Citrus Sinensis ID: 025834

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MRAIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLTI
cccccccHHHHHHHHHcccccccccccccccccEEEEccccHHHHccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEccccHHHHHHHHHHHHcccccEEEcccHHHHHHHHcccccccccEEEEEcccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEcHHHHHHccccccHHHHccccccccccccHHHHHHHHccHHHHHHcccc
cccccccHHHHHHHHcccccccHHHHHcccccEEEEEEccccEEEccccccccccccHHHHHcHHHHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHcccccEEEEcccHHEEcEccccccEcccEEEEcccEEEccccccccEEccccccccccccHccccccccccccHHHEEcccccHcccEEEEcHHHHHHHcccccHHHHHcccccccccccccccHHccccHHHHHHHHcc
mraiplapsewrnkleagkdidkasnsdlnrDFILLDvrngyewdighfhgarrpdvdcfrstsfglsqreafasdpladldkekTDILMYCTGGIRCDVYSTILrqrgfhnlytlkggvshylenegpvewvgnlfvfdsrlslppsaykpdavsearmigkvpenpfatcyICSSQVRelrhrncanldcnLLFLCCADcvknlrgccclncttapqrrpvlpgyqrykkwhlyrdsevqsqlti
mraiplapsewrnkleagkdidkasnsdlnRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGlsqreafasdpladldkeKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNcttapqrrpvlpgyqrykkwhlyrdsevqsqlti
MRAIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLTI
****************************LNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLP***Y****V*EARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYR**********
*RAIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREA**********KEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNC*********************************
MRAIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRD*********
***IPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLT*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRAIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query247 2.2.26 [Sep-21-2011]
F4I933448 Rhodanese-like domain-con yes no 0.983 0.542 0.671 4e-98
Q6ME97320 UPF0176 protein pc0378 OS yes no 0.825 0.637 0.365 9e-40
Q9Z7H1324 UPF0176 protein CPn_0734/ yes no 0.829 0.632 0.369 1e-38
Q252M0325 UPF0176 protein CF0996 OS yes no 0.829 0.630 0.365 3e-38
Q5L7A0326 UPF0176 protein CAB010 OS yes no 0.793 0.601 0.375 3e-37
Q824X8331 UPF0176 protein CCA_00010 yes no 0.825 0.616 0.362 6e-37
Q9PJB6328 UPF0176 protein TC_0916 O yes no 0.793 0.597 0.357 1e-36
Q3KL68327 UPF0176 protein CTA_0680 yes no 0.793 0.599 0.366 2e-36
O84632327 UPF0176 protein CT_627 OS yes no 0.793 0.599 0.366 2e-36
B0B8K2327 UPF0176 protein CTL0891 O yes no 0.793 0.599 0.366 2e-36
>sp|F4I933|STR8_ARATH Rhodanese-like domain-containing protein 8, chloroplastic OS=Arabidopsis thaliana GN=STR8 PE=2 SV=1 Back     alignment and function desciption
 Score =  357 bits (917), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 202/253 (79%), Gaps = 10/253 (3%)

Query: 1   MRAIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCF 60
           MRA PL PSEW+ KL+   D D+AS S+  + +ILLDVRNGYEWD+GHF GA RP+VDCF
Sbjct: 192 MRAKPLEPSEWKRKLKDLTDDDEASPSNSGKSYILLDVRNGYEWDVGHFRGAHRPEVDCF 251

Query: 61  RSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGV 120
           R+TSFGLS  +   SDPL ++DKEKTDILMYCTGGIRCDVYST+LRQRGF NLYTLKGGV
Sbjct: 252 RNTSFGLSDEKEAPSDPLINVDKEKTDILMYCTGGIRCDVYSTVLRQRGFKNLYTLKGGV 311

Query: 121 SHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEA------RMIGKVPENP----FA 170
           SHYL+ EG  EWVGNLFVFDSRLSLPP+AY  + V +A         G+ P+ P    FA
Sbjct: 312 SHYLKEEGTAEWVGNLFVFDSRLSLPPAAYNDNVVDKAVGDNVVDEAGRTPQTPVDTSFA 371

Query: 171 TCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRY 230
            CY+C+SQV+ELRHRNCANLDCN LFLCCA+CV +L+GCCC +C +AP+ RPVL G +RY
Sbjct: 372 RCYLCNSQVQELRHRNCANLDCNRLFLCCAECVVDLKGCCCSDCISAPRLRPVLHGVKRY 431

Query: 231 KKWHLYRDSEVQS 243
           +KWH+YRDSE Q+
Sbjct: 432 EKWHVYRDSEEQN 444

Arabidopsis thaliana (taxid: 3702)
>sp|Q6ME97|Y378_PARUW UPF0176 protein pc0378 OS=Protochlamydia amoebophila (strain UWE25) GN=pc0378 PE=3 SV=1 Back     alignment and function description
>sp|Q9Z7H1|Y734_CHLPN UPF0176 protein CPn_0734/CP_0012/CPj0734/CpB0762 OS=Chlamydia pneumoniae GN=CPn_0734 PE=3 SV=1 Back     alignment and function description
>sp|Q252M0|Y996_CHLFF UPF0176 protein CF0996 OS=Chlamydophila felis (strain Fe/C-56) GN=CF0996 PE=3 SV=1 Back     alignment and function description
>sp|Q5L7A0|Y010_CHLAB UPF0176 protein CAB010 OS=Chlamydophila abortus (strain S26/3) GN=CAB010 PE=3 SV=1 Back     alignment and function description
>sp|Q824X8|Y010_CHLCV UPF0176 protein CCA_00010 OS=Chlamydophila caviae (strain GPIC) GN=CCA_00010 PE=3 SV=1 Back     alignment and function description
>sp|Q9PJB6|Y916_CHLMU UPF0176 protein TC_0916 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0916 PE=3 SV=1 Back     alignment and function description
>sp|Q3KL68|Y680_CHLTA UPF0176 protein CTA_0680 OS=Chlamydia trachomatis serovar A (strain HAR-13 / ATCC VR-571B) GN=CTA_0680 PE=3 SV=1 Back     alignment and function description
>sp|O84632|Y627_CHLTR UPF0176 protein CT_627 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_627 PE=3 SV=1 Back     alignment and function description
>sp|B0B8K2|Y891_CHLT2 UPF0176 protein CTL0891 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=CTL0891 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
359491815 441 PREDICTED: UPF0176 protein pc0378-like [ 0.995 0.557 0.744 1e-108
296088010 367 unnamed protein product [Vitis vinifera] 0.995 0.670 0.744 1e-107
356512942 437 PREDICTED: UPF0176 protein pc0378-like i 1.0 0.565 0.700 1e-102
356512944 416 PREDICTED: UPF0176 protein pc0378-like i 1.0 0.593 0.700 1e-102
356527913 436 PREDICTED: LOW QUALITY PROTEIN: UPF0176 1.0 0.566 0.708 1e-102
255546894314 protein with unknown function [Ricinus c 1.0 0.786 0.693 1e-100
334182661 448 rhodanese homology domain-containing pro 0.983 0.542 0.671 2e-96
240254095 446 rhodanese homology domain-containing pro 0.983 0.544 0.671 2e-96
388521831 433 unknown [Lotus japonicus] 1.0 0.570 0.692 3e-96
297850178 448 predicted protein [Arabidopsis lyrata su 0.983 0.542 0.685 4e-95
>gi|359491815|ref|XP_002264379.2| PREDICTED: UPF0176 protein pc0378-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 209/247 (84%), Gaps = 1/247 (0%)

Query: 1   MRAIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCF 60
           +RA  LAPSEWR +LEA   ID ASN + N + ILLDVRNGYEWD+GHF GA+RPDVDCF
Sbjct: 194 LRATALAPSEWRKRLEAVNKIDDASNENSNANCILLDVRNGYEWDVGHFRGAQRPDVDCF 253

Query: 61  RSTSFGLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGV 120
           RSTSFG SQ E   SDPLA++DKEKTDILMYCTGGIRCDVYS ILRQRGF NLYTLKGGV
Sbjct: 254 RSTSFGQSQSEVIVSDPLANVDKEKTDILMYCTGGIRCDVYSAILRQRGFQNLYTLKGGV 313

Query: 121 SHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPE-NPFATCYICSSQV 179
           SHYLE EGP+EW+GNLFVFDSRLSLPPS YK +AVSE     +V E + FA CYIC+SQ+
Sbjct: 314 SHYLEKEGPMEWIGNLFVFDSRLSLPPSTYKTEAVSETSGAHQVSEGSTFARCYICNSQL 373

Query: 180 RELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDS 239
            ELRHRNCANLDCNLLFLCC  C+K+LRGCCCL+CT+AP+ RPVLPG+QRYKKW++YRD 
Sbjct: 374 HELRHRNCANLDCNLLFLCCTQCLKDLRGCCCLDCTSAPRLRPVLPGHQRYKKWYIYRDM 433

Query: 240 EVQSQLT 246
           E+Q+  T
Sbjct: 434 ELQTNST 440

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296088010|emb|CBI35293.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512942|ref|XP_003525173.1| PREDICTED: UPF0176 protein pc0378-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356512944|ref|XP_003525174.1| PREDICTED: UPF0176 protein pc0378-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356527913|ref|XP_003532550.1| PREDICTED: LOW QUALITY PROTEIN: UPF0176 protein pc0378-like [Glycine max] Back     alignment and taxonomy information
>gi|255546894|ref|XP_002514505.1| protein with unknown function [Ricinus communis] gi|223546404|gb|EEF47905.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|334182661|ref|NP_001185025.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|384950757|sp|F4I933.1|STR8_ARATH RecName: Full=Rhodanese-like domain-containing protein 8, chloroplastic; AltName: Full=Sulfurtransferase 8; Short=AtStr8; Flags: Precursor gi|332191523|gb|AEE29644.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240254095|ref|NP_564039.6| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|332191522|gb|AEE29643.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388521831|gb|AFK48977.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297850178|ref|XP_002892970.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338812|gb|EFH69229.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
UNIPROTKB|Q71ZT6319 LMOf2365_1403 "UPF0176 protein 0.627 0.485 0.363 2.4e-21
UNIPROTKB|P67330328 SP_0095 "UPF0176 protein SP_00 0.623 0.469 0.322 1.4e-18
MGI|MGI:3039624495 Tstd2 "thiosulfate sulfurtrans 0.724 0.361 0.355 1.7e-18
RGD|1310893493 Tstd2 "thiosulfate sulfurtrans 0.724 0.363 0.355 4.6e-18
UNIPROTKB|Q5T7W7516 TSTD2 "Thiosulfate sulfurtrans 0.724 0.346 0.355 1.1e-17
UNIPROTKB|Q81S00319 BAS1744 "UPF0176 protein BA_18 0.704 0.545 0.301 1.2e-17
TIGR_CMR|BA_1881319 BA_1881 "rhodanese-like domain 0.704 0.545 0.301 1.2e-17
UNIPROTKB|Q47UT5341 CPS_4798 "UPF0176 protein CPS_ 0.421 0.304 0.384 9.8e-16
TIGR_CMR|CPS_4798341 CPS_4798 "rhodanese domain pro 0.421 0.304 0.384 9.8e-16
UNIPROTKB|Q0BYQ3316 HNE_2710 "UPF0176 protein HNE_ 0.445 0.348 0.394 4.2e-15
UNIPROTKB|Q71ZT6 LMOf2365_1403 "UPF0176 protein LMOf2365_1403" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
 Score = 250 (93.1 bits), Expect = 2.4e-21, P = 2.4e-21
 Identities = 64/176 (36%), Positives = 97/176 (55%)

Query:    29 LNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDI 88
             L+ D ++LD RN YE+DIGHF GA RPD+  FR     +        + LAD  K+   I
Sbjct:   124 LDEDTVILDARNDYEFDIGHFRGAVRPDIQNFRELPGWIEDNR----EQLAD--KK---I 174

Query:    89 LMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENE---GPVEWVGNLFVFDSRLSL 145
             + YCTGGIRC+ +S  L+  GF ++  L GG++ Y +NE   G + W G ++VFD R+++
Sbjct:   175 VTYCTGGIRCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETKGEL-WDGQMYVFDERIAV 233

Query:   146 PPSAYKPDAVSEARMIGKVPE------NPFATCYICSSQVRELRH-RNCANLDCNL 194
             P +   P  V +    G   E      NP+    I +S   E ++ R+C++ DC +
Sbjct:   234 PINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASIENEKKYLRSCSH-DCRV 288
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|P67330 SP_0095 "UPF0176 protein SP_0095" [Streptococcus pneumoniae TIGR4 (taxid:170187)] Back     alignment and assigned GO terms
MGI|MGI:3039624 Tstd2 "thiosulfate sulfurtransferase (rhodanese)-like domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310893 Tstd2 "thiosulfate sulfurtransferase (rhodanese)-like domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T7W7 TSTD2 "Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q81S00 BAS1744 "UPF0176 protein BA_1881/GBAA_1881/BAS1744" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1881 BA_1881 "rhodanese-like domain protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q47UT5 CPS_4798 "UPF0176 protein CPS_4798" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4798 CPS_4798 "rhodanese domain protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BYQ3 HNE_2710 "UPF0176 protein HNE_2710" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037029001
SubName- Full=Chromosome chr17 scaffold_85, whole genome shotgun sequence; (439 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00031553001
SubName- Full=Chromosome chr12 scaffold_57, whole genome shotgun sequence; (213 aa)
      • 0.415

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
PRK00142314 PRK00142, PRK00142, putative rhodanese-related sul 2e-51
cd01518101 cd01518, RHOD_YceA, Member of the Rhodanese Homolo 2e-43
COG1054308 COG1054, COG1054, Predicted sulfurtransferase [Gen 3e-41
PRK01415247 PRK01415, PRK01415, hypothetical protein; Validate 2e-18
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 1e-16
PRK05320257 PRK05320, PRK05320, rhodanese superfamily protein; 3e-15
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 1e-13
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 4e-11
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 2e-08
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 1e-07
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 3e-06
cd01528101 cd01528, RHOD_2, Member of the Rhodanese Homology 8e-05
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 1e-04
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 2e-04
cd0144496 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and 4e-04
>gnl|CDD|234663 PRK00142, PRK00142, putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information 
 Score =  169 bits (430), Expect = 2e-51
 Identities = 71/220 (32%), Positives = 105/220 (47%), Gaps = 42/220 (19%)

Query: 6   LAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSF 65
           L P E    L+             + D + +D+RN YE++IGHF  A  PD++ FR    
Sbjct: 114 LKPKEVNELLD-------------DPDVVFIDMRNDYEYEIGHFENAIEPDIETFREFPP 160

Query: 66  GLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLE 125
            + +          D  K+K  ++MYCTGGIRC+  S  ++  GF  +Y L+GG+  Y E
Sbjct: 161 WVEENL--------DPLKDK-KVVMYCTGGIRCEKASAWMKHEGFKEVYQLEGGIITYGE 211

Query: 126 NEGPVE--WVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELR 183
           +       W G L+VFD R+++P        +++   IG         C+ C +     R
Sbjct: 212 DPETQGLLWDGKLYVFDERMAVP--------INDEVPIGH--------CHQCGTP--CDR 253

Query: 184 HRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPV 223
           + NCAN  CNLL L C +C +   GCC   C   P+ R V
Sbjct: 254 YVNCANPACNLLILQCEECEEKYLGCCSEECCEHPRNRYV 293

Length = 314
>gnl|CDD|238776 cd01518, RHOD_YceA, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|223982 COG1054, COG1054, Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|167229 PRK01415, PRK01415, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|235405 PRK05320, PRK05320, rhodanese superfamily protein; Provisional Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 247
COG1054308 Predicted sulfurtransferase [General function pred 100.0
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 100.0
PRK05320257 rhodanese superfamily protein; Provisional 100.0
PRK01415247 hypothetical protein; Validated 99.97
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.86
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.81
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.81
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.8
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.8
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.8
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.79
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.78
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.78
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.78
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.78
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.78
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.78
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.78
PLN02160136 thiosulfate sulfurtransferase 99.78
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.77
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.77
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.76
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.75
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.75
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.75
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.75
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.74
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.73
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.72
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.7
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.69
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.69
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.67
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.67
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.66
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.65
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.65
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.64
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.64
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.62
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.61
PRK07411390 hypothetical protein; Validated 99.6
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.6
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.58
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.58
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.58
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.51
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.51
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.5
PRK11784345 tRNA 2-selenouridine synthase; Provisional 99.49
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.46
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.45
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.45
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.43
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.16
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.1
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 98.95
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.73
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.31
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.29
COG2603334 Predicted ATPase [General function prediction only 95.46
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 94.47
KOG1093725 consensus Predicted protein kinase (contains TBC a 91.55
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 88.63
KOG1717343 consensus Dual specificity phosphatase [Defense me 88.03
PF11494105 Ta0938: Ta0938; InterPro: IPR021585 Ta0938 is a pr 81.89
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=5.2e-47  Score=333.59  Aligned_cols=173  Identities=39%  Similarity=0.806  Sum_probs=150.3

Q ss_pred             CCCCCHHHHHHHhhcCCchhhhhcccCCCCeEEEEcCCchhhhcccCCCcccCCccccccccCCcchhhhhccCCccCCC
Q 025834            3 AIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLD   82 (247)
Q Consensus         3 a~~Lsp~e~~~~l~~~~~~~l~~~~~~~~~~vvIDvRn~~E~~~GhipGAi~i~~~~~~~~~~~~~~~~~~~~~~l~~l~   82 (247)
                      +++|+|++|+++|.+             ++++|||+||.|||++|||.||++|++.+|++||.|....       .+. -
T Consensus       112 G~yl~p~~wn~~l~D-------------~~~vviDtRN~YE~~iG~F~gAv~p~~~tFrefP~~v~~~-------~~~-~  170 (308)
T COG1054         112 GTYLSPKDWNELLSD-------------PDVVVIDTRNDYEVAIGHFEGAVEPDIETFREFPAWVEEN-------LDL-L  170 (308)
T ss_pred             cCccCHHHHHHHhcC-------------CCeEEEEcCcceeEeeeeecCccCCChhhhhhhHHHHHHH-------HHh-c
Confidence            689999999999997             8899999999999999999999999999999998544321       111 2


Q ss_pred             CCCceEEEEeCCCchHHHHHHHHHHcCCCcEEEccchHHHHHHCcCC--ceeecceeEEeeeeecCCCCCCCchhhhhhh
Q 025834           83 KEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGP--VEWVGNLFVFDSRLSLPPSAYKPDAVSEARM  160 (247)
Q Consensus        83 k~~~~Iv~YCtgG~R~e~aa~~L~~~Gf~nV~~L~GGi~~w~~~g~~--~~~~G~~fvFD~R~~~~~~~~~~~~~~~~~~  160 (247)
                      ++ |+|+||||||||||++++||+..||++||+|+|||..|.++.+.  ..|+|+|||||+||+|+++..+++       
T Consensus       171 ~~-KkVvmyCTGGIRCEKas~~m~~~GF~eVyhL~GGIl~Y~e~~~~~g~lw~G~cFVFDeRvav~~~l~~~~-------  242 (308)
T COG1054         171 KD-KKVVMYCTGGIRCEKASAWMKENGFKEVYHLEGGILKYLEDVGTEGSLWDGKCFVFDERVAVPIGLVEGD-------  242 (308)
T ss_pred             cC-CcEEEEcCCceeehhhHHHHHHhcchhhhcccchHHHHhhhcCccCceeccceeEecceecccCcccCCC-------
Confidence            33 36999999999999999999999999999999999999997655  359999999999999998864321       


Q ss_pred             cCCCCCCCccccccCCCcccccccccCCCCCCCceEEechhhhhccCCCCCccccccccCCCCC
Q 025834          161 IGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVL  224 (247)
Q Consensus       161 ~~~~~~~~~~~C~~C~~~~~~~~~~nc~~~~C~~~~~~c~~c~~~~~~~c~~~c~~~~~~~~~~  224 (247)
                              +       .|+     .||+|+.|+.++++|+.|..++.++|+++|.+++++|+..
T Consensus       243 --------~-------~~C-----~~C~~p~~~~~~~~~~~~~~~~~~~C~~ec~~~~~~r~~e  286 (308)
T COG1054         243 --------H-------TPC-----DNCRNPLCNLLFISCEYCEGKYCGCCSDECSEEPRLRYEE  286 (308)
T ss_pred             --------c-------chh-----hhcCCCCCHHHhhcchhhhcccCCCccHHHhhhhhhHHHH
Confidence                    2       222     2899999999999999999999999999999999999765

>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PF11494 Ta0938: Ta0938; InterPro: IPR021585 Ta0938 is a protein of unknown function however the structure has been determined Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
4f67_A265 Three Dimensional Structure Of The Double Mutant Of 3e-15
1qxn_A137 Solution Structure Of The 30 Kda Polysulfide-Sulfur 3e-04
>pdb|4F67|A Chain A, Three Dimensional Structure Of The Double Mutant Of Upf0176 Protein Lpg2838 From Legionella Pneumophila At The Resolution 1.8a, Northeast Structural Genomics Consortium (Nesg) Target Lgr82 Length = 265 Back     alignment and structure 
Iteration: 1

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 72/142 (50%), Gaps = 24/142 (16%)
Query: 6   LAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSF 65
           L+P EW   ++             + + ILLD RN YE+++G F  A  PD++ FR    
Sbjct: 124 LSPEEWHQFIQ-------------DPNVILLDTRNDYEYELGTFKNAINPDIENFREFP- 169
Query: 66  GLSQREAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLE 125
              QR          +DK+   I  +CTGGIRC+  +   ++ GF ++Y L  G+ +YLE
Sbjct: 170 DYVQRNL--------IDKKDKKIAXFCTGGIRCEKTTAYXKELGFEHVYQLHDGILNYLE 221
Query: 126 N--EGPVEWVGNLFVFDSRLSL 145
           +  E    W G  FVFD R+++
Sbjct: 222 SIPESESLWEGKCFVFDDRVAV 243
>pdb|1QXN|A Chain A, Solution Structure Of The 30 Kda Polysulfide-Sulfur Transferase Homodimer From Wolinella Succinogenes Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 2e-33
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 2e-15
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 4e-15
1tq1_A129 AT5G66040, senescence-associated family protein; C 2e-14
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 2e-13
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 2e-12
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 2e-12
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 2e-12
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 7e-12
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 2e-11
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 5e-11
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 1e-10
3foj_A100 Uncharacterized protein; protein SSP1007, structur 2e-10
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 2e-10
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 4e-10
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-08
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-05
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-04
3r2u_A466 Metallo-beta-lactamase family protein; structural 5e-10
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 2e-09
1vee_A134 Proline-rich protein family; hypothetical protein, 2e-09
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 3e-09
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 5e-09
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 4e-08
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 4e-08
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 7e-08
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 8e-08
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 1e-07
2jtq_A85 Phage shock protein E; solution structure rhodanes 2e-07
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 2e-06
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 2e-06
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 1e-05
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 2e-05
3op3_A216 M-phase inducer phosphatase 3; structural genomics 1e-04
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 2e-04
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Length = 265 Back     alignment and structure
 Score =  120 bits (303), Expect = 2e-33
 Identities = 47/144 (32%), Positives = 72/144 (50%), Gaps = 28/144 (19%)

Query: 6   LAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSF 65
           L+P EW   ++             + + ILLD RN YE+++G F  A  PD++ FR    
Sbjct: 124 LSPEEWHQFIQ-------------DPNVILLDTRNDYEYELGTFKNAINPDIENFR---- 166

Query: 66  GLSQREAF--ASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHY 123
                  F           K+K  I M+CTGGIRC+  +  +++ GF ++Y L  G+ +Y
Sbjct: 167 ------EFPDYVQRNLIDKKDKK-IAMFCTGGIRCEKTTAYMKELGFEHVYQLHDGILNY 219

Query: 124 LENEGPVE--WVGNLFVFDSRLSL 145
           LE+    E  W G  FVFD R+++
Sbjct: 220 LESIPESESLWEGKCFVFDDRVAV 243
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.95
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.89
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.89
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.88
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.86
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.86
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.86
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.86
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.85
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.85
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.85
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.84
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.84
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.84
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.83
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.81
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.79
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.79
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.77
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.77
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.76
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.75
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.75
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.75
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.75
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.75
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.75
1vee_A134 Proline-rich protein family; hypothetical protein, 99.75
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.74
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.74
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.73
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.73
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.73
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.72
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.71
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.71
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.71
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.7
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.69
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.69
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.68
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.68
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.68
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.68
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.67
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.67
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.66
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.65
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.63
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.63
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.63
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.63
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.62
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.62
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.61
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.52
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.52
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.52
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.51
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.51
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.43
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.39
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.39
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.07
2f46_A156 Hypothetical protein; structural genomics, joint c 97.04
1v8c_A168 MOAD related protein; riken structural genomics/pr 93.93
2fqh_A109 Hypothetical protein TA0938; structural genomics, 84.46
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
Probab=99.95  E-value=2.2e-29  Score=222.16  Aligned_cols=125  Identities=37%  Similarity=0.729  Sum_probs=104.8

Q ss_pred             CCCCCHHHHHHHhhcCCchhhhhcccCCCCeEEEEcCCchhhhcccCCCcccCCccccccccCCcchhhhhccCCccCCC
Q 025834            3 AIPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLD   82 (247)
Q Consensus         3 a~~Lsp~e~~~~l~~~~~~~l~~~~~~~~~~vvIDvRn~~E~~~GhipGAi~i~~~~~~~~~~~~~~~~~~~~~~l~~l~   82 (247)
                      .+.|+|++|.+++.+             ++++|||||+++||+.||||||+|+|+..|++++.+.     ..  .+ ..+
T Consensus       121 ~~~Is~~el~~ll~~-------------~~~vlIDVR~~~Ey~~GHIpGAiniP~~~~~~~~~~l-----~~--~l-~~~  179 (265)
T 4f67_A          121 GTYLSPEEWHQFIQD-------------PNVILLDTRNDYEYELGTFKNAINPDIENFREFPDYV-----QR--NL-IDK  179 (265)
T ss_dssp             TCEECHHHHHHHTTC-------------TTSEEEECSCHHHHHHEEETTCBCCCCSSGGGHHHHH-----HH--HT-GGG
T ss_pred             CceECHHHHHHHhcC-------------CCeEEEEeCCchHhhcCcCCCCEeCCHHHHHhhHHHH-----HH--hh-hhC
Confidence            467889999988875             6899999999999999999999999999887643111     00  01 124


Q ss_pred             CCCceEEEEeCCCchHHHHHHHHHHcCCCcEEEccchHHHHHHCcCC--ceeecceeEEeeeeecCCCC
Q 025834           83 KEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGP--VEWVGNLFVFDSRLSLPPSA  149 (247)
Q Consensus        83 k~~~~Iv~YCtgG~R~e~aa~~L~~~Gf~nV~~L~GGi~~w~~~g~~--~~~~G~~fvFD~R~~~~~~~  149 (247)
                      +++ +||+||++|+||++++++|++.||++|++|+|||.+|.++..+  ..|+|+|||||+|++|+++.
T Consensus       180 kdk-~IVvyC~~G~RS~~Aa~~L~~~Gf~nV~~L~GGi~aW~~~~~~~~~~w~G~~fVFD~R~~~~~~l  247 (265)
T 4f67_A          180 KDK-KIAMFCTGGIRCEKTTAYMKELGFEHVYQLHDGILNYLESIPESESLWEGKCFVFDDRVAVDQKL  247 (265)
T ss_dssp             TTS-CEEEECSSSHHHHHHHHHHHHHTCSSEEEETTHHHHHHHHSCTTTCCEEECEECSSTTCEECTTS
T ss_pred             CCC-eEEEEeCCChHHHHHHHHHHHcCCCCEEEecCHHHHHHHhcCcccccccCcceeEcCccccccCH
Confidence            444 7999999999999999999999999999999999999987654  47999999999999999765
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>2fqh_A Hypothetical protein TA0938; structural genomics, Zn-binding,, ontario centre for structural proteomics, OCSP, unknown function; NMR {Thermoplasma acidophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 247
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 1e-13
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 1e-10
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 5e-10
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 3e-08
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 3e-08
d1yt8a2101 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P 3e-07
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 9e-07
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 2e-05
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 3e-05
d1uara1143 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther 6e-05
d1yt8a3157 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase 2e-04
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 0.001
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 0.002
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 0.004
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 63.3 bits (153), Expect = 1e-13
 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 3/103 (2%)

Query: 29  LNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDKEKTDI 88
           L      LDVR   E+  GH  GA         ++    S+   F     +   +   +I
Sbjct: 19  LLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGM--SKNTDFLEQVSSHFGQSD-NI 75

Query: 89  LMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVE 131
           ++ C  G R    +T L   GF  +  + GG S + +N  P +
Sbjct: 76  IVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 118
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.86
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.86
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.85
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.83
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.83
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.82
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.8
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.8
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.78
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.77
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.76
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.74
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.73
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.64
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.62
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.53
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.46
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 85.22
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 83.47
d1jf8a_130 Arsenate reductase ArsC {Staphylococcus aureus [Ta 82.37
d1jl3a_137 Arsenate reductase ArsC {Bacillus subtilis [TaxId: 81.12
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Sulfurtransferase GlpE
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=9.8e-23  Score=154.45  Aligned_cols=98  Identities=20%  Similarity=0.384  Sum_probs=84.6

Q ss_pred             CCCCHHHHHHHhhcCCchhhhhcccCCCCeEEEEcCCchhhhcccCCCcccCCccccccccCCcchhhhhccCCccCCCC
Q 025834            4 IPLAPSEWRNKLEAGKDIDKASNSDLNRDFILLDVRNGYEWDIGHFHGARRPDVDCFRSTSFGLSQREAFASDPLADLDK   83 (247)
Q Consensus         4 ~~Lsp~e~~~~l~~~~~~~l~~~~~~~~~~vvIDvRn~~E~~~GhipGAi~i~~~~~~~~~~~~~~~~~~~~~~l~~l~k   83 (247)
                      ..||++++.+++++             ++++|||||++.||..||||||+|+|.+.|...              +..+++
T Consensus         5 ~~Is~~e~~~~l~~-------------~~~~liDvR~~~e~~~ghI~gA~~ip~~~l~~~--------------~~~~~~   57 (108)
T d1gmxa_           5 ECINVADAHQKLQE-------------KEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAF--------------MRDNDF   57 (108)
T ss_dssp             EEECHHHHHHHHHT-------------TCCEEEECSCHHHHHHCEETTCEECCHHHHHHH--------------HHHSCT
T ss_pred             CEeCHHHHHHHHHC-------------CCeEEEECCCHHHHHhcCCCCcccccchhHHHH--------------hhhccc
Confidence            56899999999986             689999999999999999999999998877421              123456


Q ss_pred             CCceEEEEeCCCchHHHHHHHHHHcCCCcEEEccchHHHHHHCcCCc
Q 025834           84 EKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPV  130 (247)
Q Consensus        84 ~~~~Iv~YCtgG~R~e~aa~~L~~~Gf~nV~~L~GGi~~w~~~g~~~  130 (247)
                      ++ +||+||.+|.|+..++.+|++.||+||++|+||+.+|.++ +|.
T Consensus        58 ~~-~ivv~c~~g~rs~~~a~~L~~~G~~~v~~l~GG~~~W~~~-~p~  102 (108)
T d1gmxa_          58 DT-PVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQ-FPA  102 (108)
T ss_dssp             TS-CEEEECSSSSHHHHHHHHHHHHTCSSEEEETTHHHHHHHH-CGG
T ss_pred             cC-cccccCCCChHHHHHHHHHHHcCCCCEEEEcChHHHHHHc-CCC
Confidence            54 7999999999999999999999999999999999999755 554
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1jf8a_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure