Citrus Sinensis ID: 025729

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKETSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAAEAAKKAPPKET
cccccccccEEcccccHHHHHHHHHHHHccccEEEEEcccEEEEEEEcccccccccccccccEEEEcccEEEEEccccccHHHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHEEEEEccccccccEEEEcccccccccEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEccHHHHHHHHHHHHHHHHHHHHHcccccccc
ccHcccccccEcccccEHHHHHHHHHHcccccEEEEEccccEEEEEEcccccccEcHHHcccEEEEEccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEccccEEEEEEEEEcccEcEEEEEEcccccEEEEcEEEEcccHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccEEEEEEEcccEEEcccHHHHHHHHHHHHHHHHHHHHHHccccccc
marydraitvfspdghlFQVEYALEAVRKgnaavgvrGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIEcqshrltvedpvTVEYITRYIAGLQQKytqsggvrpfglstlivgfdpytgvpslyqtdpsgtfsawkanatgrnsNSIREFLEKNYKETSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAAEAakkappket
marydraitvfspdghlFQVEYALEAVRKGNAAVGVRGTDIVVLGVekksavklqdsrmvRKIVSLDNHIALACAGLKADARVLVNRARiecqshrltvedpvtVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKanatgrnsnsIREFLEKnyketsgqetVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAaeaakkappket
MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKETSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIeaekaaaeaakkappkeT
*****RAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKA************************ETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIV*********************
*ARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKETSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVS********************
MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKETSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEA****************
***YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKETSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAA***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKETSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQxxxxxxxxxxxxxxxxxxxxxAAKKAPPKET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q9SXU1249 Proteasome subunit alpha N/A no 0.915 0.915 0.942 1e-125
O24030259 Proteasome subunit alpha N/A no 0.915 0.880 0.942 1e-125
O24616250 Proteasome subunit alpha yes no 1.0 0.996 0.924 1e-124
P30186250 Proteasome subunit alpha yes no 0.915 0.912 0.917 1e-121
Q0J006249 Proteasome subunit alpha yes no 0.915 0.915 0.903 1e-119
A2Z3I9249 Proteasome subunit alpha N/A no 0.915 0.915 0.903 1e-119
Q6YT00249 Proteasome subunit alpha yes no 0.915 0.915 0.899 1e-119
A2YXU2249 Proteasome subunit alpha N/A no 0.915 0.915 0.899 1e-119
Q9CWH6250 Proteasome subunit alpha yes no 0.963 0.96 0.684 4e-95
P34120250 Proteasome subunit alpha yes no 0.987 0.984 0.647 3e-93
>sp|Q9SXU1|PSA7_CICAR Proteasome subunit alpha type-7 OS=Cicer arietinum GN=PAD1 PE=2 SV=1 Back     alignment and function desciption
 Score =  447 bits (1151), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/228 (94%), Positives = 223/228 (97%)

Query: 1   MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMV 60
           MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTD VVLGVEKKS  KLQD+R V
Sbjct: 1   MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDNVVLGVEKKSTAKLQDTRSV 60

Query: 61  RKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120
           RKIV+LD+HIALACAGLKADARVL+NRAR+ECQSHRLTVEDPVTVEYITRYIAGLQQKYT
Sbjct: 61  RKIVNLDDHIALACAGLKADARVLINRARVECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120

Query: 121 QSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE 180
           QSGGVRPFGLSTLIVGFDPYTG PSLYQTDPSGTFSAWKANATGRNSNSIREFLEKN+KE
Sbjct: 121 QSGGVRPFGLSTLIVGFDPYTGSPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNFKE 180

Query: 181 TSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIV 228
           TSGQETVKLAIRALLEVVESGGKNIEVAVMT+E+GLRQLEEAEIDAIV
Sbjct: 181 TSGQETVKLAIRALLEVVESGGKNIEVAVMTKENGLRQLEEAEIDAIV 228
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Cicer arietinum (taxid: 3827)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|O24030|PSA7_SOLLC Proteasome subunit alpha type-7 OS=Solanum lycopersicum GN=PAD1 PE=2 SV=1 Back     alignment and function description
>sp|O24616|PSA7B_ARATH Proteasome subunit alpha type-7-B OS=Arabidopsis thaliana GN=PAD2 PE=1 SV=2 Back     alignment and function description
>sp|P30186|PSA7A_ARATH Proteasome subunit alpha type-7-A OS=Arabidopsis thaliana GN=PAD1 PE=1 SV=1 Back     alignment and function description
>sp|Q0J006|PSA7B_ORYSJ Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. japonica GN=PAD1 PE=2 SV=1 Back     alignment and function description
>sp|A2Z3I9|PSA7B_ORYSI Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. indica GN=PAD1 PE=2 SV=1 Back     alignment and function description
>sp|Q6YT00|PSA7A_ORYSJ Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. japonica GN=Os08g0548900 PE=2 SV=1 Back     alignment and function description
>sp|A2YXU2|PSA7A_ORYSI Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. indica GN=OsI_029135 PE=2 SV=2 Back     alignment and function description
>sp|Q9CWH6|PSA7L_MOUSE Proteasome subunit alpha type-7-like OS=Mus musculus GN=Psma8 PE=2 SV=1 Back     alignment and function description
>sp|P34120|PSA7_DICDI Proteasome subunit alpha type-7 OS=Dictyostelium discoideum GN=psmA7 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
225428005249 PREDICTED: proteasome subunit alpha type 1.0 1.0 0.943 1e-127
225431090249 PREDICTED: proteasome subunit alpha type 1.0 1.0 0.943 1e-127
82621184249 proteasome-like protein alpha subunit-li 1.0 1.0 0.939 1e-126
356502736249 PREDICTED: proteasome subunit alpha type 0.915 0.915 0.951 1e-124
255579983249 proteasome subunit alpha type, putative 0.915 0.915 0.929 1e-124
449434142249 PREDICTED: proteasome subunit alpha type 0.915 0.915 0.942 1e-124
449456827251 PREDICTED: proteasome subunit alpha type 0.915 0.908 0.934 1e-124
77999287249 proteasome-like protein alpha subunit [S 0.915 0.915 0.942 1e-124
12229936249 RecName: Full=Proteasome subunit alpha t 0.915 0.915 0.942 1e-123
76160964249 proteasome, alpha subunit-like protein [ 0.915 0.915 0.942 1e-123
>gi|225428005|ref|XP_002278162.1| PREDICTED: proteasome subunit alpha type-7 [Vitis vinifera] gi|297744621|emb|CBI37883.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/249 (94%), Positives = 244/249 (97%)

Query: 1   MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMV 60
           MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTD +VLGVEKKS  KLQDSR V
Sbjct: 1   MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLGVEKKSTAKLQDSRTV 60

Query: 61  RKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120
           RKIV+LD+HIALACAGLKADARVL+NRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT
Sbjct: 61  RKIVNLDDHIALACAGLKADARVLINRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120

Query: 121 QSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE 180
           QSGGVRPFGLSTLI+GFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNS+REFLEKNYKE
Sbjct: 121 QSGGVRPFGLSTLIIGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSMREFLEKNYKE 180

Query: 181 TSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAAEA 240
           TSGQETVKLAIRALLEVVESGGKNIE+AVMT+EHGLRQLEEAEIDAIV+EIEAEKAAAEA
Sbjct: 181 TSGQETVKLAIRALLEVVESGGKNIEIAVMTKEHGLRQLEEAEIDAIVAEIEAEKAAAEA 240

Query: 241 AKKAPPKET 249
           AKK PPKET
Sbjct: 241 AKKGPPKET 249

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431090|ref|XP_002264052.1| PREDICTED: proteasome subunit alpha type-7 [Vitis vinifera] gi|297734987|emb|CBI17349.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|82621184|gb|ABB86280.1| proteasome-like protein alpha subunit-like [Solanum tuberosum] Back     alignment and taxonomy information
>gi|356502736|ref|XP_003520172.1| PREDICTED: proteasome subunit alpha type-7-like isoform 1 [Glycine max] gi|356502738|ref|XP_003520173.1| PREDICTED: proteasome subunit alpha type-7-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255579983|ref|XP_002530826.1| proteasome subunit alpha type, putative [Ricinus communis] gi|223529618|gb|EEF31566.1| proteasome subunit alpha type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449434142|ref|XP_004134855.1| PREDICTED: proteasome subunit alpha type-7-like [Cucumis sativus] gi|449491326|ref|XP_004158862.1| PREDICTED: proteasome subunit alpha type-7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449456827|ref|XP_004146150.1| PREDICTED: proteasome subunit alpha type-7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|77999287|gb|ABB16990.1| proteasome-like protein alpha subunit [Solanum tuberosum] Back     alignment and taxonomy information
>gi|12229936|sp|Q9SXU1.1|PSA7_CICAR RecName: Full=Proteasome subunit alpha type-7; AltName: Full=20S proteasome alpha subunit D; AltName: Full=20S proteasome subunit alpha-4 gi|4586592|dbj|BAA76428.1| multicatalytic endopeptidase complex [Cicer arietinum] Back     alignment and taxonomy information
>gi|76160964|gb|ABA40445.1| proteasome, alpha subunit-like protein [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2156962250 PAD2 "proteasome alpha subunit 0.927 0.924 0.922 1.1e-108
TAIR|locus:2080833250 PAD1 "20S proteasome alpha sub 0.927 0.924 0.913 8.1e-108
ZFIN|ZDB-GENE-040426-2194251 psma8 "proteasome (prosome, ma 0.919 0.912 0.703 7.2e-84
UNIPROTKB|Q9PTW9251 psma7 "Proteasome subunit alph 0.919 0.912 0.699 1.9e-83
UNIPROTKB|E2RF52250 PSMA8 "Proteasome subunit alph 0.919 0.916 0.699 5e-83
UNIPROTKB|F1SBA5250 PSMA8 "Proteasome subunit alph 0.919 0.916 0.695 2.2e-82
MGI|MGI:1920927250 Psma8 "proteasome (prosome, ma 0.919 0.916 0.690 2.2e-82
UNIPROTKB|O14818248 PSMA7 "Proteasome subunit alph 0.911 0.915 0.701 7.4e-82
UNIPROTKB|Q3ZBG0248 PSMA7 "Proteasome subunit alph 0.911 0.915 0.701 1.2e-81
MGI|MGI:1347070248 Psma7 "proteasome (prosome, ma 0.911 0.915 0.701 1.2e-81
TAIR|locus:2156962 PAD2 "proteasome alpha subunit D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1074 (383.1 bits), Expect = 1.1e-108, P = 1.1e-108
 Identities = 214/232 (92%), Positives = 223/232 (96%)

Query:     1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMV 60
             MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTD VVL VEKKS  KLQDSR  
Sbjct:     1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSA 60

Query:    61 RKIVSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYT 120
             RKIVSLDNHIALACAGLKADARVL+N+ARIECQSHRLT+EDPVTVEYITRYIAGLQQKYT
Sbjct:    61 RKIVSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYT 120

Query:   121 QSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE 180
             QSGGVRPFGLSTLIVGFDPY+ +PSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE
Sbjct:   121 QSGGVRPFGLSTLIVGFDPYSRLPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE 180

Query:   181 TSGQETVKLAIRALLEVVESGGKNIEVAVMTREH-GLRQLEEAEIDAIVSEI 231
             +SGQET+KLAIRALLEVVESGGKNIEVAVMTRE  GLRQLEEAEIDAIV++I
Sbjct:   181 SSGQETIKLAIRALLEVVESGGKNIEVAVMTREETGLRQLEEAEIDAIVAKI 232
GO:0004175 "endopeptidase activity" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005839 "proteasome core complex" evidence=IEA;TAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA;TAS
GO:0008233 "peptidase activity" evidence=ISS
GO:0019773 "proteasome core complex, alpha-subunit complex" evidence=IEA;ISS
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0000502 "proteasome complex" evidence=IDA
TAIR|locus:2080833 PAD1 "20S proteasome alpha subunit PAD1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2194 psma8 "proteasome (prosome, macropain) subunit, alpha type, 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PTW9 psma7 "Proteasome subunit alpha type-7" [Carassius auratus (taxid:7957)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF52 PSMA8 "Proteasome subunit alpha type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBA5 PSMA8 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1920927 Psma8 "proteasome (prosome, macropain) subunit, alpha type, 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O14818 PSMA7 "Proteasome subunit alpha type-7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBG0 PSMA7 "Proteasome subunit alpha type-7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1347070 Psma7 "proteasome (prosome, macropain) subunit, alpha type 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C3NHC6PSA_SULIN3, ., 4, ., 2, 5, ., 10.42660.84730.8755yesno
Q9UXC6PSA_SULSO3, ., 4, ., 2, 5, ., 10.42660.84730.8755yesno
O59219PSA_PYRHO3, ., 4, ., 2, 5, ., 10.49330.88750.85yesno
Q9SXU1PSA7_CICAR3, ., 4, ., 2, 5, ., 10.94290.91560.9156N/Ano
P30186PSA7A_ARATH3, ., 4, ., 2, 5, ., 10.91700.91560.912yesno
P34120PSA7_DICDI3, ., 4, ., 2, 5, ., 10.64770.98790.984yesno
O13268PSA7_CHICK3, ., 4, ., 2, 5, ., 10.69050.87950.8795yesno
Q4R7D9PSA7L_MACFA3, ., 4, ., 2, 5, ., 10.68830.91160.908N/Ano
P40303PSA4_YEAST3, ., 4, ., 2, 5, ., 10.58050.92770.9094yesno
C4KHD9PSA_SULIK3, ., 4, ., 2, 5, ., 10.42660.84730.8755yesno
Q95005PSA7_CAEEL3, ., 4, ., 2, 5, ., 10.58110.91160.8972yesno
Q0J006PSA7B_ORYSJ3, ., 4, ., 2, 5, ., 10.90350.91560.9156yesno
Q8TAA3PSA7L_HUMAN3, ., 4, ., 2, 5, ., 10.66660.91160.8867yesno
C3N5R0PSA_SULIA3, ., 4, ., 2, 5, ., 10.42660.84730.8755yesno
A2Z3I9PSA7B_ORYSI3, ., 4, ., 2, 5, ., 10.90350.91560.9156N/Ano
Q9V122PSA_PYRAB3, ., 4, ., 2, 5, ., 10.48690.89950.8615yesno
O24616PSA7B_ARATH3, ., 4, ., 2, 5, ., 10.9241.00.996yesno
C3NEC6PSA_SULIY3, ., 4, ., 2, 5, ., 10.42660.84730.8755yesno
O16811PSA71_DROVI3, ., 4, ., 2, 5, ., 10.63510.86740.8744N/Ano
Q9PVY6PSA7A_XENLA3, ., 4, ., 2, 5, ., 10.68990.90360.9072N/Ano
Q9PTW9PSA7_CARAU3, ., 4, ., 2, 5, ., 10.69690.91160.9043N/Ano
Q8ZVM1PSA_PYRAE3, ., 4, ., 2, 5, ., 10.45810.89150.9135yesno
Q10329PSA4_SCHPO3, ., 4, ., 2, 5, ., 10.54690.97990.9420yesno
Q5JIU9PSA_PYRKO3, ., 4, ., 2, 5, ., 10.46350.91160.8730yesno
O24030PSA7_SOLLC3, ., 4, ., 2, 5, ., 10.94290.91560.8803N/Ano
Q8TYB7PSA_METKA3, ., 4, ., 2, 5, ., 10.46320.90360.9146yesno
O29760PSA_ARCFU3, ., 4, ., 2, 5, ., 10.48790.80720.8170yesno
C3MQ43PSA_SULIL3, ., 4, ., 2, 5, ., 10.42660.84730.8755yesno
B6YSH9PSA_THEON3, ., 4, ., 2, 5, ., 10.45570.88350.8461yesno
C3MVG1PSA_SULIM3, ., 4, ., 2, 5, ., 10.42660.84730.8755yesno
Q9PVQ1PSA7B_XENLA3, ., 4, ., 2, 5, ., 10.68990.90360.9109N/Ano
P22769PSA71_DROME3, ., 4, ., 2, 5, ., 10.63510.87550.8755yesno
Q6YT00PSA7A_ORYSJ3, ., 4, ., 2, 5, ., 10.89910.91560.9156yesno
A2YXU2PSA7A_ORYSI3, ., 4, ., 2, 5, ., 10.89910.91560.9156N/Ano
Q9NDA2PSA7_TRYBB3, ., 4, ., 2, 5, ., 10.60470.83530.8421N/Ano
Q9CWH6PSA7L_MOUSE3, ., 4, ., 2, 5, ., 10.68440.96380.96yesno
A4YCU9PSA_METS53, ., 4, ., 2, 5, ., 10.42980.85940.8916yesno
C6A459PSA_THESM3, ., 4, ., 2, 5, ., 10.45680.90760.8692yesno
Q8U0L6PSA_PYRFU3, ., 4, ., 2, 5, ., 10.47610.90360.8653yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.10.993
3rd Layer3.4.250.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
cd03755207 cd03755, proteasome_alpha_type_7, proteasome_alpha 1e-142
cd01911209 cd01911, proteasome_alpha, proteasome alpha subuni 1e-110
PRK03996241 PRK03996, PRK03996, proteasome subunit alpha; Prov 8e-93
TIGR03633224 TIGR03633, arc_protsome_A, proteasome endopeptidas 4e-83
cd03756211 cd03756, proteasome_alpha_archeal, proteasome_alph 1e-78
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 3e-75
cd03750227 cd03750, proteasome_alpha_type_2, proteasome_alpha 5e-70
cd03752213 cd03752, proteasome_alpha_type_4, proteasome_alpha 4e-63
pfam00227188 pfam00227, Proteasome, Proteasome subunit 5e-61
PTZ00246253 PTZ00246, PTZ00246, proteasome subunit alpha; Prov 8e-60
cd03753213 cd03753, proteasome_alpha_type_5, proteasome_alpha 2e-57
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 8e-57
cd03749211 cd03749, proteasome_alpha_type_1, proteasome_alpha 2e-56
cd03751212 cd03751, proteasome_alpha_type_3, proteasome_alpha 6e-50
cd03754215 cd03754, proteasome_alpha_type_6, proteasome_alpha 1e-49
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 2e-35
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 2e-21
cd03764188 cd03764, proteasome_beta_archeal, Archeal proteaso 1e-18
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 1e-16
pfam1058423 pfam10584, Proteasome_A_N, Proteasome subunit A N- 1e-11
smart0094823 smart00948, Proteasome_A_N, Proteasome subunit A N 3e-11
cd03758193 cd03758, proteasome_beta_type_2, proteasome beta t 1e-06
cd03763189 cd03763, proteasome_beta_type_7, proteasome beta t 2e-05
cd03757212 cd03757, proteasome_beta_type_1, proteasome beta t 6e-05
cd03762188 cd03762, proteasome_beta_type_6, proteasome beta t 0.001
>gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 Back     alignment and domain information 
 Score =  396 bits (1019), Expect = e-142
 Identities = 168/208 (80%), Positives = 183/208 (87%), Gaps = 2/208 (0%)

Query: 4   YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKI 63
           YDRAITVFSPDGHLFQVEYA EAVRKG  AVGVRG D VVLGVEKKS  KLQD R VRKI
Sbjct: 1   YDRAITVFSPDGHLFQVEYAQEAVRKGTTAVGVRGKDCVVLGVEKKSVAKLQDPRTVRKI 60

Query: 64  VSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSG 123
             LD+H+ LA AGL ADARVL+NRAR+ECQSHRLTVEDPVTVEYITRYIAGLQQ+YTQSG
Sbjct: 61  CMLDDHVCLAFAGLTADARVLINRARLECQSHRLTVEDPVTVEYITRYIAGLQQRYTQSG 120

Query: 124 GVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKET-S 182
           GVRPFG+STLIVGFDP  G P LYQTDPSGT+SAWKANA GRNS ++REFLEKNYKE  +
Sbjct: 121 GVRPFGISTLIVGFDPD-GTPRLYQTDPSGTYSAWKANAIGRNSKTVREFLEKNYKEEMT 179

Query: 183 GQETVKLAIRALLEVVESGGKNIEVAVM 210
             +T+KLAI+ALLEVV+SG KNIE+AVM
Sbjct: 180 RDDTIKLAIKALLEVVQSGSKNIELAVM 207

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 207
>gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit Back     alignment and domain information
>gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 Back     alignment and domain information
>gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 Back     alignment and domain information
>gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 Back     alignment and domain information
>gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|204518 pfam10584, Proteasome_A_N, Proteasome subunit A N-terminal signature Back     alignment and domain information
>gnl|CDD|198016 smart00948, Proteasome_A_N, Proteasome subunit A N-terminal signature Add an annotation Back     alignment and domain information
>gnl|CDD|239727 cd03758, proteasome_beta_type_2, proteasome beta type-2 subunit Back     alignment and domain information
>gnl|CDD|239732 cd03763, proteasome_beta_type_7, proteasome beta type-7 subunit Back     alignment and domain information
>gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit Back     alignment and domain information
>gnl|CDD|239731 cd03762, proteasome_beta_type_6, proteasome beta type-6 subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 100.0
KOG0183249 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0176241 consensus 20S proteasome, regulatory subunit alpha 100.0
PTZ00246253 proteasome subunit alpha; Provisional 100.0
PRK03996241 proteasome subunit alpha; Provisional 100.0
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 100.0
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 100.0
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 100.0
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 100.0
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 100.0
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 100.0
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 100.0
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 100.0
KOG0178249 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0181233 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0182246 consensus 20S proteasome, regulatory subunit alpha 100.0
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 100.0
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 100.0
KOG0184254 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0863264 consensus 20S proteasome, regulatory subunit alpha 100.0
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 100.0
TIGR03690219 20S_bact_beta proteasome, beta subunit, bacterial 100.0
PTZ00488247 Proteasome subunit beta type-5; Provisional 100.0
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 100.0
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 100.0
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 100.0
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 100.0
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 100.0
cd03765236 proteasome_beta_bacterial Bacterial proteasome, be 100.0
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 100.0
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 100.0
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 100.0
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 100.0
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 100.0
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 100.0
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 100.0
KOG0177200 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0175285 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0173271 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0179235 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0174224 consensus 20S proteasome, regulatory subunit beta 99.98
KOG0185256 consensus 20S proteasome, regulatory subunit beta 99.97
PRK05456172 ATP-dependent protease subunit HslV; Provisional 99.97
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.97
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 99.96
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.96
KOG0180204 consensus 20S proteasome, regulatory subunit beta 99.96
PF1058423 Proteasome_A_N: Proteasome subunit A N-terminal si 99.55
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 99.49
COG3484255 Predicted proteasome-type protease [Posttranslatio 99.28
PF09894194 DUF2121: Uncharacterized protein conserved in arch 94.25
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information 
Probab=100.00  E-value=3.1e-61  Score=410.18  Aligned_cols=223  Identities=43%  Similarity=0.696  Sum_probs=214.8

Q ss_pred             CCCCCcccCCCCcchhhhhHHHHHhcCCcEEEEEeCCEEEEEEeccCcccccccCcccceEEecCcEEEEEeccHHHHHH
Q 025729            4 YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADARV   83 (249)
Q Consensus         4 yd~~~~~fspeG~l~Qveya~~a~~~G~t~igi~~~dgVvla~d~~~~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~   83 (249)
                      ||+.+|+|||||||+|||||++|+++|+|+|||+++||||||+|++.+++++.+++.+||++|++|++|+++|..+|++.
T Consensus         1 yd~~~t~fsp~Grl~QveyA~~av~~G~t~igik~~dgVvlaad~~~~~~l~~~~~~~KI~~I~~~i~~~~sG~~~D~~~   80 (227)
T cd03750           1 YSFSLTTFSPSGKLVQIEYALAAVSSGAPSVGIKAANGVVLATEKKVPSPLIDESSVHKVEQITPHIGMVYSGMGPDFRV   80 (227)
T ss_pred             CCCCCceECCCCeEhHHHHHHHHHHcCCCEEEEEeCCEEEEEEeecCCccccCCCCcceEEEEcCCEEEEEeEcHHhHHH
Confidence            89999999999999999999999999999999999999999999999888888889999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhhcCCCcCHHHHHHHHHHHHHHhhccCCCCcceeeeEEEEeeCCCCcceEEEECCCCceecceeeee
Q 025729           84 LVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANAT  163 (249)
Q Consensus        84 l~~~~~~~~~~~~~~~~~~i~~~~la~~l~~~~~~~~~~~~~rP~~v~~iiaG~d~~~~gp~Ly~idp~G~~~~~~~~ai  163 (249)
                      +++++|.++..|++++|++++++.++++|++.+|.|+++++.|||+|++||+|||+  .||+||.+||+|++.+++++|+
T Consensus        81 l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~~~rP~~v~~li~G~D~--~g~~Ly~~d~~G~~~~~~~~a~  158 (227)
T cd03750          81 LVKKARKIAQQYYLVYGEPIPVSQLVREIASVMQEYTQSGGVRPFGVSLLIAGWDE--GGPYLYQVDPSGSYFTWKATAI  158 (227)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCCCCCChheEEEEEEEeC--CCCEEEEECCCCCEEeeeEEEE
Confidence            99999999999999999999999999999999999999999999999999999994  5899999999999999999999


Q ss_pred             cCCchHHHHHHHhhhccCCc-HHHHHHHHHHHHHHHhc--CCCcEEEEEEEcCCCEEEccHHHHHHHH
Q 025729          164 GRNSNSIREFLEKNYKETSG-QETVKLAIRALLEVVES--GGKNIEVAVMTREHGLRQLEEAEIDAIV  228 (249)
Q Consensus       164 G~g~~~~~~~Le~~~~~~~s-~eai~la~~al~~~~~~--~~~~iev~ii~~~g~~~~l~~~ei~~~~  228 (249)
                      |+|+.+++++||++|+++|+ +||++++++||..+.++  ++++++|++++++++++.++++||++++
T Consensus       159 G~g~~~~~~~Le~~~~~~ms~eeai~l~~~~l~~~~~~~l~~~~iev~iv~~~~~~~~~~~~ei~~~~  226 (227)
T cd03750         159 GKNYSNAKTFLEKRYNEDLELEDAIHTAILTLKEGFEGQMTEKNIEIGICGETKGFRLLTPAEIKDYL  226 (227)
T ss_pred             CCCCHHHHHHHHhhccCCCCHHHHHHHHHHHHHHHhcccCCCCcEEEEEEECCCCEEECCHHHHHHHh
Confidence            99999999999999999999 99999999999988864  6789999999997559999999999876

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
>KOG0183 consensus 20S proteasome, regulatory subunit alpha type PSMA7/PRE6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0176 consensus 20S proteasome, regulatory subunit alpha type PSMA5/PUP2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0178 consensus 20S proteasome, regulatory subunit alpha type PSMA4/PRE9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0181 consensus 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0182 consensus 20S proteasome, regulatory subunit alpha type PSMA6/SCL1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>KOG0184 consensus 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>KOG0177 consensus 20S proteasome, regulatory subunit beta type PSMB2/PRE1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0175 consensus 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0173 consensus 20S proteasome, regulatory subunit beta type PSMB7/PSMB10/PUP1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0179 consensus 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0174 consensus 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0185 consensus 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>KOG0180 consensus 20S proteasome, regulatory subunit beta type PSMB3/PUP3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10584 Proteasome_A_N: Proteasome subunit A N-terminal signature; InterPro: IPR000426 The proteasome (or macropain) (3 Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09894 DUF2121: Uncharacterized protein conserved in archaea (DUF2121); InterPro: IPR016754 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1iru_D248 Crystal Structure Of The Mammalian 20s Proteasome A 5e-91
3une_C248 Mouse Constitutive 20s Proteasome Length = 248 7e-91
3unb_C248 Mouse Constitutive 20s Proteasome In Complex With P 3e-90
1g0u_C243 A Gated Channel Into The Proteasome Core Particle L 5e-81
1fnt_D254 Crystal Structure Of The 20s Proteasome From Yeast 7e-81
1ryp_D241 Crystal Structure Of The 20s Proteasome From Yeast 2e-80
1vsy_D227 Proteasome Activator Complex Length = 227 2e-72
1j2q_A237 20s Proteasome In Complex With Calpain-inhibitor I 4e-48
1j2p_A246 Alpha-Ring From The Proteasome From Archaeoglobus F 2e-47
3h4p_A264 Proteasome 20s Core Particle From Methanocaldococcu 3e-47
1iru_B233 Crystal Structure Of The Mammalian 20s Proteasome A 7e-43
3unb_A234 Mouse Constitutive 20s Proteasome In Complex With P 1e-42
2ku1_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 1e-42
1pma_A233 Proteasome From Thermoplasma Acidophilum Length = 2 1e-42
3jrm_A227 Crystal Structure Of Archaeal 20s Proteasome In Com 1e-42
1yar_A233 Structure Of Archeabacterial 20s Proteasome Mutant 7e-42
1iru_C261 Crystal Structure Of The Mammalian 20s Proteasome A 1e-41
3unb_B261 Mouse Constitutive 20s Proteasome In Complex With P 4e-41
2ku2_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 5e-41
1yau_A233 Structure Of Archeabacterial 20s Proteasome- Pa26 C 5e-41
1g0u_B245 A Gated Channel Into The Proteasome Core Particle L 6e-39
1z7q_C258 Crystal Structure Of The 20s Proteasome From Yeast 7e-39
1ryp_C244 Crystal Structure Of The 20s Proteasome From Yeast 7e-39
3oeu_B235 Structure Of Yeast 20s Open-Gate Proteasome With Co 4e-37
3unb_D241 Mouse Constitutive 20s Proteasome In Complex With P 9e-37
1iru_E241 Crystal Structure Of The Mammalian 20s Proteasome A 5e-36
1ryp_B250 Crystal Structure Of The 20s Proteasome From Yeast 6e-36
1vsy_C232 Proteasome Activator Complex Length = 232 2e-35
1iru_A246 Crystal Structure Of The Mammalian 20s Proteasome A 8e-35
1g0u_D241 A Gated Channel Into The Proteasome Core Particle L 9e-35
2z5c_C262 Crystal Structure Of A Novel Chaperone Complex For 1e-34
4g4s_E261 Structure Of Proteasome-Pba1-Pba2 Complex Length = 1e-34
1fnt_E260 Crystal Structure Of The 20s Proteasome From Yeast 1e-34
3unb_G246 Mouse Constitutive 20s Proteasome In Complex With P 1e-34
1vsy_E250 Proteasome Activator Complex Length = 250 2e-34
1ryp_E242 Crystal Structure Of The 20s Proteasome From Yeast 1e-33
1iru_F263 Crystal Structure Of The Mammalian 20s Proteasome A 7e-32
3unb_E263 Mouse Constitutive 20s Proteasome In Complex With P 7e-32
1vsy_B231 Proteasome Activator Complex Length = 231 6e-31
1g0u_F248 A Gated Channel Into The Proteasome Core Particle L 2e-26
1z7q_G288 Crystal Structure Of The 20s Proteasome From Yeast 2e-26
1fnt_G287 Crystal Structure Of The 20s Proteasome From Yeast 2e-26
3oeu_F242 Structure Of Yeast 20s Open-Gate Proteasome With Co 2e-26
1ryp_G244 Crystal Structure Of The 20s Proteasome From Yeast 3e-26
3sdi_E233 Structure Of Yeast 20s Open-Gate Proteasome With Co 3e-26
1g0u_E234 A Gated Channel Into The Proteasome Core Particle L 3e-26
3unb_F255 Mouse Constitutive 20s Proteasome In Complex With P 5e-26
1fnt_F234 Crystal Structure Of The 20s Proteasome From Yeast 6e-26
4g4s_F235 Structure Of Proteasome-Pba1-Pba2 Complex Length = 6e-26
1ryp_F233 Crystal Structure Of The 20s Proteasome From Yeast 7e-26
1iru_G254 Crystal Structure Of The Mammalian 20s Proteasome A 8e-26
1ryp_A243 Crystal Structure Of The 20s Proteasome From Yeast 2e-25
1g0u_G252 A Gated Channel Into The Proteasome Core Particle L 3e-25
1ya7_H217 Implications For Interactions Of Proteasome With Pa 2e-10
1pma_B211 Proteasome From Thermoplasma Acidophilum Length = 2 2e-10
3c91_H203 Thermoplasma Acidophilum 20s Proteasome With An Ope 1e-09
1j2q_H202 20s Proteasome In Complex With Calpain-inhibitor I 5e-07
1g0u_L241 A Gated Channel Into The Proteasome Core Particle L 4e-05
1ryp_M222 Crystal Structure Of The 20s Proteasome From Yeast 4e-05
1ryp_K198 Crystal Structure Of The 20s Proteasome From Yeast 3e-04
3nzj_K287 Crystal Structure Of Yeast 20s Proteasome In Comple 5e-04
1g0u_K212 A Gated Channel Into The Proteasome Core Particle L 5e-04
>pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 Back     alignment and structure 
Iteration: 1

 Score =  330 bits (846), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 160/229 (69%), Positives = 189/229 (82%), Gaps = 4/229 (1%)
Query: 4   YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKI 63
           YDRAITVFSPDGHLFQVEYA EAV+KG+ AVGVRG DIVVLGVEKKS  KLQD R VRKI
Sbjct: 3   YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKI 62
Query: 64  VSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSG 123
            +LD+++ +A AGL ADAR+++NRAR+ECQSHRLTVEDPVTVEYITRYIA L+Q+YTQS 
Sbjct: 63  CALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSN 122
Query: 124 GVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKETSG 183
           G RPFG+S LIVGFD + G P LYQTDPSGT+ AWKANA GR + S+REFLEKNY + + 
Sbjct: 123 GRRPFGISALIVGFD-FDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAI 181
Query: 184 QE---TVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVS 229
           +    T+KL I+ALLEVV+SGGKNIE+AVM R+  L+ L   EI+  V+
Sbjct: 182 ETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVA 230
>pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 Back     alignment and structure
>pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 Back     alignment and structure
>pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 Back     alignment and structure
>pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 Back     alignment and structure
>pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 Back     alignment and structure
>pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 Back     alignment and structure
>pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 Back     alignment and structure
>pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 Back     alignment and structure
>pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 Back     alignment and structure
>pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 Back     alignment and structure
>pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 Back     alignment and structure
>pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 Back     alignment and structure
>pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 Back     alignment and structure
>pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 Back     alignment and structure
>pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 Back     alignment and structure
>pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 Back     alignment and structure
>pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 Back     alignment and structure
>pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 Back     alignment and structure
>pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 Back     alignment and structure
>pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 Back     alignment and structure
>pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 Back     alignment and structure
>pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 Back     alignment and structure
>pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 Back     alignment and structure
>pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 Back     alignment and structure
>pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 Back     alignment and structure
>pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 Back     alignment and structure
>pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 Back     alignment and structure
>pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 Back     alignment and structure
>pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 Back     alignment and structure
>pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 Back     alignment and structure
>pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 Back     alignment and structure
>pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 Back     alignment and structure
>pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 Back     alignment and structure
>pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 Back     alignment and structure
>pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 Back     alignment and structure
>pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 Back     alignment and structure
>pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 Back     alignment and structure
>pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 Back     alignment and structure
>pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 Back     alignment and structure
>pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 Back     alignment and structure
>pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 Back     alignment and structure
>pdb|1RYP|A Chain A, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 243 Back     alignment and structure
>pdb|1G0U|G Chain G, A Gated Channel Into The Proteasome Core Particle Length = 252 Back     alignment and structure
>pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 Back     alignment and structure
>pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 Back     alignment and structure
>pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 Back     alignment and structure
>pdb|1J2Q|H Chain H, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 202 Back     alignment and structure
>pdb|1G0U|L Chain L, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>pdb|1RYP|M Chain M, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 222 Back     alignment and structure
>pdb|1RYP|K Chain K, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 198 Back     alignment and structure
>pdb|3NZJ|K Chain K, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 287 Back     alignment and structure
>pdb|1G0U|K Chain K, A Gated Channel Into The Proteasome Core Particle Length = 212 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1iru_D248 20S proteasome; cell cycle, immune response, prote 1e-127
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 1e-121
1iru_F263 20S proteasome; cell cycle, immune response, prote 1e-119
1iru_A246 20S proteasome; cell cycle, immune response, prote 1e-114
1iru_E241 20S proteasome; cell cycle, immune response, prote 1e-114
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 1e-112
1iru_B233 20S proteasome; cell cycle, immune response, prote 1e-112
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 1e-111
1iru_C261 20S proteasome; cell cycle, immune response, prote 1e-110
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 1e-109
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 1e-108
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 1e-108
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 1e-108
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 1e-107
1iru_G254 20S proteasome; cell cycle, immune response, prote 1e-105
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 1e-105
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 1e-105
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 1e-103
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 5e-55
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 8e-54
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 1e-41
3unf_H234 Proteasome subunit beta type-10; antigen presentat 2e-41
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 3e-41
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 6e-38
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 9e-35
1iru_I234 20S proteasome; cell cycle, immune response, prote 2e-34
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 2e-34
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 7e-34
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 5e-31
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 7e-31
1iru_L204 20S proteasome; cell cycle, immune response, prote 5e-28
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 1e-27
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 2e-27
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 1e-25
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 3e-24
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 6e-23
1iru_K201 20S proteasome; cell cycle, immune response, prote 2e-22
1iru_H205 20S proteasome; cell cycle, immune response, prote 8e-22
1iru_J205 20S proteasome; cell cycle, immune response, prote 2e-21
3unf_N199 Proteasome subunit beta type-9; antigen presentati 9e-21
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 3e-20
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 6e-20
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 9e-20
1iru_M213 20S proteasome; cell cycle, immune response, prote 5e-19
1iru_N219 20S proteasome; cell cycle, immune response, prote 8e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 Back     alignment and structure
 Score =  358 bits (922), Expect = e-127
 Identities = 167/244 (68%), Positives = 195/244 (79%), Gaps = 4/244 (1%)

Query: 4   YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKI 63
           YDRAITVFSPDGHLFQVEYA EAV+KG+ AVGVRG DIVVLGVEKKS  KLQD R VRKI
Sbjct: 3   YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKI 62

Query: 64  VSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSG 123
            +LD+++ +A AGL ADAR+++NRAR+ECQSHRLTVEDPVTVEYITRYIA L+Q+YTQS 
Sbjct: 63  CALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSN 122

Query: 124 GVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE--- 180
           G RPFG+S LIVGFD   G P LYQTDPSGT+ AWKANA GR + S+REFLEKNY +   
Sbjct: 123 GRRPFGISALIVGFDF-DGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAI 181

Query: 181 TSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAAEA 240
            +   T+KL I+ALLEVV+SGGKNIE+AVM R+  L+ L   EI+  V+EIE EK   E 
Sbjct: 182 ETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEK 241

Query: 241 AKKA 244
            K+ 
Sbjct: 242 KKQK 245
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
1iru_D248 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_C261 20S proteasome; cell cycle, immune response, prote 100.0
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 100.0
1iru_B233 20S proteasome; cell cycle, immune response, prote 100.0
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 100.0
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_A246 20S proteasome; cell cycle, immune response, prote 100.0
1iru_G254 20S proteasome; cell cycle, immune response, prote 100.0
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 100.0
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_E241 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_F263 20S proteasome; cell cycle, immune response, prote 100.0
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 100.0
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 100.0
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 100.0
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, 100.0
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 100.0
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 100.0
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 100.0
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 100.0
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 100.0
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 100.0
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 100.0
1iru_L204 20S proteasome; cell cycle, immune response, prote 100.0
1iru_N219 20S proteasome; cell cycle, immune response, prote 100.0
1iru_H205 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_M213 20S proteasome; cell cycle, immune response, prote 100.0
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 100.0
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 100.0
3unf_H234 Proteasome subunit beta type-10; antigen presentat 100.0
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_J205 20S proteasome; cell cycle, immune response, prote 100.0
1iru_K201 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 100.0
3unf_N199 Proteasome subunit beta type-9; antigen presentati 100.0
1iru_I234 20S proteasome; cell cycle, immune response, prote 100.0
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 100.0
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 100.0
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 100.0
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
Probab=100.00  E-value=2.1e-64  Score=433.79  Aligned_cols=236  Identities=70%  Similarity=1.076  Sum_probs=225.1

Q ss_pred             CCCCCCCcccCCCCcchhhhhHHHHHhcCCcEEEEEeCCEEEEEEeccCcccccccCcccceEEecCcEEEEEeccHHHH
Q 025729            2 ARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKIVSLDNHIALACAGLKADA   81 (249)
Q Consensus         2 ~~yd~~~~~fspeG~l~Qveya~~a~~~G~t~igi~~~dgVvla~d~~~~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~   81 (249)
                      |+||+.+|+|||||||||||||++|+++|+|+|||+++||||||+|++.+.+++.+++.+||++|++||+|+++|..+|+
T Consensus         1 ~~yd~~~t~fsp~Grl~QvEYA~~av~~Gtt~vgi~~~dgVvlaaD~r~~~~l~~~~~~~KI~~i~~~i~~~~aG~~aD~   80 (248)
T 1iru_D            1 MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA   80 (248)
T ss_dssp             -CCCCCCSCCCTTSCCHHHHHHHHHHHTSCCEEEECCSSEEEEEECCCCCCSSSCGGGGCSEEESSSSCEEEEEECHHHH
T ss_pred             CCccCCCceECCCCcchHHHHHHHHHHcCCCEEEEEeCCEEEEEEeecccccCccCCCCCcEEEEcCCEEEEEeecHHHH
Confidence            34999999999999999999999999999999999999999999999999988888899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhhhcCCCcCHHHHHHHHHHHHHHhhccCCCCcceeeeEEEEeeCCCCcceEEEECCCCceecceee
Q 025729           82 RVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKAN  161 (249)
Q Consensus        82 ~~l~~~~~~~~~~~~~~~~~~i~~~~la~~l~~~~~~~~~~~~~rP~~v~~iiaG~d~~~~gp~Ly~idp~G~~~~~~~~  161 (249)
                      +.++++++.+++.|+++++++++++.+++++++++|.|++++++|||+|++||||||+ ++||+||.+||+|++.+++++
T Consensus        81 ~~l~~~~~~~~~~~~~~~~~~~~v~~la~~l~~~~~~~~~~~~~rp~~v~~lvaG~D~-~~gp~Ly~idp~G~~~~~~~~  159 (248)
T 1iru_D           81 RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDF-DGTPRLYQTDPSGTYHAWKAN  159 (248)
T ss_dssp             HHHHHHHHHHHHHHHHHSSSCCCHHHHHHHHHHHHHHTTSBTTBCCCCEEEEEEEECS-SSCEEEEEECTTSCEEEBSEE
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHhccCCcccccEEEEEEEEeC-CCCcEEEEEcCCCcEEEeeEE
Confidence            9999999999999999999999999999999999999999999999999999999996 679999999999999999999


Q ss_pred             eecCCchHHHHHHHhhhccCC--c-HHHHHHHHHHHHHHHhcCCCcEEEEEEEcCCCEEEccHHHHHHHHHHHHHHHHHH
Q 025729          162 ATGRNSNSIREFLEKNYKETS--G-QETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAA  238 (249)
Q Consensus       162 aiG~g~~~~~~~Le~~~~~~~--s-~eai~la~~al~~~~~~~~~~iev~ii~~~g~~~~l~~~ei~~~~~~i~~~~~~~  238 (249)
                      |+|+|+.+++++||++|+++|  + +||++++++||..+.+.++++++|++|+++|+|++++++||++++.++...+.++
T Consensus       160 aiG~gs~~a~~~Le~~~~~~m~~s~eea~~la~~al~~~~~~sg~~i~v~vi~~~g~~~~l~~~ei~~~~~~~~~~~~~~  239 (248)
T 1iru_D          160 AIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEEN  239 (248)
T ss_dssp             EESTTHHHHHHHHTTTCCSSTTCSHHHHHHHHHHHHHTTSCTTSTTCCEEEEESSSCEECCCHHHHHHHTTTTTTTTTTT
T ss_pred             EECCCcHHHHHHHHHhhcccccCCHHHHHHHHHHHHHHHHcCCCCcEEEEEEECCCcEEECCHHHHHHHHHHHHhcchhh
Confidence            999999999999999999999  9 9999999999999988778899999999998899999999999999986554333
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1irud_243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 3e-84
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 3e-80
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 4e-79
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 3e-76
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 2e-75
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 4e-75
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 1e-74
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 2e-73
d1rypa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 5e-73
d1rypb_250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 2e-70
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 2e-70
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 3e-70
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 4e-70
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 5e-69
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 5e-68
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 6e-66
d1q5qa_227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 4e-45
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 6e-38
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 9e-38
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 7e-36
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 7e-36
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 5e-35
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-31
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 2e-31
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 3e-31
d1rypj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 2e-30
d1rypi_222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 5e-30
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 7e-30
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-28
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 2e-28
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 7e-28
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 2e-26
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 4e-25
d1iru1_213 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 1e-21
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  249 bits (637), Expect = 3e-84
 Identities = 166/243 (68%), Positives = 194/243 (79%), Gaps = 4/243 (1%)

Query: 4   YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQDSRMVRKI 63
           YDRAITVFSPDGHLFQVEYA EAV+KG+ AVGVRG DIVVLGVEKKS  KLQD R VRKI
Sbjct: 2   YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKI 61

Query: 64  VSLDNHIALACAGLKADARVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSG 123
            +LD+++ +A AGL ADAR+++NRAR+ECQSHRLTVEDPVTVEYITRYIA L+Q+YTQS 
Sbjct: 62  CALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSN 121

Query: 124 GVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE--- 180
           G RPFG+S LIVGFD     P LYQTDPSGT+ AWKANA GR + S+REFLEKNY +   
Sbjct: 122 GRRPFGISALIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAI 180

Query: 181 TSGQETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAAAEA 240
            +   T+KL I+ALLEVV+SGGKNIE+AVM R+  L+ L   EI+  V+EIE EK   E 
Sbjct: 181 ETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEK 240

Query: 241 AKK 243
            K+
Sbjct: 241 KKQ 243
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irud_243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iruc_250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypb_250 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypg_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1q5qa_227 Proteasome alpha subunit (non-catalytic) {Rhodococ 100.0
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 100.0
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypl_212 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 100.0
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1ryp2_233 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1irui_220 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1q5qh_224 Proteasome beta subunit (catalytic) {Rhodococcus e 100.0
d1rypi_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1ryp1_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.89
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.88
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.85
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=5.1e-63  Score=421.45  Aligned_cols=235  Identities=57%  Similarity=0.989  Sum_probs=223.4

Q ss_pred             CCCCCCcccCCCCcchhhhhHHHHHhcCCcEEEEEeCCEEEEEEeccCccccc-ccCcccceEEecCcEEEEEeccHHHH
Q 025729            3 RYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDIVVLGVEKKSAVKLQ-DSRMVRKIVSLDNHIALACAGLKADA   81 (249)
Q Consensus         3 ~yd~~~~~fspeG~l~Qveya~~a~~~G~t~igi~~~dgVvla~d~~~~~~l~-~~~~~~Ki~~i~~~i~~~~sG~~~D~   81 (249)
                      |||+++|+|||||||+|||||.||+++|+|+|||+++|||||++|++.++++. ...+.+||++|++|++|++||..+|+
T Consensus         1 gyd~~~t~fsp~Grl~QvEya~kav~~G~tvIgik~~dgVvlaad~~~~~~~~~~~~~~~KI~~I~~~i~~~~sG~~~D~   80 (241)
T d1rypd_           1 GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADS   80 (241)
T ss_dssp             CCCCCCSCCBTTTBCHHHHHHHHHHTTSCCEEEEECSSCEEEEEECCCSSCCBCTTTSCCSEEEEETTEEEEEEECHHHH
T ss_pred             CCCCCCceECCCCcEeHHHHHHHHHHcCCCEEEEEeCCEEEEEEEccccccCcccccccccEEEeCCCEEEEeeeccchH
Confidence            79999999999999999999999999999999999999999999999998665 44688999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhhhcCCCcCHHHHHHHHHHHHHHhhccCCCCcceeeeEEEEeeCCCCcceEEEECCCCceecceee
Q 025729           82 RVLVNRARIECQSHRLTVEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTGVPSLYQTDPSGTFSAWKAN  161 (249)
Q Consensus        82 ~~l~~~~~~~~~~~~~~~~~~i~~~~la~~l~~~~~~~~~~~~~rP~~v~~iiaG~d~~~~gp~Ly~idp~G~~~~~~~~  161 (249)
                      +.+++.++.++..|+++++.+++++.++++++.++|.|++++++|||+|++|++|||+.+++|+||.+||+|++.+++++
T Consensus        81 ~~l~~~~~~~~~~~~~~~~~~i~~~~la~~i~~~~~~~t~~~~~rP~~v~~li~G~d~~~~~p~Ly~idp~G~~~~~~~~  160 (241)
T d1rypd_          81 RILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQ  160 (241)
T ss_dssp             HHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHTTSSTTBCCCSEEEEEEECCTTCCSCEEEEECTTSCEEEBSEE
T ss_pred             HHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHhhccccCcccceEEEEEEccccCcceEEEecCCEEEEeeCeE
Confidence            99999999999999999999999999999999999999999999999999999999974679999999999999999999


Q ss_pred             eecCCchHHHHHHHhhhcc---CCc-HHHHHHHHHHHHHHHhcCCCcEEEEEEEcCCCEEEccHHHHHHHHHHHHHHHHH
Q 025729          162 ATGRNSNSIREFLEKNYKE---TSG-QETVKLAIRALLEVVESGGKNIEVAVMTREHGLRQLEEAEIDAIVSEIEAEKAA  237 (249)
Q Consensus       162 aiG~g~~~~~~~Le~~~~~---~~s-~eai~la~~al~~~~~~~~~~iev~ii~~~g~~~~l~~~ei~~~~~~i~~~~~~  237 (249)
                      |+|+|++.++++|++.|++   +|+ +|++++|++||+.+.+.++.+++|+++++++++++++++||++++.+|++++.+
T Consensus       161 a~G~gs~~~~~~Le~~~~~~~~~~t~~e~i~lal~al~~~~~~~~~~iei~ii~~d~~~~~l~~~ei~~~l~~i~~~~~~  240 (241)
T d1rypd_         161 TIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQE  240 (241)
T ss_dssp             EESTTHHHHHHHHHTTCCTTSCCCSHHHHHHHHHHHHHHHHCSCSTTEEEEEEETTTEEEECCHHHHHHHHHHHTHHHHC
T ss_pred             EECcCHHHHHHHHHHhhhcccCCCCHHHHHHHHHHHHHHHhcCCCCcEEEEEEECCCCEEECCHHHHHHHHHHHHHHHhc
Confidence            9999999999999999965   589 999999999999999888889999999998779999999999999999766543
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure