Citrus Sinensis ID: 025774


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
cccccccccHHHHHHHHccEEEEEEEcccHHHHHHHHHHccccccEEEEEccccccEEEEEcccccHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHcccccccccccccccccccHHccccccccccccccccccccEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHccccccccEEEEcccccccccccccccccHHHccccccEEEEEEc
cccccccccHHHHHHHHHcEEEEEEEcccHccHEEEEEEccccccEEEEEccccccEEEEEcccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHccccccccccccccccccccccEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHccccccccEEEEEccccccccccccccccHHHccccccEEEEEEc
MLNRDTWANEAVSQTISTNFIFWQvyddtsegkkvctyykldsipvvlvvdpitgqkmrswcgmvqpeslledlvpfmdggpreqhakvshkrprgssttpqqknkdkpdiENEELLQALAASMETIkdasgvsssdtdvastdkdeasatekpaypilpeepkvdrsllcrvgvrlpdgrrmqrnflrtdPIQLLWSYCYsqlegsemkpfrlthaipgatksldydskltfedsgLANAMISVTWE
MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTyykldsipvvLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQhakvshkrprgssttpqqknkdkpdIENEELLQALAASMETIkdasgvsssdtdvastdkdeasatekpaypilpeepkvdrslLCRVGvrlpdgrrmqrnflrtdpiqLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQALAASMETIKdasgvsssdtdvastdkdEASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
******WANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPF*****************************************************************************************RSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFE***L**********
MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQ*********QPESLLEDLVPFMDGGPREQHA********************************************************************************SLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLD*DSKLTFEDSGLANAMISVTWE
*********EAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGP***************************DIENEELLQALAASMETI*************************KPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
**NRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGG******************************************************************************PEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDSGLANAMISVTWE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
O14048427 UBX domain-containing pro yes no 0.915 0.531 0.273 1e-20
Q6P5G6467 UBX domain-containing pro yes no 0.504 0.267 0.335 6e-15
Q5REY7489 UBX domain-containing pro yes no 0.455 0.231 0.351 8e-15
O94888489 UBX domain-containing pro yes no 0.455 0.231 0.351 8e-15
Q55BU7503 UBX domain-containing pro yes no 0.524 0.258 0.323 8e-13
Q06682500 UBX domain-containing pro yes no 0.923 0.458 0.227 9e-11
>sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 125/260 (48%), Gaps = 33/260 (12%)

Query: 1   MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRS 60
           +LNRD W +E+V + I  +F+F Q+ DD   G +   +Y + S P + ++DP TG++++ 
Sbjct: 189 VLNRDLWKDESVKEVIRAHFLFLQLLDDEEPGMEFKRFYPVRSTPHIAILDPRTGERVKE 248

Query: 61  WCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQAL 120
           W     P   +  L  F++G   ++ +    K P G+ +   QK  +    E+E++ +A+
Sbjct: 249 WSKSFTPADFVIALNDFLEGCTLDETS--GRKNPLGAKS---QKPVEAMS-EDEQMHKAI 302

Query: 121 AASM---ETIKDASGVSSS---------DTDVASTDKDEASATEKPAYPILPEEPKVDRS 168
           AAS+    +  ++ G SSS         D  V   D  E  A E    P           
Sbjct: 303 AASLGNGNSTTESQGESSSQQAESHGVADDTVHKIDSAECDAEEPSPGPN---------- 352

Query: 169 LLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYD 228
            + R+ +R+P+G R  R F  TDP+  +++Y     EG++ +PF LT        SLD  
Sbjct: 353 -VTRIQIRMPNGARFIRRFSLTDPVSKVYAYVKGVAEGADKQPFSLTFQRKSLWTSLDS- 410

Query: 229 SKLTFEDSGLANAMISVTWE 248
              T +++G+ N  +   ++
Sbjct: 411 ---TIKEAGIQNTALQFEFQ 427




Involved in CDC48-dependent protein degradation through the ubiquitin/proteasome pathway.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 Back     alignment and function description
>sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 Back     alignment and function description
>sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 Back     alignment and function description
>sp|Q55BU7|UBXN7_DICDI UBX domain-containing protein 7 homolog OS=Dictyostelium discoideum GN=ubxd7 PE=4 SV=1 Back     alignment and function description
>sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
359473684 456 PREDICTED: UBX domain-containing protein 1.0 0.543 0.742 1e-101
359473686 447 PREDICTED: UBX domain-containing protein 1.0 0.554 0.742 1e-101
224111366 444 predicted protein [Populus trichocarpa] 0.975 0.545 0.703 1e-100
255561727 452 UBX domain-containing protein, putative 0.991 0.544 0.714 4e-99
449445306 450 PREDICTED: UBX domain-containing protein 0.983 0.542 0.705 9e-98
449498388288 PREDICTED: UBX domain-containing protein 0.983 0.847 0.705 1e-97
356526695 468 PREDICTED: UBX domain-containing protein 0.995 0.527 0.681 2e-97
357517375 461 UBX domain-containing protein [Medicago 1.0 0.537 0.666 2e-96
356559122 467 PREDICTED: UBX domain-containing protein 0.995 0.528 0.673 8e-96
356526697 476 PREDICTED: UBX domain-containing protein 0.995 0.518 0.660 4e-95
>gi|359473684|ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2-like isoform 2 [Vitis vinifera] gi|297738308|emb|CBI27509.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 218/252 (86%), Gaps = 4/252 (1%)

Query: 1   MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRS 60
           MLNRDTWANEAV+QTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLV+DPITGQKMRS
Sbjct: 205 MLNRDTWANEAVAQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVIDPITGQKMRS 264

Query: 61  WCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNK---DKPDIENEELL 117
           WCGM+QPE LLEDL+PFMDGGP++ H  +SHKRPR SS TP QK +   D+ + E+EE+ 
Sbjct: 265 WCGMIQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPQKIQVAADETNEEDEEVQ 324

Query: 118 QALAASMETIKDASGVSSSDTDVASTD-KDEASATEKPAYPILPEEPKVDRSLLCRVGVR 176
            ALAASM ++KD SG++S + DV +TD K+E  + +KP YP LPEEPK DR+LLCRVGVR
Sbjct: 325 LALAASMASMKDPSGLTSKEKDVTTTDKKEEMCSAKKPEYPPLPEEPKGDRNLLCRVGVR 384

Query: 177 LPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFEDS 236
           LPDGRR+QRNFLRTDPIQLLWS+CYSQLE    +PF LT AIPGA+++LDYD +LTFE+S
Sbjct: 385 LPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQNLDYDRELTFEES 444

Query: 237 GLANAMISVTWE 248
           GLAN+MISVTWE
Sbjct: 445 GLANSMISVTWE 456




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359473686|ref|XP_002274120.2| PREDICTED: UBX domain-containing protein 2-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111366|ref|XP_002315828.1| predicted protein [Populus trichocarpa] gi|222864868|gb|EEF01999.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561727|ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis] gi|223538911|gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449445306|ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449498388|ref|XP_004160525.1| PREDICTED: UBX domain-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356526695|ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|357517375|ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula] gi|358345084|ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula] gi|355502548|gb|AES83751.1| UBX domain-containing protein [Medicago truncatula] gi|355522998|gb|AET03452.1| UBX domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356559122|ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356526697|ref|XP_003531953.1| PREDICTED: UBX domain-containing protein 7-like isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
TAIR|locus:2204497468 AT1G14570 "AT1G14570" [Arabido 1.0 0.529 0.645 5.8e-82
TAIR|locus:2202872307 AT1G59550 "AT1G59550" [Arabido 0.709 0.573 0.338 4.8e-31
TAIR|locus:505006365152 AT3G23605 "AT3G23605" [Arabido 0.370 0.605 0.567 9.6e-29
POMBASE|SPAC2C4.15c427 ubx2 "UBX domain protein Ubx2" 0.955 0.555 0.26 1e-20
UNIPROTKB|E1BTX4492 UBXN7 "Uncharacterized protein 0.455 0.229 0.367 5.5e-19
ZFIN|ZDB-GENE-040704-8505 ubxn7 "UBX domain protein 7" [ 0.387 0.190 0.393 1.1e-18
MGI|MGI:2146388467 Ubxn7 "UBX domain protein 7" [ 0.455 0.241 0.351 1.6e-18
UNIPROTKB|I3LQY9476 UBXN7 "Uncharacterized protein 0.455 0.237 0.351 1.7e-18
UNIPROTKB|E2R9U7489 UBXN7 "Uncharacterized protein 0.455 0.231 0.351 2e-18
UNIPROTKB|O94888489 UBXN7 "UBX domain-containing p 0.455 0.231 0.351 2e-18
TAIR|locus:2204497 AT1G14570 "AT1G14570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 822 (294.4 bits), Expect = 5.8e-82, P = 5.8e-82
 Identities = 164/254 (64%), Positives = 191/254 (75%)

Query:     1 MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRS 60
             MLNRDTWAN+AVSQTI  NFIFWQVYDDT+EG+KVCTYYKL+SIPVVLV+DP TGQ+MR 
Sbjct:   215 MLNRDTWANDAVSQTIKANFIFWQVYDDTTEGRKVCTYYKLESIPVVLVIDPTTGQRMRM 274

Query:    61 WCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGS-STTPQQKNKDK--PDIENEELL 117
             W GMV PE+LLEDLVPFMDGGPRE  A +S KRPRGS S TP  K K+    D E EEL 
Sbjct:   275 WTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKEDVAKDEEEEELQ 334

Query:   118 QALAASMETIKXXXXXXXXXXXXXXXXXXEA-SATEKPAYPILPEEPKV-DRSLLCRVGV 175
             +ALAAS+E                     EA ++   P +P LPEEPK  DRSL CRVG+
Sbjct:   335 RALAASLEDNNMKESSDDQSTIIPEEVAVEAVTSAVLPTFPPLPEEPKGGDRSLQCRVGI 394

Query:   176 RLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMK-PFRLTHAIPGATKSLDYDSKLTFE 234
             RLP+G+R+QRNFL+TD IQLLWS+CYSQLE SE K P +LT AIPG +K+L+Y+S LT E
Sbjct:   395 RLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGESKTLEYESNLTLE 454

Query:   235 DSGLANAMISVTWE 248
              SG+AN+MIS TWE
Sbjct:   455 QSGVANSMISATWE 468




GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2202872 AT1G59550 "AT1G59550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006365 AT3G23605 "AT3G23605" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC2C4.15c ubx2 "UBX domain protein Ubx2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTX4 UBXN7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-8 ubxn7 "UBX domain protein 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2146388 Ubxn7 "UBX domain protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQY9 UBXN7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9U7 UBXN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O94888 UBXN7 "UBX domain-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00035143001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (453 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
cd02958114 cd02958, UAS, UAS family; UAS is a domain of unkno 1e-35
smart00594122 smart00594, UAS, UAS domain 1e-32
pfam0078978 pfam00789, UBX, UBX domain 3e-16
cd0176777 cd01767, UBX, UBX (ubiquitin regulatory X) domain 2e-06
smart0016677 smart00166, UBX, Domain present in ubiquitin-regul 5e-04
>gnl|CDD|239256 cd02958, UAS, UAS family; UAS is a domain of unknown function Back     alignment and domain information
 Score =  122 bits (309), Expect = 1e-35
 Identities = 35/80 (43%), Positives = 53/80 (66%)

Query: 1   MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRS 60
           +LNRD W+NE+V + I  NFIFWQ   D+SEG++    YK+D  P + ++DP TG+ ++ 
Sbjct: 34  VLNRDLWSNESVKEFIRENFIFWQCDIDSSEGQRFLQSYKVDKYPHIAIIDPRTGEVLKV 93

Query: 61  WCGMVQPESLLEDLVPFMDG 80
           W G + PE LL  L+ F++ 
Sbjct: 94  WSGNITPEDLLSQLIEFLEE 113


Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP), which is involved in the ubiquitin-proteosome pathway. Some members of this family are uncharacterized proteins containing only a UAS domain. Length = 114

>gnl|CDD|214737 smart00594, UAS, UAS domain Back     alignment and domain information
>gnl|CDD|216120 pfam00789, UBX, UBX domain Back     alignment and domain information
>gnl|CDD|176362 cd01767, UBX, UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>gnl|CDD|197552 smart00166, UBX, Domain present in ubiquitin-regulatory proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
KOG1363460 consensus Predicted regulator of the ubiquitin pat 99.97
KOG1364356 consensus Predicted ubiquitin regulatory protein, 99.95
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 99.89
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 99.87
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 99.87
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 99.87
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 99.86
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 99.82
smart0016680 UBX Domain present in ubiquitin-regulatory protein 99.82
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 99.82
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 99.79
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 99.78
cd02990136 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 99.77
smart00594122 UAS UAS domain. 99.64
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.62
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 99.5
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 99.36
COG2143182 Thioredoxin-related protein [Posttranslational mod 97.69
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 97.66
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 97.57
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 97.4
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 97.34
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 97.3
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 97.3
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 97.26
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 97.26
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 97.12
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 97.06
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 97.05
cd02955124 SSP411 TRX domain, SSP411 protein family; members 97.03
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 97.03
PTZ0004476 ubiquitin; Provisional 96.96
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 96.88
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 96.8
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 96.78
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 96.67
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 96.61
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 96.59
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 96.59
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 96.58
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 96.5
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 96.49
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 96.47
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 96.41
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 96.4
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 96.34
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 96.29
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 95.9
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 95.79
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 95.75
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 95.55
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 95.54
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 95.54
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 95.4
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 95.39
PRK00293571 dipZ thiol:disulfide interchange protein precursor 95.37
PRK10996139 thioredoxin 2; Provisional 95.32
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 95.29
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 95.25
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 95.17
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 94.95
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 94.86
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 94.85
PRK09381109 trxA thioredoxin; Provisional 94.35
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 94.31
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 94.24
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 94.24
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 94.19
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 94.18
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 94.14
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 94.01
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 94.0
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 93.7
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 93.69
PHA02278103 thioredoxin-like protein 93.2
TIGR02740271 TraF-like TraF-like protein. This protein is relat 93.17
PRK03147173 thiol-disulfide oxidoreductase; Provisional 93.16
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 93.02
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 92.64
cd0294793 TRX_family TRX family; composed of two groups: Gro 92.5
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 92.41
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 92.34
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 92.32
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 92.24
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 92.07
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 91.62
TIGR02739256 TraF type-F conjugative transfer system pilin asse 91.53
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 91.52
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 91.41
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 91.39
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 91.28
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 91.26
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 91.22
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 91.11
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 91.1
PF13728215 TraF: F plasmid transfer operon protein 91.1
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 91.01
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 90.62
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 89.84
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 89.83
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 89.31
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 89.08
PRK13703248 conjugal pilus assembly protein TraF; Provisional 88.71
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 88.66
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 88.66
PRK13728181 conjugal transfer protein TrbB; Provisional 88.55
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 88.53
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 87.71
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 87.24
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 86.85
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 86.8
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 86.41
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 86.0
PTZ00443224 Thioredoxin domain-containing protein; Provisional 85.91
COG5100 571 NPL4 Nuclear pore protein [Nuclear structure] 84.83
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 84.75
PLN02560 308 enoyl-CoA reductase 84.57
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 84.18
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 84.07
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 83.71
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 83.2
KOG0907106 consensus Thioredoxin [Posttranslational modificat 82.9
PTZ0005198 thioredoxin; Provisional 82.87
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 82.41
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 82.38
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 81.25
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 80.98
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 80.95
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 80.81
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 80.59
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 80.46
PF0280918 UIM: Ubiquitin interaction motif; InterPro: IPR003 80.38
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 80.23
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.97  E-value=3.3e-31  Score=243.56  Aligned_cols=234  Identities=21%  Similarity=0.285  Sum_probs=167.3

Q ss_pred             CcccccCCCHHHHHHhhcceEEEEEecCChHHHHHHHhcCCC----------------CCceEEEEeCCC-Cc-eEEeee
Q 025774            1 MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLD----------------SIPVVLVVDPIT-GQ-KMRSWC   62 (248)
Q Consensus         1 ~~~r~vl~~~~v~~~l~~~fV~w~~d~~~~eg~~~~~~~~~~----------------~~P~l~ii~~~~-g~-~l~~~~   62 (248)
                      .||+.+|||+.|++||+++||+|+||+++++++.+++.+.+.                .||++.++.... .. ++..++
T Consensus       199 ~F~~~iL~~e~v~~~l~~~~llw~~dvt~~e~~~~~~~~~~r~~~~~~~~~~~~~~~~~fP~~~iv~~~~~~~Ell~~l~  278 (460)
T KOG1363|consen  199 VFCGQILCNEAVVDYLRENFLLWGWDVTESENLLVFNSLLNRSISSPAAVTNKASKSERFPLVRIVIGSRSPEELLRYLQ  278 (460)
T ss_pred             HHHHhhhhhHHHHHHHhhceeeecccccCchhhHHHHHHhhcccchhhhhhcchhhcccCchhhhhhcCCCHHHHHHHHH
Confidence            389999999999999999999999999999999999999887                688887765321 11 566788


Q ss_pred             CCCChHHHHHHHhhhhhcCCCCccccccCCCCCCCCCCcccCCCCCCcchHHHHHHHHHHhhHhhhcc--CCC--CCCCc
Q 025774           63 GMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDKPDIENEELLQALAASMETIKDA--SGV--SSSDT  138 (248)
Q Consensus        63 G~~~~e~l~~~L~~~~~~~~~~~~~~l~~~r~~~~~~~~~~~~~~~~~~eeee~~~A~~~sl~~~~~~--~~~--~~ee~  138 (248)
                      |.++.++.+..+..+++.+....    ...+.  ++     ..+..|..-++|++.+|++||++|+.+  +..  .++.+
T Consensus       279 g~~~~~e~~~~~~~~~~~~~~~~----q~~~~--~~-----~er~~r~~~~~eQd~eyq~sle~Dr~r~~e~e~~~e~~r  347 (460)
T KOG1363|consen  279 GVTGVDEEMTLLLVAFEEEERRL----QMRRS--EQ-----DEREARLALEQEQDDEYQASLEADRVREAEAEQAAEEFR  347 (460)
T ss_pred             hcCCchHHHHHHHhhhhhhhHHH----hhccc--ch-----hHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhhHHHH
Confidence            88888888888877777652111    10010  00     011122333345678999999999876  111  11111


Q ss_pred             c----cCCcchhhhcccCCCCCCCCCCCCCCCCCCceEEEEEcCCCceEEEeeCCCCchHHHHHHHHhhcCCCCCcCeEE
Q 025774          139 D----VASTDKDEASATEKPAYPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRL  214 (248)
Q Consensus       139 ~----~~~~~~~e~~~~~~~~~~~l~~eP~~~~~~~~~i~iRlp~G~r~~r~F~~~~~l~~l~~fv~~~~~~~~~~~f~L  214 (248)
                      .    +++++++|.........+.||+||++...++++|+||+|+|.+..|||..+++++.||+||.++  +..+..|.+
T Consensus       348 ~e~er~~~~ee~e~~R~~l~~es~lp~EP~a~~~~~~~l~iR~P~G~r~~RrF~~s~~~q~l~~~v~~~--~~~~~e~~~  425 (460)
T KOG1363|consen  348 LEKERKEEEEERETARQLLALESSLPPEPSASEEEAITVAIRLPSGTRLERRFLKSDKLQILYDYVDSN--GFHPEEYSL  425 (460)
T ss_pred             HhhhhhhHHHHHHHHHHHHhhhccCCCCCCcCcccceeeEEECCCCCeeeeeeecccchhHHHHHHHhc--cCCchhhcc
Confidence            0    1111111111112234578999998788899999999999999999999999999999999997  456899999


Q ss_pred             EccCCCCccccCCCcCCCccccCCcC--ceEEEEeC
Q 025774          215 THAIPGATKSLDYDSKLTFEDSGLAN--AMISVTWE  248 (248)
Q Consensus       215 ~~~~Pr~~~~l~~d~~~tl~d~gl~~--~~v~v~~~  248 (248)
                      .++|||+.++- .....|+++.|+.+  .+|.++|.
T Consensus       426 ~~~fPr~~~~~-~~~~~sl~~~~l~p~qe~lflE~~  460 (460)
T KOG1363|consen  426 NTSFPRRPLGD-YEHSSSLQDIGLTPRQETLFLEEI  460 (460)
T ss_pred             ccCCCcccccc-cccccccccCCcccccceeeeecC
Confidence            99999997332 34589999999986  56777763



>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>COG5100 NPL4 Nuclear pore protein [Nuclear structure] Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PF02809 UIM: Ubiquitin interaction motif; InterPro: IPR003903 The Ubiquitin Interacting Motif (UIM), or 'LALAL-motif', is a stretch of about 20 amino acid residues, which was first described in the 26S proteasome subunit PSD4/RPN-10 that is known to recognise ubiquitin [,] Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2dlx_A153 Solution Structure Of The Uas Domain Of Human Ubx D 3e-15
>pdb|2DLX|A Chain A, Solution Structure Of The Uas Domain Of Human Ubx Domain- Containing Protein 7 Length = 153 Back     alignment and structure

Iteration: 1

Score = 78.6 bits (192), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%) Query: 2 LNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRSW 61 LNRD W+NEAV I +FIFWQVY D+ EG++ +YKL P V ++DP TGQK+ W Sbjct: 60 LNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEW 119 Query: 62 CGMVQPESLLEDLVPFM 78 + S L+ + F+ Sbjct: 120 -HQLDVSSFLDQVTGFL 135

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 8e-28
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 2e-17
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 1e-13
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 3e-10
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 1e-09
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 3e-08
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 Back     alignment and structure
 Score =  103 bits (257), Expect = 8e-28
 Identities = 35/79 (44%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MLNRDTWANEAVSQTISTNFIFWQVYDDTSEGKKVCTYYKLDSIPVVLVVDPITGQKMRS 60
            LNRD W+NEAV   I  +FIFWQVY D+ EG++   +YKL   P V ++DP TGQK+  
Sbjct: 59  CLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVE 118

Query: 61  WCGMVQPESLLEDLVPFMD 79
           W  +    S L+ +  F+ 
Sbjct: 119 WHQL-DVSSFLDQVTGFLG 136


>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Length = 109 Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Length = 127 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Length = 124 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Length = 84 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 99.9
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 99.84
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 99.84
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 99.83
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 99.8
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 99.72
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.49
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.68
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 97.05
2kuc_A130 Putative disulphide-isomerase; structural genomics 97.7
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 97.58
2pjh_A80 Protein NPL4, nuclear protein localization protein 97.56
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 97.52
3f9u_A172 Putative exported cytochrome C biogenesis-related; 97.39
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 97.39
3v6c_B91 Ubiquitin; structural genomics, structural genomic 97.35
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 97.31
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 97.28
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 97.27
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 97.24
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 97.19
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 97.17
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 97.17
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 97.14
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 97.12
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 97.12
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 97.08
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 97.07
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 97.06
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 97.05
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 97.04
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 97.03
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 97.01
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 96.96
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 96.92
2l57_A126 Uncharacterized protein; structural genomics, unkn 96.91
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 96.78
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 96.77
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 96.77
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 96.75
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 96.71
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 96.7
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 96.69
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 96.66
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 96.65
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 96.64
1we6_A111 Splicing factor, putative; structural genomics, ub 96.62
2qsi_A137 Putative hydrogenase expression/formation protein; 96.61
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 96.59
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 96.59
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 96.57
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 96.57
2yzu_A109 Thioredoxin; redox protein, electron transport, st 96.56
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 96.55
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 96.55
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 96.55
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 96.53
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 96.53
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 96.52
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 96.52
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 96.51
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 96.5
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 96.5
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 96.49
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 96.49
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 96.48
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 96.45
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 96.44
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 96.43
4euy_A105 Uncharacterized protein; structural genomics, PSI- 96.41
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 96.38
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 96.38
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 96.37
3ira_A173 Conserved protein; methanosarcina mazei,structural 96.34
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 96.33
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 96.29
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 96.29
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 96.29
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 96.26
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 96.26
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 96.25
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 96.25
3m62_B106 UV excision repair protein RAD23; armadillo-like r 96.24
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 96.23
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 96.2
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 96.18
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 96.17
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 96.15
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 96.14
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 96.09
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 96.08
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 96.07
2l5l_A136 Thioredoxin; structural genomics, electron transpo 96.06
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 96.05
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 96.05
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 96.03
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 96.01
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 95.98
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 95.94
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 95.93
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 95.92
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 95.92
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 95.91
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 95.9
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 95.88
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 95.85
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 95.84
3raz_A151 Thioredoxin-related protein; structural genomics, 95.84
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 95.83
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 95.83
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 95.82
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 95.8
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 95.8
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 95.78
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 95.77
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 95.76
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 95.72
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 95.72
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 95.7
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 95.65
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 95.65
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 95.65
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 95.65
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 95.63
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 95.57
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 95.56
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 95.54
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 95.53
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 95.5
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 95.5
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 95.49
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 95.49
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 95.49
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 95.48
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 95.47
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 95.47
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 95.45
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 95.42
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 95.42
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 95.41
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 95.41
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.37
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 95.36
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 95.35
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 95.35
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 95.34
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 95.33
2l5o_A153 Putative thioredoxin; structural genomics, unknown 95.32
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 95.32
4evm_A138 Thioredoxin family protein; structural genomics, n 95.27
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 95.23
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 95.23
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 94.21
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 95.12
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 95.11
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 95.1
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 95.06
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 95.04
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 95.02
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 94.98
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 94.98
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 94.97
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 94.96
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 94.96
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 94.94
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 94.81
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 94.78
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 94.75
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 94.74
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 94.7
2kj6_A97 Tubulin folding cofactor B; methods development, N 94.69
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 94.68
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 94.57
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 94.56
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 94.55
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 94.54
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 94.48
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 94.47
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 94.45
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 94.43
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 94.4
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 94.29
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 94.2
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 94.18
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 94.07
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 94.07
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 94.01
2lrt_A152 Uncharacterized protein; structural genomics, thio 93.94
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 93.9
1zma_A118 Bacterocin transport accessory protein; alpha-beta 93.86
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 93.82
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 93.82
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 93.76
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 93.65
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 93.55
1mek_A120 Protein disulfide isomerase; electron transport, r 93.55
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 93.54
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 93.48
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 93.41
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 93.32
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 93.31
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 93.27
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 93.26
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 92.37
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 93.21
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 93.12
2lrn_A152 Thiol:disulfide interchange protein; structural ge 92.77
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 92.68
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 92.57
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 92.52
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 92.4
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 92.21
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 92.2
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 92.13
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 91.86
2ywi_A196 Hypothetical conserved protein; uncharacterized co 91.76
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 91.75
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 91.72
2fnj_B118 Transcription elongation factor B polypeptide 2; b 91.71
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 91.67
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 91.62
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 91.59
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 91.56
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 91.41
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 91.36
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 91.19
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 90.95
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 90.93
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 90.91
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 90.9
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 90.14
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 89.96
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 89.78
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 89.76
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 89.69
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 89.68
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 89.45
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 89.43
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 89.22
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 89.2
1wmj_A130 Thioredoxin H-type; structural genomics, program f 89.19
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 88.93
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 88.26
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 88.14
4ajy_B118 Transcription elongation factor B polypeptide 2; E 87.98
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 87.9
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 87.71
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 87.6
3me7_A170 Putative uncharacterized protein; electron transfe 87.53
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 87.3
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 87.0
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 86.37
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 86.33
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 86.29
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 86.26
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 85.85
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 85.69
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 85.55
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 85.03
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 84.97
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 84.87
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 84.85
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 84.57
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 84.56
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 84.5
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 84.39
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 84.27
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 83.48
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 82.71
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 81.83
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 81.64
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 81.13
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 80.8
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 80.8
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 80.69
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 80.04
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
Probab=99.90  E-value=8.9e-24  Score=159.39  Aligned_cols=86  Identities=27%  Similarity=0.484  Sum_probs=77.4

Q ss_pred             CCCCCCCCCCCCCCceEEEEEcCCCceEEEeeCCCCchHHHHHHHHhhcCCCCCcCeEEEccCCCCccccCCCcCCCccc
Q 025774          156 YPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFED  235 (248)
Q Consensus       156 ~~~l~~eP~~~~~~~~~i~iRlp~G~r~~r~F~~~~~l~~l~~fv~~~~~~~~~~~f~L~~~~Pr~~~~l~~d~~~tl~d  235 (248)
                      ...||+||..+.+++|+|+||||||+|++|||+.+++|++||+||.++  ++.+..|.|+++|||+.  +..|.++||+|
T Consensus         9 ~~~lp~EP~~~~~~~~~IqiRlpdG~r~~rrF~~~~tl~~v~~fv~~~--~~~~~~f~L~t~fPrk~--l~~d~~~TL~e   84 (109)
T 2cr5_A            9 VPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKV--GYHKSLYRLSTSFPRRA--LEVEGGSSLED   84 (109)
T ss_dssp             CCCCCCCCCSSCSSEEEEEEECTTSCEEEEEEESSSBTHHHHHHHHHH--TCCTTTEEEECSSSCCB--CCCCSSCBHHH
T ss_pred             cccCCCCCCCCCCCcEEEEEECCCCCEEEEEeCCCCCHHHHHHHHHhc--CCCCCCeEEEeCCCCcC--CCCCCCCCHHH
Confidence            568999999888899999999999999999999999999999999986  55688999999999987  55578999999


Q ss_pred             cCCcCceEEE
Q 025774          236 SGLANAMISV  245 (248)
Q Consensus       236 ~gl~~~~v~v  245 (248)
                      +||.|+++|+
T Consensus        85 ~gL~p~a~L~   94 (109)
T 2cr5_A           85 IGITVDTVLN   94 (109)
T ss_dssp             HTCSSCEEEE
T ss_pred             cCCCCCeEEE
Confidence            9999877654



>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d2cr5a196 d.15.1.2 (A:8-103) UBX domain-containing protein 6 4e-13
d1i42a_89 d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 9e-13
d2dlxa1147 c.47.1.24 (A:1-147) UBX domain-containing protein 7e-12
d1wj4a_124 d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human 5e-11
d1h8ca_82 d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human 2e-09
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: UBX domain
domain: UBX domain-containing protein 6 (Reproduction 8)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 61.5 bits (149), Expect = 4e-13
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 157 PILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTH 216
           P LPEEP      +  V +R P+GR ++R F ++   Q+L  +         +  +RL+ 
Sbjct: 3   PDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSL--YRLST 60

Query: 217 AIPGATKSLDYDSKLTFEDSGLANAMI 243
           + P   ++L+ +   + ED G+    +
Sbjct: 61  SFPR--RALEVEGGSSLEDIGITVDTV 85


>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 99.9
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.88
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 99.84
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 99.8
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.57
d1s3si_50 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.91
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 97.55
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 97.34
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 97.27
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 97.26
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 97.25
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 97.21
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 97.13
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.12
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 97.07
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 97.02
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 97.0
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 96.97
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 96.92
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 96.9
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 96.88
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 96.86
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 96.85
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 96.8
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 96.71
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 96.65
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 96.63
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 96.63
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 96.62
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 96.51
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.4
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 96.3
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 96.29
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 96.28
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 96.22
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 96.18
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 96.12
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 96.11
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 96.07
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 95.96
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 95.86
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 95.84
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 95.76
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 95.68
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 95.53
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 95.5
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 95.49
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 95.46
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 95.4
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 95.33
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 95.1
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 95.07
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 94.88
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 94.79
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 94.6
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 94.59
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 94.33
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 94.09
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 94.05
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 93.78
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 93.73
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 93.35
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 93.3
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 93.26
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 93.23
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 92.88
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 92.7
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 92.33
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 91.54
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 91.49
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 91.19
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 91.09
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 90.53
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 90.49
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 89.91
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 89.48
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 89.33
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 89.19
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 88.2
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 87.32
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 85.27
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 84.52
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 84.44
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 83.19
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 82.38
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 80.2
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: UBX domain
domain: UBX domain-containing protein 6 (Reproduction 8)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.90  E-value=1.2e-23  Score=153.50  Aligned_cols=88  Identities=27%  Similarity=0.489  Sum_probs=77.6

Q ss_pred             CCCCCCCCCCCCCCceEEEEEcCCCceEEEeeCCCCchHHHHHHHHhhcCCCCCcCeEEEccCCCCccccCCCcCCCccc
Q 025774          156 YPILPEEPKVDRSLLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYDSKLTFED  235 (248)
Q Consensus       156 ~~~l~~eP~~~~~~~~~i~iRlp~G~r~~r~F~~~~~l~~l~~fv~~~~~~~~~~~f~L~~~~Pr~~~~l~~d~~~tl~d  235 (248)
                      .+.||+||+.+.+++|+|+||||||++++|+|+.+++|++||+||.+.  ++....|.|+++||++.  +..|.++||+|
T Consensus         2 ~~~lp~EP~~~~~~~~~i~iRlPdG~r~~r~F~~~dtl~~l~~fv~~~--~~~~~~f~l~~~~Pr~~--~~~d~~~TL~e   77 (96)
T d2cr5a1           2 VPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKV--GYHKSLYRLSTSFPRRA--LEVEGGSSLED   77 (96)
T ss_dssp             CCCCCCCCCSSCSSEEEEEEECTTSCEEEEEEESSSBTHHHHHHHHHH--TCCTTTEEEECSSSCCB--CCCCSSCBHHH
T ss_pred             CCCCCCCCCCCCCCeEEEEEECCCCCEEEEEECCcccHHHHHHHHHHh--ccCcccceeecCCCcee--cCccCCCcHHH
Confidence            468999999888999999999999999999999999999999999987  45688999999999986  54578999999


Q ss_pred             cCCcCceE-EEEe
Q 025774          236 SGLANAMI-SVTW  247 (248)
Q Consensus       236 ~gl~~~~v-~v~~  247 (248)
                      +||.++++ +|.+
T Consensus        78 ~gl~p~~~L~v~~   90 (96)
T d2cr5a1          78 IGITVDTVLNVEE   90 (96)
T ss_dssp             HTCSSCEEEEEEE
T ss_pred             CCCCCCCEEEEec
Confidence            99997665 4543



>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3si_ d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure