Citrus Sinensis ID: 025999

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MQSFLRQSRVSINSRSWDDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH
ccccccccccccEEEcccccccEEEEEcccccccccEEEEEEEEEEcccccccccccccccEEEEEEcccccccccccEEEEEEEEEEcccccEEEEccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEcccccccEEEEccccEEccHHHHHcccccccccHHHHHHHHcccc
cccEEEcccccEEEEcccccccEEEEEccccccccccHEEEcccccccccHHHHHHHHHccccccccEEEEEEcccccEEEEEEEEEEccccEEEEcccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccEEEEEccccEEEcHHHHHHcccccccHHHHHHEEEEHcc
mqsflrqsrvsinsrswddgtgrafvvgarGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIerllptgtsltvvgeavkddigtvriqrphkgpfyvspkTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAAVKrseqdnegtngqaengsdgtqrdrvmpDLCVICLEqeynavfvpcghmccciicswhltncplcrrRIDQVVRTFRH
mqsflrqsrvsinsrswddgtgRAFVVGARGATGFVLTVGsevfeesgrslvRGTLDYLQGLKMLGVKRIErllptgtsltvvgeavkddigtvriqrphkgpfyvspktIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAavkrseqdnegtngqaengsdgtqrdrVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH
MQSFLRQSRVSINSRSWDDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH
****************WDDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAA**************************VMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRT***
********RVSINSRSWDDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVG*****************GPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWE***************************************DLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH
**********SINSRSWDDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAA**********************QRDRVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH
*QSFLRQSRVSINSRSWDDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAAVKR************************MPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSFLRQSRVSINSRSWDDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQRKRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
Q6NTT6353 Mitochondrial ubiquitin l N/A no 0.763 0.529 0.291 4e-16
Q969V5352 Mitochondrial ubiquitin l yes no 0.910 0.633 0.276 4e-15
Q4R7G8352 Mitochondrial ubiquitin l N/A no 0.910 0.633 0.276 5e-15
Q5M7X9341 Mitochondrial ubiquitin l yes no 0.840 0.604 0.287 5e-15
Q8VCM5352 Mitochondrial ubiquitin l yes no 0.918 0.639 0.270 3e-13
Q557E7665 E3 ubiquitin-protein liga yes no 0.244 0.090 0.424 6e-12
Q7XI08513 Probable E3 ubiquitin-pro no no 0.322 0.153 0.329 5e-09
D3ZDI6445 E3 ubiquitin-protein liga no no 0.191 0.105 0.446 1e-08
Q8WY64445 E3 ubiquitin-protein liga no no 0.191 0.105 0.446 1e-08
Q6TEM9472 E3 ubiquitin-protein liga no no 0.232 0.120 0.363 2e-08
>sp|Q6NTT6|MUL1_XENLA Mitochondrial ubiquitin ligase activator of nfkb 1 OS=Xenopus laevis GN=mul1 PE=2 SV=1 Back     alignment and function desciption
 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 99/209 (47%), Gaps = 22/209 (10%)

Query: 42  EVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHK 101
           E F  + +S       Y+ G +  GV+  E +L  G ++T VGE V D+  T+++Q P  
Sbjct: 158 EKFHPAVQSFSNILGHYMTGERPKGVQETEEMLKIGATITGVGELVLDN-KTIKLQPPKD 216

Query: 102 GP-FYVSPKTIDELIENLGKWARWYKYAS--FGL-TIFGTFLIAKRAIHYILQRKRRWEL 157
           G  FY+S    + L+E      RW++  S  FG+ +    F I +R   +  +++    L
Sbjct: 217 GMLFYLSSMDYEGLLEKQEVQMRWWRILSIVFGVASCITLFFILRRKYRHYKEKQHLKNL 276

Query: 158 HRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCVICLEQEYNAVFVPCGHMC 217
            R    + A +R +Q+               Q    + + C ICL  E + VF+ CGH+C
Sbjct: 277 QREFEESRARQRVQQE--------------PQNKEEVQNPCSICLSTEKSCVFLECGHVC 322

Query: 218 CCIICSWHLTN---CPLCRRRIDQVVRTF 243
            CI C   L +   CP+CR  ID++V  +
Sbjct: 323 SCISCYQALPSPKKCPICRNFIDRIVPLY 351
E3 ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Xenopus laevis (taxid: 8355)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q969V5|MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens GN=MUL1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7G8|MUL1_MACFA Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Macaca fascicularis GN=MUL1 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7X9|MUL1A_DANRE Mitochondrial ubiquitin ligase activator of nfkb 1-A OS=Danio rerio GN=mul1a PE=2 SV=1 Back     alignment and function description
>sp|Q8VCM5|MUL1_MOUSE Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Mus musculus GN=Mul1 PE=2 SV=2 Back     alignment and function description
>sp|Q557E7|CBLA_DICDI E3 ubiquitin-protein ligase cblA OS=Dictyostelium discoideum GN=cblA-1 PE=1 SV=1 Back     alignment and function description
>sp|Q7XI08|XB34_ORYSJ Probable E3 ubiquitin-protein ligase XBOS34 OS=Oryza sativa subsp. japonica GN=XBOS34 PE=2 SV=1 Back     alignment and function description
>sp|D3ZDI6|MYLIP_RAT E3 ubiquitin-protein ligase MYLIP OS=Rattus norvegicus GN=Mylip PE=2 SV=1 Back     alignment and function description
>sp|Q8WY64|MYLIP_HUMAN E3 ubiquitin-protein ligase MYLIP OS=Homo sapiens GN=MYLIP PE=1 SV=2 Back     alignment and function description
>sp|Q6TEM9|MYLIA_DANRE E3 ubiquitin-protein ligase MYLIP-A OS=Danio rerio GN=mylipa PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
118486812238 unknown [Populus trichocarpa] 0.922 0.949 0.833 1e-109
255567656 363 zinc ion binding protein, putative [Rici 0.902 0.608 0.828 1e-107
225436896343 PREDICTED: mitochondrial ubiquitin ligas 0.926 0.661 0.798 1e-107
449436571342 PREDICTED: mitochondrial ubiquitin ligas 0.926 0.663 0.793 1e-106
449515051337 PREDICTED: mitochondrial ubiquitin ligas 0.906 0.658 0.789 1e-104
224131332335 predicted protein [Populus trichocarpa] 0.893 0.653 0.748 5e-97
356500224339 PREDICTED: mitochondrial ubiquitin ligas 0.918 0.663 0.785 3e-96
356535760339 PREDICTED: mitochondrial ubiquitin ligas 0.918 0.663 0.780 3e-96
312283085344 unnamed protein product [Thellungiella h 0.926 0.659 0.754 2e-95
144924893341 Zinc finger, RING-type [Medicago truncat 0.979 0.703 0.707 2e-94
>gi|118486812|gb|ABK95241.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 207/228 (90%), Gaps = 2/228 (0%)

Query: 18  DDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTG 77
           DDGT R +VVGARGA+GFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIER+LPTG
Sbjct: 13  DDGTDRVYVVGARGASGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERVLPTG 72

Query: 78  TSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGT 137
           TSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPK+IDELI NLGKWARWYKYAS GLT+FG 
Sbjct: 73  TSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKSIDELIGNLGKWARWYKYASLGLTVFGA 132

Query: 138 FLIAKRAIHYILQRKRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDL 197
           FLI K  I YI++R+RRWEL  RVLAAA  KRS QDNEG+N +AENGSDG +R+R +PDL
Sbjct: 133 FLITKHVIRYIMERRRRWELQSRVLAAA--KRSGQDNEGSNDKAENGSDGAKRERPIPDL 190

Query: 198 CVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH 245
           CVICLEQEYNAVF+PCGHMCCCI C   L+NCPLCRRRI+QVV+TFRH
Sbjct: 191 CVICLEQEYNAVFLPCGHMCCCITCCSQLSNCPLCRRRIEQVVKTFRH 238

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255567656|ref|XP_002524807.1| zinc ion binding protein, putative [Ricinus communis] gi|223535991|gb|EEF37650.1| zinc ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225436896|ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|296086688|emb|CBI32323.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436571|ref|XP_004136066.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515051|ref|XP_004164563.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224131332|ref|XP_002321058.1| predicted protein [Populus trichocarpa] gi|222861831|gb|EEE99373.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500224|ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356535760|ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|312283085|dbj|BAJ34408.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|144924893|gb|ABE86663.2| Zinc finger, RING-type [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
TAIR|locus:2202882338 ZCF61 [Arabidopsis thaliana (t 0.910 0.659 0.526 3.6e-57
UNIPROTKB|E1BGD5350 MUL1 "Uncharacterized protein" 0.853 0.597 0.324 7.3e-18
UNIPROTKB|H9KZ02285 MUL1 "Uncharacterized protein" 0.857 0.736 0.296 7.5e-18
UNIPROTKB|Q6NTT6353 mul1 "Mitochondrial ubiquitin 0.697 0.484 0.310 1e-17
UNIPROTKB|E2RBI8352 MUL1 "Uncharacterized protein" 0.844 0.588 0.306 1.3e-17
MGI|MGI:1915600352 Mul1 "mitochondrial ubiquitin 0.759 0.528 0.299 1.7e-17
RGD|1309944352 Mul1 "mitochondrial E3 ubiquit 0.857 0.596 0.288 1.1e-16
UNIPROTKB|I3LH19352 MUL1 "Uncharacterized protein" 0.763 0.531 0.290 1.8e-16
UNIPROTKB|Q969V5352 MUL1 "Mitochondrial ubiquitin 0.763 0.531 0.285 5.2e-16
UNIPROTKB|Q4R7G8352 MUL1 "Mitochondrial ubiquitin 0.763 0.531 0.285 5.2e-16
TAIR|locus:2202882 ZCF61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 588 (212.0 bits), Expect = 3.6e-57, P = 3.6e-57
 Identities = 121/230 (52%), Positives = 154/230 (66%)

Query:    18 DDGTGRAFVVGARGATGFVLTVGSEVFEESGR-SLVRGTLDYLQGLKMLGVKRIERLLPT 76
             DDGTGR  V  ++G  G  LTVGS+VFE++   SLV+G L YL+G K+LGV+ +ER++P 
Sbjct:   114 DDGTGRVNVDVSQGELGLALTVGSDVFEKAEPVSLVQGALGYLKGFKILGVRHVERVVPI 173

Query:    77 GTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFG 136
             GT LTVVGEAV+D +G VRIQ+P +GPFYV+   +D+LI  LG  +R +KYAS GLT+ G
Sbjct:   174 GTPLTVVGEAVRDGMGNVRIQKPEQGPFYVTYIPLDQLISKLGDLSRRFKYASMGLTVLG 233

Query:   137 TFLIAKRAIHYILQR-KRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMP 195
               LI+K  I YIL+R +   E  RR  A   +KR   D      +   G  GT RD   P
Sbjct:   234 VILISKPVIEYILKRIEDTLERRRRQFA---LKRVV-DAAARRAKPVTGG-GTSRDGDTP 288

Query:   196 DLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH 245
             DLCV+CL+Q+YN  FV CGHMCCC  CS  L  CPLCR RI QV++ +RH
Sbjct:   289 DLCVVCLDQKYNTAFVECGHMCCCTPCSLQLRTCPLCRERIQQVLKIYRH 338
GO:0005739 "mitochondrion" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
UNIPROTKB|E1BGD5 MUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZ02 MUL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NTT6 mul1 "Mitochondrial ubiquitin ligase activator of nfkb 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBI8 MUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1915600 Mul1 "mitochondrial ubiquitin ligase activator of NFKB 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309944 Mul1 "mitochondrial E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LH19 MUL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q969V5 MUL1 "Mitochondrial ubiquitin ligase activator of NFKB 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7G8 MUL1 "Mitochondrial ubiquitin ligase activator of NFKB 1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023653001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (343 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
pfam12483154 pfam12483, GIDE, E3 Ubiquitin ligase 2e-46
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-15
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-07
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 4e-06
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-06
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 9e-05
smart0018440 smart00184, RING, Ring finger 7e-04
>gnl|CDD|221597 pfam12483, GIDE, E3 Ubiquitin ligase Back     alignment and domain information 
 Score =  151 bits (383), Expect = 2e-46
 Identities = 60/136 (44%), Positives = 76/136 (55%), Gaps = 5/136 (3%)

Query: 6   RQSRVSINSRS--W--DDGTGRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQG 61
           R   V+ N R   +   DGTGR  VV         L    + FE S  SL      +  G
Sbjct: 17  RSELVASNEREVPFYLRDGTGRVLVVMDPSGAEIELVTVLDRFEPSEGSLFSLLFGFFSG 76

Query: 62  LKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKG-PFYVSPKTIDELIENLGK 120
              LG + IER+LP GT LTVVGEAV+D+ GT+RIQ+P KG PF++S K+ +ELIE+L  
Sbjct: 77  DVTLGYRYIERVLPVGTRLTVVGEAVRDEDGTLRIQKPSKGGPFFISTKSEEELIESLAS 136

Query: 121 WARWYKYASFGLTIFG 136
            AR   Y S GL + G
Sbjct: 137 SARTLFYGSIGLGVVG 152

This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length. There is a single completely conserved residue E that may be functionally important. GIDE is an E3 ubiquitin ligase which is involved in inducing apoptosis. Length = 154
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF12483160 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 Thi 99.95
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.37
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.3
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.27
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 99.24
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.08
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.04
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.91
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.66
PHA02929238 N1R/p28-like protein; Provisional 98.59
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.58
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.51
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 98.5
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.49
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.49
PF1463444 zf-RING_5: zinc-RING finger domain 98.42
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.38
PHA02926242 zinc finger-like protein; Provisional 98.35
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.27
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.23
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.21
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.15
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.11
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.09
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.09
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.09
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.92
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.92
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.79
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.76
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.7
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.69
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.67
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.5
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.44
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.41
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.41
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.32
COG5152259 Uncharacterized conserved protein, contains RING a 97.31
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.31
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.68
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.66
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.61
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.58
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.58
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.55
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.25
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.23
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.01
KOG3002 299 consensus Zn finger protein [General function pred 95.53
PF04641260 Rtf2: Rtf2 RING-finger 95.11
KOG0825 1134 consensus PHD Zn-finger protein [General function 94.85
KOG0297 391 consensus TNF receptor-associated factor [Signal t 94.66
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 94.53
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.27
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.96
KOG1002 791 consensus Nucleotide excision repair protein RAD16 93.79
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 93.52
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 93.17
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 93.11
KOG3039303 consensus Uncharacterized conserved protein [Funct 91.72
KOG4445 368 consensus Uncharacterized conserved protein, conta 90.4
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 90.15
KOG2660 331 consensus Locus-specific chromosome binding protei 88.97
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 88.96
COG5222427 Uncharacterized conserved protein, contains RING Z 88.39
KOG2113394 consensus Predicted RNA binding protein, contains 88.02
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 87.99
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 87.13
PF10272358 Tmpp129: Putative transmembrane protein precursor; 87.04
COG5175 480 MOT2 Transcriptional repressor [Transcription] 86.96
COG52191525 Uncharacterized conserved protein, contains RING Z 85.93
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 85.18
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 84.76
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 84.7
KOG3842429 consensus Adaptor protein Pellino [Signal transduc 84.19
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 83.44
KOG149384 consensus Anaphase-promoting complex (APC), subuni 80.94
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 80.36
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7e-41  Score=294.77  Aligned_cols=233  Identities=37%  Similarity=0.629  Sum_probs=205.9

Q ss_pred             ccccc--ccCCcee----EEEecCCCcccceeeeeeEEeecCcc-cccccccccccceeeeceeeeecccCCCceeEEeE
Q 025999           12 INSRS--WDDGTGR----AFVVGARGATGFVLTVGSEVFEESGR-SLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVG   84 (245)
Q Consensus        12 ~~~~~--~~d~~g~----V~V~~~~~a~~~~~~~~~~~f~~~~~-s~~~~~~~~~~g~~~~G~~~~E~~L~~G~~lt~vG   84 (245)
                      .|+.+  +.++++.    |+|..++.+..++++++++.|+|+.+ +++++.++|++|.++.|++++|++||+|+.+|++|
T Consensus       114 ~~~~~~~l~~q~~~~~~~~~~s~~~~~~~l~l~~~~d~f~~s~p~s~~~~~~~~~sg~~~~~~~~~~~~l~~~~~~t~l~  193 (355)
T KOG1571|consen  114 GNEVPFFLRSQTTGFACEVRVSKTLGRLFLPLNVVYDLFEPSDPCSLVDVGGGYHSGVRRGGFRETERVLPLGTRLTALG  193 (355)
T ss_pred             CcccceeeccCCcceeeeeeeecceeeeeecceeeeccccccCcceeeecccccccceeeecccceEEeeccccceeeee
Confidence            34444  5667777    99999999999999999999999996 99999999999999999999999999999999999


Q ss_pred             eEEecCCCCeEEeCCCCCCeEEecCChHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHH
Q 025999           85 EAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIAKRAIHYILQ--RKRRWELHRRVL  162 (245)
Q Consensus        85 e~~~d~~g~~~iq~P~~g~f~ls~~s~~~Li~~l~~~~r~~~~~~i~~~~~g~~ll~~~~~r~~~~--~r~~~~~~~~~~  162 (245)
                      |++.|+.++.++|+|.+|++|++....++||..++++++.+++.+++++++++++|.+...++|.+  ++++.++.+...
T Consensus       194 e~v~d~~~~~r~~~~~~g~~~v~~s~~d~LIsr~g~~s~~~kv~~~~~~~~~~ills~~~~d~~led~r~~r~~l~k~~~  273 (355)
T KOG1571|consen  194 ELVRDGYCGVRVQPPMQGPLYVTKSAADRLISREGDLSFFVKVNGMVFGTLGVILLSFIVKDNYLEDDRRQRRELVKRVE  273 (355)
T ss_pred             hheecCCCceEecCCccCcceeeccchhhHHHhhccceeeeeecceeeeeeeEEeehHHHHHHHHHHHHHHHHHHHHhhh
Confidence            999998899999999999766666669999999999999999999999999999999999999988  777777777666


Q ss_pred             HHHHhhhhhcccCCCCCCCCCCCCCCccCCcccccceeccccccceEEccCCCcccchhhHhccCCCccccccccceeec
Q 025999          163 AAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRT  242 (245)
Q Consensus       163 ~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~~~~~~~v~~pCgH~~~C~~C~~~~~~CPiCR~~i~~~~~i  242 (245)
                      .+++ .+.+....+....-++.+++...+...++.|+||.+++.+++|+||||+|||..|+..++.||+||+.|..++++
T Consensus       274 ~~~~-~rae~~s~g~~gtr~~~~~~~~~~~~~p~lcVVcl~e~~~~~fvpcGh~ccct~cs~~l~~CPvCR~rI~~~~k~  352 (355)
T KOG1571|consen  274 DLAT-VRAELLSRGVRGTRIQNENGTFRELPQPDLCVVCLDEPKSAVFVPCGHVCCCTLCSKHLPQCPVCRQRIRLVRKR  352 (355)
T ss_pred             hhhh-heeeeecccccccccccccCcccccCCCCceEEecCCccceeeecCCcEEEchHHHhhCCCCchhHHHHHHHHHH
Confidence            6666 666655566555545556666666677889999999999999999999999999999999999999999999999


Q ss_pred             ccC
Q 025999          243 FRH  245 (245)
Q Consensus       243 ~~~  245 (245)
                      |+|
T Consensus       353 y~~  355 (355)
T KOG1571|consen  353 YRS  355 (355)
T ss_pred             hcC
Confidence            987

>PF12483 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2yhn_A79 The Idol-Ube2d Complex Mediates Sterol-Dependent De 4e-10
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 6e-08
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 4e-07
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 2e-05
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 2e-05
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 3e-05
2ea5_A68 Solution Structure Of The Ring Domain Of The Human 5e-05
4auq_B62 Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 2e-04
>pdb|2YHN|A Chain A, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 79 Back     alignment and structure 
Iteration: 1

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 9/66 (13%)
Query: 187 GTQRDRVMPD---------LCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRID 237
           G Q+ RV+ +         LC++C E+E N+ F PCGH  CC  C+  L +CP+CR R++
Sbjct: 1   GAQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVE 60
Query: 238 QVVRTF 243
            V   +
Sbjct: 61  HVQHVY 66
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|2EA5|A Chain A, Solution Structure Of The Ring Domain Of The Human Cell Growth Regulator With Ring Finger Domain 1 Protein Length = 68 Back     alignment and structure
>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 3e-22
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 6e-22
2ea5_A68 Cell growth regulator with ring finger domain prot 7e-22
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-19
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 6e-18
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 1e-17
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-09
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 5e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-07
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 4e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 6e-07
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 4e-06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 1e-05
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-05
2ecw_A85 Tripartite motif-containing protein 30; metal bind 3e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 6e-05
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 9e-05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 1e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 1e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-04
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 5e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 7e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 8e-04
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 86.0 bits (213), Expect = 3e-22
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 176 GTNGQAENGSDGTQRDRVMPD--LCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCR 233
           G++G  +      ++ R + +  LC IC+++    VFVPCGH+  C  C+  +  CP+C 
Sbjct: 4   GSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCY 63

Query: 234 RRIDQVVRTF 243
             I    + F
Sbjct: 64  TVITFKQKIF 73
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
2ea5_A68 Cell growth regulator with ring finger domain prot 99.56
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.47
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.42
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.38
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.37
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.31
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.07
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.04
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.02
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.01
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.99
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.94
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.93
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.93
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.93
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.91
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.89
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.89
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.89
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.88
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.87
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.84
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.84
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.82
2ect_A78 Ring finger protein 126; metal binding protein, st 98.81
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.8
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.8
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.79
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.79
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.79
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.78
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.76
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.74
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.74
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.73
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.71
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.71
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.7
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.69
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.68
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.64
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.64
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.63
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.61
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.6
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.58
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.56
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.54
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.53
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.51
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.51
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.49
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.48
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.44
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.38
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.36
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.27
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.23
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.15
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.09
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.04
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.91
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.83
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.67
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.66
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.42
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.98
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.37
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.89
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 88.55
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 85.97
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 85.81
3nw0_A238 Non-structural maintenance of chromosomes element 83.41
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.56  E-value=2.1e-15  Score=104.55  Aligned_cols=54  Identities=28%  Similarity=0.653  Sum_probs=49.2

Q ss_pred             CcccccceeccccccceEEccCCCcccchhhHhccCCCccccccccceeecccC
Q 025999          192 RVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH  245 (245)
Q Consensus       192 ~~~~~~C~iC~~~~~~~v~~pCgH~~~C~~C~~~~~~CPiCR~~i~~~~~i~~~  245 (245)
                      ..+...|+||++++++++++||||+++|..|+..+..||+||++|..++++|.+
T Consensus        12 ~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~~   65 (68)
T 2ea5_A           12 EENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGP   65 (68)
T ss_dssp             CCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCSS
T ss_pred             CCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeecC
Confidence            334568999999999999999999977999999999999999999999999964
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-11
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-11
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-09
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-06
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.002
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 0.002
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.003
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.5 bits (136), Expect = 2e-11
 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 4/48 (8%)

Query: 196 DLCVICLEQEYNAVFVPCGHMCCCIICSWHLTN----CPLCRRRIDQV 239
            LC IC E + +    PCGH+ C    +    +    CP CR  I   
Sbjct: 24  QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGT 71
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.05
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.04
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.92
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.79
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.76
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.7
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.69
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.65
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.64
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.6
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.58
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.41
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.34
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.17
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.15
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.41
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 82.54
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.15  E-value=6e-12  Score=87.86  Aligned_cols=47  Identities=34%  Similarity=0.832  Sum_probs=41.5

Q ss_pred             ccceeccccccceEEccCCCcccchhhHhcc-----CCCccccccccceeecc
Q 025999          196 DLCVICLEQEYNAVFVPCGHMCCCIICSWHL-----TNCPLCRRRIDQVVRTF  243 (245)
Q Consensus       196 ~~C~iC~~~~~~~v~~pCgH~~~C~~C~~~~-----~~CPiCR~~i~~~~~i~  243 (245)
                      ..|.||++...+++++||||.| |..|+..|     .+||+||..|.....+.
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~f-C~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHLM-CTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCEE-CHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCccCCCcCCCeEEeCCCCee-eHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            3699999999999999999998 99999876     47999999998876553
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure