 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 9e-71 | |
| d1rypc_ | 244 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 4e-69 | |
| d1yara1 | 221 | d.153.1.4 (A:13-233) Proteasome alpha subunit (non | 1e-68 | |
| d1irub_ | 233 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 1e-66 | |
| d1q5qa_ | 227 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 7e-46 | |
| d1ryp2_ | 233 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 5e-39 | |
| d1rypk_ | 198 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 1e-38 | |
| d1ryp1_ | 222 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 3e-36 | |
| d1rypl_ | 212 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 8e-36 | |
| d1yarh1 | 203 | d.153.1.4 (H:1-203) Proteasome beta subunit (catal | 2e-35 | |
| d1j2qh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 4e-32 | |
| d1irul_ | 201 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 1e-31 | |
| d1rypj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 2e-31 | |
| d1rypi_ | 222 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 7e-31 | |
| d1q5qh_ | 224 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 7e-31 | |
| d1iru2_ | 217 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 1e-29 | |
| d1iruh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 2e-29 | |
| d1irui_ | 220 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 8e-29 | |
| d1iruj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 1e-28 | |
| d1iruk_ | 199 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 1e-26 | |
| d1ryph_ | 205 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 7e-25 | |
| d1iru1_ | 213 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 9e-22 | |
| d2z3ba1 | 180 | d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus | 6e-04 |
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome alpha subunit (non-catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Score = 249 bits (638), Expect = 2e-84
Identities = 167/243 (68%), Positives = 196/243 (80%), Gaps = 4/243 (1%)
Query: 4 YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTVKLQDSRSVRKI 63
YDRAITVFSPDGHLFQVEYA EAV+KG+ AVGVRG D +VLGVEKKS KLQD R+VRKI
Sbjct: 2 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKI 61
Query: 64 VSLDNHIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSG 123
+LD+++ +A AGL ADAR++INRAR+ECQSHRLTVEDPVTVEYITRYIA L+Q+YTQS
Sbjct: 62 CALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSN 121
Query: 124 GVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKE--- 180
G RPFG+S LIVGFD P LYQTDPSGT+ AWKANA GR + S+REFLEKNY +
Sbjct: 122 GRRPFGISALIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAI 180
Query: 181 TSGQETIKLAIRALLEVVESGGKNIEVAVMTREKGLKQLDEAEIDAMVAEIEAKKAAAEA 240
+ TIKL I+ALLEVV+SGGKNIE+AVM R++ LK L+ EI+ VAEIE +K E
Sbjct: 181 ETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEK 240
Query: 241 AKK 243
K+
Sbjct: 241 KKQ 243
|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| d1irud_ | 243 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypd_ | 241 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1iruc_ | 250 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1j2pa_ | 243 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1irua_ | 244 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypa_ | 243 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1irug_ | 245 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1irue_ | 234 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypb_ | 250 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1iruf_ | 238 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypc_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypg_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rype_ | 242 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1irub_ | 233 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1yara1 | 221 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1rypf_ | 233 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1q5qa_ | 227 | Proteasome alpha subunit (non-catalytic) {Rhodococ | 100.0 | |
| d1yarh1 | 203 | Proteasome beta subunit (catalytic) {Archaeon Ther | 100.0 | |
| d1rypk_ | 198 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1irul_ | 201 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1rypl_ | 212 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1j2qh_ | 202 | Proteasome beta subunit (catalytic) {Archaeon Arch | 100.0 | |
| d1ryph_ | 205 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iruh_ | 202 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1ryp2_ | 233 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1irui_ | 220 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1q5qh_ | 224 | Proteasome beta subunit (catalytic) {Rhodococcus e | 100.0 | |
| d1rypi_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iru2_ | 217 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iruj_ | 204 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1rypj_ | 204 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1ryp1_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iruk_ | 199 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iru1_ | 213 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d2z3ba1 | 180 | HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 | 99.89 | |
| d1m4ya_ | 171 | HslV (ClpQ) protease {Thermotoga maritima [TaxId: | 99.87 | |
| d1g3ka_ | 173 | HslV (ClpQ) protease {Haemophilus influenzae [TaxI | 99.84 |
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome alpha subunit (non-catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=1.4e-64 Score=432.30 Aligned_cols=239 Identities=70% Similarity=1.071 Sum_probs=227.5
Q ss_pred CCCCCCcccCCCCcchhhhhHHHHHccCCcEEEEEeCCEEEEEEeccCCcccccCCcccceEEecCCEEEEEecChhhHH
Q 025716 3 RYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTVKLQDSRSVRKIVSLDNHIALACAGLKADAR 82 (249)
Q Consensus 3 ~yd~~~~~fsp~G~l~Qveya~kav~~G~t~igi~~~dgVvla~d~~~~~~l~~~~~~~Ki~~I~~~i~~~~sG~~~D~~ 82 (249)
+||+.+|+|||||||+|||||+||+++|+|+|||+++||||||+|++++.+++.+++.+||++|++|++|++||+.+|++
T Consensus 1 ~yd~~~t~Fsp~Grl~QvEya~kav~~G~Tvvgik~~dgVvla~d~r~~~~~~~~~~~~KI~~i~~~i~~~~sG~~~D~~ 80 (243)
T d1irud_ 1 SYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADAR 80 (243)
T ss_dssp CCCCCCSCCCTTSCCHHHHHHHHHHHTSCCEEEECCSSEEEEEECCCCCCSSSCGGGGCSEEESSSSCEEEEEECHHHHH
T ss_pred CCCCCCeeECCCCcchHHHHHHHHHhcCCCEEEEEeCCEEEEEEeccccCcccCCCccccEEECCCCEEEEEEEchhhHH
Confidence 59999999999999999999999999999999999999999999999887888888999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhhhcCCCCCHHHHHHHHHHHHHhhhccCCCccceeEEEEEeeeCCCCCceEEEECCCCceeccceEe
Q 025716 83 VLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANA 162 (249)
Q Consensus 83 ~l~~~~~~~~~~~~~~~~~~i~~~~la~~ls~~~~~~t~~~~~rP~gv~~ivaG~d~~~~gp~Ly~iDp~G~~~~~~~~a 162 (249)
.++++++.++..|++++|.+++++.+++++++++|.|+++++.|||+|++||+|||+ +++|+||.+||+|++.+++++|
T Consensus 81 ~l~~~~~~~~~~~~~~~~~~i~v~~la~~ls~~~~~~t~~~~~rp~~v~~li~G~D~-~~~p~Ly~idp~G~~~~~~~~a 159 (243)
T d1irud_ 81 IVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDF-DGTPRLYQTDPSGTYHAWKANA 159 (243)
T ss_dssp HHHHHHHHHHHHHHHHSSSCCCHHHHHHHHHHHHHHTTSBTTBCCCCEEEEEEEECS-SSCEEEEEECTTSCEEEBSEEE
T ss_pred HHHHHHHHHHHHHHHhcCCCccHHHHHHHHHHHHHHHHhcccCCccceEEEEEEEcC-CCCCEEEEecCcEEEEeccEEE
Confidence 999999999999999999999999999999999999999999999999999999997 6799999999999999999999
Q ss_pred ecCCchHHHHHHHhhhccCC--c-HHHHHHHHHHHHHHHhcCCCcEEEEEEEcCCCEEEcCHHHHHHHHHHHHHHHHHHH
Q 025716 163 TGRNSNSMREFLEKNYKETS--G-QETIKLAIRALLEVVESGGKNIEVAVMTREKGLKQLDEAEIDAMVAEIEAKKAAAE 239 (249)
Q Consensus 163 iG~g~~~a~~~Le~~~~~~~--s-eeai~la~~~l~~~~~~~~~~iei~~v~~~g~~~~~~~~ei~~~l~~i~~~~~~~~ 239 (249)
+|+|+..++++||++|+++| + ++++++++++|.+....+++++||+++++++.|++++++||++++.+|++++++++
T Consensus 160 ~G~gs~~a~~~Lek~~~~~~~~~~~~~i~~ai~~l~~~~~~~~~~vei~ii~k~~~~~~l~~~eI~~~l~~i~~~~~~~~ 239 (243)
T d1irud_ 160 IGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE 239 (243)
T ss_dssp ESTTHHHHHHHHTTTCCSSTTCSHHHHHHHHHHHHHTTSCTTSTTCCEEEEESSSCEECCCHHHHHHHTTTTTTTTTTTT
T ss_pred ECCChHHHHHHHHHhcccCCCccHHHHHHHHHHHHHHHhcCCCCcEEEEEEECCCCEEECCHHHHHHHHHHHHhhhhhhh
Confidence 99999999999999999998 4 78999999999998888888999999999866999999999999999998776665
Q ss_pred Hhh
Q 025716 240 AAK 242 (249)
Q Consensus 240 ~~~ 242 (249)
.++
T Consensus 240 ~~~ 242 (243)
T d1irud_ 240 KKK 242 (243)
T ss_dssp SSC
T ss_pred hcc
Confidence 543
|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|