Citrus Sinensis ID: 026004

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MDDEDSWPDFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFRDKQKKSQAKSKSSSKDLKLFIDLCGESISSNEPEMSDKPIGSRISELKELAFEARSSKDDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCCRPTL
cccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEEEEEEEEccccEEEEEEcccccccccccHHHHHccccccccccccccccccccEEEEEEEcccEEEEEcEEEEEEEEcccccccEEEEEEEEEcccccEEEEcccEEEEcccc
cccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccEEcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHcccccccEEEEEEcccccccccEEEHHHHHHHccccccccccEEEccccEEEEEEcccccEEEEEHEHHHHHHHHccccccEEEEEEEEcccccccEccHHHEcccccc
mddedswpdfTLAEIKEMESMYKEIGEASLTQEYCKALATSFsfsasraarpaiTWLQVQSWFrdkqkksqaksksssKDLKLFIDLCgesissnepemsdkpigSRISELKELAFEArsskddawyDVASFLTYRVTCAGELEVRVRfsgfnntedeWVNVKTAvrqrsipleqsecvkvnvgDLVLCYqeredqavycdAHVLDIQRrvhdtegcqcifvvrydhdfseeQVKVERLCCRPTL
mddedswpdfTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVqswfrdkqkksqakskssskdlKLFIDLCGesissnepemsdkpIGSRISELKELAFEARSSKDDAWYDVASFLTYRVTCAGELEVRVRfsgfnntedewvnVKTAvrqrsipleqsecvkvnVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRydhdfseeqvkverlccrptl
MDDEDSWPDFTLAEIKEMESMYKEIGEASLTQEYCKalatsfsfsasraarpaITWLQVQSWFRdkqkksqakskssskdlklFIDLCGESISSNEPEMSDKPIGSRISELKELAFEARSSKDDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCCRPTL
***********LA*I*****MYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFR*****************KLFIDLC**********************************DDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCC****
****DSW*DFTLAEIKEMESMYKE*GEASLTQEYCKALAT*************ITWLQVQSWFR***************************************************FEARSSKDDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCCRP**
MDDEDSWPDFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSW*****************DLKLFIDLCGESISSNEPEMSDKPIGSRISELKELAFEARSSKDDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCCRPTL
******WPDFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFRDKQKKSQ*************************************SELKELAFEARSSKDDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCCR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDEDSWPDFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFRDKQKKSQAKSKSSSKDLKLFIDLCGESISSNEPEMSDKPIGSRISELKELAFEARSSKDDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCCRPTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
255549846285 conserved hypothetical protein [Ricinus 0.959 0.824 0.656 3e-87
224059142239 predicted protein [Populus trichocarpa] 0.959 0.983 0.614 8e-79
225442489247 PREDICTED: uncharacterized protein LOC10 0.963 0.955 0.586 2e-76
147807923266 hypothetical protein VITISV_013721 [Viti 0.918 0.845 0.575 9e-70
145361431258 uncharacterized protein [Arabidopsis tha 0.987 0.937 0.521 4e-68
359475952245 PREDICTED: uncharacterized protein LOC10 0.934 0.934 0.542 4e-67
388501948270 unknown [Medicago truncatula] 0.987 0.896 0.520 4e-66
297844426276 hypothetical protein ARALYDRAFT_334813 [ 0.938 0.833 0.508 1e-63
79317986252 uncharacterized protein [Arabidopsis tha 0.938 0.912 0.523 1e-63
449480632279 PREDICTED: uncharacterized protein LOC10 0.963 0.845 0.483 5e-63
>gi|255549846|ref|XP_002515974.1| conserved hypothetical protein [Ricinus communis] gi|223544879|gb|EEF46394.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 155/236 (65%), Positives = 189/236 (80%), Gaps = 1/236 (0%)

Query: 9   DFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFRDKQK 68
           +FTLAE+ EME++YKE+GE SL  E+C+ LATSFSF+A+RA +PAITW QVQSWF D+QK
Sbjct: 50  EFTLAEMVEMENIYKELGEESLDSEFCERLATSFSFTANRAGKPAITWEQVQSWFEDRQK 109

Query: 69  KSQAKSKSSSKDLKLFIDLCGESISSNEPEMSDKPIGSRISELKELAFEARSSKDDAWYD 128
           +S+ +   S   LKLF+DL    ISS+ PE S    G ++++L EL FEARSS+D+AWYD
Sbjct: 110 ESRPRVSPSPLSLKLFVDLSNAKISSDAPESSRNSKG-KVTDLSELIFEARSSRDNAWYD 168

Query: 129 VASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVL 188
           VA+FL YRV   GELE RVRFSGF NT+DEWVNVK AVR+RSIPLE SEC +V VGDLVL
Sbjct: 169 VAAFLNYRVLSTGELEARVRFSGFRNTDDEWVNVKRAVRERSIPLEPSECHRVKVGDLVL 228

Query: 189 CYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEEQVKVERLCCRPT 244
           C++ER DQAVYCDAHV+ IQRR H+   C+CIFVVRYDHD +EE  ++ERLCCRPT
Sbjct: 229 CFRERFDQAVYCDAHVVGIQRRPHEAASCRCIFVVRYDHDNTEEAAQLERLCCRPT 284

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224059142|ref|XP_002299736.1| predicted protein [Populus trichocarpa] gi|222846994|gb|EEE84541.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442489|ref|XP_002283948.1| PREDICTED: uncharacterized protein LOC100258357 [Vitis vinifera] gi|297743205|emb|CBI36072.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147807923|emb|CAN77675.1| hypothetical protein VITISV_013721 [Vitis vinifera] Back     alignment and taxonomy information
>gi|145361431|ref|NP_849666.2| uncharacterized protein [Arabidopsis thaliana] gi|5103848|gb|AAD39678.1|AC007591_43 F9L1.16 [Arabidopsis thaliana] gi|332191165|gb|AEE29286.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359475952|ref|XP_002277697.2| PREDICTED: uncharacterized protein LOC100245843 [Vitis vinifera] gi|296081562|emb|CBI20567.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388501948|gb|AFK39040.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297844426|ref|XP_002890094.1| hypothetical protein ARALYDRAFT_334813 [Arabidopsis lyrata subsp. lyrata] gi|297335936|gb|EFH66353.1| hypothetical protein ARALYDRAFT_334813 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79317986|ref|NP_001031048.1| uncharacterized protein [Arabidopsis thaliana] gi|332191167|gb|AEE29288.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449480632|ref|XP_004155951.1| PREDICTED: uncharacterized protein LOC101230634 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
TAIR|locus:1005716727258 SHH1 "AT1G15215" [Arabidopsis 0.987 0.937 0.478 1.1e-57
TAIR|locus:2095077349 SHH2 "SAWADEE homeodomain homo 0.620 0.435 0.531 2.5e-41
TAIR|locus:1005716727 SHH1 "AT1G15215" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 593 (213.8 bits), Expect = 1.1e-57, P = 1.1e-57
 Identities = 120/251 (47%), Positives = 161/251 (64%)

Query:     2 DDEDSWPDFTLAEIKEMESMYKEIGEASLTQEYCKXXXXXXXXXXXXXXXXXITWLQVQS 61
             D    + +FTL+EI +ME++YKE+G+ SL +++C+                 ITW QVQ 
Sbjct:     6 DSSHYFTEFTLSEIVDMENLYKELGDQSLHKDFCQTVASTFSCSVNRNGKSSITWKQVQI 65

Query:    62 WFRXXXXXXXXXXXXXXXXXXXFI-DLCGESI----SSNEPEMSDKPI----GSRISELK 112
             WF+                    I DL   S     +SN   + +         + S+L 
Sbjct:    66 WFQEKLKHQSQPKSKTLPSPPLQIHDLSNPSSYASNASNATFVGNSTFVQTRKGKASDLA 125

Query:   113 ELAFEARSSKDDAWYDVASFLTYRVTCAGELEVRVRFSGFNNTEDEWVNVKTAVRQRSIP 172
             +LAFEA+S++D AWYDV+SFLTYRV   GELEVRVRFSGF+N  DEWVNVKT+VR+RSIP
Sbjct:   126 DLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGFDNRHDEWVNVKTSVRERSIP 185

Query:   173 LEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQRRVHDTEGCQCIFVVRYDHDFSEE 232
             +E SEC +VNVGDL+LC+QEREDQA+YCD HVL+I+R +HD   C C+F+VRY+ D +EE
Sbjct:   186 VEPSECGRVNVGDLLLCFQEREDQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEE 245

Query:   233 QVKVERLCCRP 243
              + +ER+C RP
Sbjct:   246 SLGLERICRRP 256
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0006306 "DNA methylation" evidence=IMP
GO:0006346 "methylation-dependent chromatin silencing" evidence=IMP
GO:0033562 "cotranscriptional gene silencing by small RNA" evidence=IMP
TAIR|locus:2095077 SHH2 "SAWADEE homeodomain homolog 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_I0553
hypothetical protein (239 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
KOG0489261 consensus Transcription factor zerknullt and relat 99.63
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.58
KOG0488309 consensus Transcription factor BarH and related HO 99.55
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.51
KOG0843197 consensus Transcription factor EMX1 and related HO 99.46
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.44
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.43
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.37
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.36
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.32
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.3
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.3
KOG0493342 consensus Transcription factor Engrailed, contains 99.29
KOG0850245 consensus Transcription factor DLX and related pro 99.25
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.24
KOG0494332 consensus Transcription factor CHX10 and related H 99.2
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.19
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.15
KOG0848317 consensus Transcription factor Caudal, contains HO 99.15
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.12
KOG0847288 consensus Transcription factor, contains HOX domai 98.98
COG5576156 Homeodomain-containing transcription factor [Trans 98.85
KOG0490235 consensus Transcription factor, contains HOX domai 98.83
KOG0486351 consensus Transcription factor PTX1, contains HOX 98.78
KOG4577383 consensus Transcription factor LIM3, contains LIM 98.34
KOG0775304 consensus Transcription factor SIX and related HOX 98.23
KOG0849354 consensus Transcription factor PRD and related pro 98.2
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.04
KOG3802398 consensus Transcription factor OCT-1, contains POU 97.23
KOG0774334 consensus Transcription factor PBX and related HOX 96.97
KOG0490235 consensus Transcription factor, contains HOX domai 96.82
KOG2252558 consensus CCAAT displacement protein and related h 96.62
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 95.68
PF15057124 DUF4537: Domain of unknown function (DUF4537) 95.63
cd0002455 CHROMO Chromatin organization modifier (chromo) do 93.06
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 92.8
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 92.7
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 92.0
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 91.72
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 91.51
KOG0773342 consensus Transcription factor MEIS1 and related H 91.35
KOG1146 1406 consensus Homeobox protein [General function predi 91.16
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 88.75
smart0029855 CHROMO Chromatin organization modifier domain. 87.74
PF0282073 MBT: mbt repeat; InterPro: IPR004092 The function 87.0
PLN00104 450 MYST -like histone acetyltransferase; Provisional 86.79
smart0074361 Agenet Tudor-like domain present in plant sequence 86.48
PF12824164 MRP-L20: Mitochondrial ribosomal protein subunit L 84.83
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 84.68
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 84.53
PF1214885 DUF3590: Protein of unknown function (DUF3590); In 83.16
smart0074361 Agenet Tudor-like domain present in plant sequence 82.49
PF1214885 DUF3590: Protein of unknown function (DUF3590); In 81.75
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information 
Probab=99.63  E-value=9e-17  Score=144.91  Aligned_cols=56  Identities=20%  Similarity=0.375  Sum_probs=52.0

Q ss_pred             cCCCCHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHcCCCcccCCCCcCCcchhhhhhhcccccccccc
Q 026004            7 WPDFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFRDKQKKSQAKS   74 (245)
Q Consensus         7 ~~~FT~~Ql~eMEk~f~~~~~~y~~~~~rq~LA~~f~lS~~r~Gk~~v~~~QVk~WFQNRR~k~k~k~   74 (245)
                      =+.||..|+.||||+|+.  |+||++..|.+||..|+|+|          +||||||||||||||...
T Consensus       163 RtayT~~QllELEkEFhf--N~YLtR~RRiEiA~~L~LtE----------rQIKIWFQNRRMK~Kk~~  218 (261)
T KOG0489|consen  163 RTAFTRYQLLELEKEFHF--NKYLTRSRRIEIAHALNLTE----------RQIKIWFQNRRMKWKKEN  218 (261)
T ss_pred             Ccccchhhhhhhhhhhcc--ccccchHHHHHHHhhcchhH----------HHHHHHHHHHHHHHHHhh
Confidence            367999999999999999  59999999999999999988          999999999999998443

>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>PF02820 MBT: mbt repeat; InterPro: IPR004092 The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>PF12824 MRP-L20: Mitochondrial ribosomal protein subunit L20; InterPro: IPR024388 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>PF12148 DUF3590: Protein of unknown function (DUF3590); InterPro: IPR021991 This domain is found in eukaryotes, and is typically between 83 and 97 amino acids in length Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>PF12148 DUF3590: Protein of unknown function (DUF3590); InterPro: IPR021991 This domain is found in eukaryotes, and is typically between 83 and 97 amino acids in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 45.2 bits (106), Expect = 9e-06
 Identities = 43/287 (14%), Positives = 98/287 (34%), Gaps = 75/287 (26%)

Query: 9   DFTLAEIKEMESMYKEIGEASL-----------TQEYCKALATSFSFSASRAARPAITWL 57
           DF   E  E +  YK+I                 Q+  K++ +         ++ A++  
Sbjct: 8   DF---ETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGT 64

Query: 58  QVQSW-FRDKQKKS--------------------QAKSKSSSKDLKLFIDLCGESISSNE 96
               W    KQ++                     + + +  S   +++I+   + + ++ 
Sbjct: 65  LRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIE-QRDRLYNDN 123

Query: 97  PEMSDKPIGSR---ISELKELAFEARSSKDDAWYDVA----SFLTYRVTCAGELEVRVRF 149
              +   + SR     +L++   E R +K+     V     +++   V  + +++ ++ F
Sbjct: 124 QVFAKYNV-SRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDF 182

Query: 150 SGFNNTEDEWVNVKTAVRQRSIPLEQSECVKVNVGDLVLCYQEREDQAVYCDAHVLDIQR 209
             F      W+N+K      ++ LE  +          L YQ   +     D H  +I+ 
Sbjct: 183 KIF------WLNLKNCNSPETV-LEMLQ---------KLLYQIDPNWTSRSD-HSSNIKL 225

Query: 210 RVHDTEG-----------CQCIFVVRYDHDFSEEQVKVERLCCRPTL 245
           R+H  +              C+ V+   +  + +      L C+  L
Sbjct: 226 RIHSIQAELRRLLKSKPYENCLLVL--LNVQNAKAWNAFNLSCK-IL 269
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.66
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.65
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.64
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.63
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.63
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.63
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.62
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.62
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.62
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.62
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.62
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.61
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.61
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.61
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.61
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.6
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.6
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.6
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.6
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.59
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.59
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.59
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.59
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.59
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.59
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.59
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.58
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.58
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.58
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.58
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.58
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.57
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.57
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.57
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.57
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.57
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.57
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.57
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.57
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.57
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.57
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.56
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.56
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.56
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.56
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.55
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.55
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.55
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.55
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.55
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.54
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.54
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.52
2e19_A64 Transcription factor 8; homeobox domain, structura 99.52
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.52
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.51
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.51
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.5
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.5
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.48
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.48
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.44
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.43
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.43
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.43
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.42
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.42
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.41
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.4
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.39
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.37
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.33
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.2
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.1
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.07
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.07
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.67
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.29
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 97.27
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 96.25
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 95.98
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 94.92
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 94.92
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 94.54
3s6w_A54 Tudor domain-containing protein 3; methylated argi 94.25
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 93.82
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 93.75
2lcc_A76 AT-rich interactive domain-containing protein 4A; 93.67
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 93.39
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 93.39
2diq_A110 Tudor and KH domain-containing protein; tudor doma 93.29
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 93.13
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 93.12
2bud_A92 Males-absent on the first protein; transferase, MO 93.07
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 93.03
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 92.74
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 92.71
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 92.67
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 92.63
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 92.62
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 92.6
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 92.52
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 92.43
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 92.19
3sd4_A69 PHD finger protein 20; tudor domain, transcription 92.12
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 91.82
3s6w_A54 Tudor domain-containing protein 3; methylated argi 91.67
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 91.57
2d9t_A78 Tudor domain-containing protein 3; structural geno 91.5
2d9t_A78 Tudor domain-containing protein 3; structural geno 90.44
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 90.35
3qii_A85 PHD finger protein 20; tudor domain, structural ge 90.07
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 89.7
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 89.35
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 88.93
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 88.73
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 88.0
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 87.21
1pfb_A55 Polycomb protein; chromatin, histone methylation, 87.14
2lcc_A76 AT-rich interactive domain-containing protein 4A; 86.53
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 86.31
3h91_A54 Chromobox protein homolog 2; human chromobox homol 86.21
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 85.99
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 85.82
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 85.66
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 85.32
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 85.13
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 84.95
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 84.17
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 84.11
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 83.98
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 83.27
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 82.07
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 81.98
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 81.92
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 81.79
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 81.57
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 80.52
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
Probab=99.66  E-value=5.4e-17  Score=113.20  Aligned_cols=54  Identities=22%  Similarity=0.449  Sum_probs=48.9

Q ss_pred             cCCCCHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHcCCCcccCCCCcCCcchhhhhhhcccccccc
Q 026004            7 WPDFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFRDKQKKSQA   72 (245)
Q Consensus         7 ~~~FT~~Ql~eMEk~f~~~~~~y~~~~~rq~LA~~f~lS~~r~Gk~~v~~~QVk~WFQNRR~k~k~   72 (245)
                      ++.||+.|+..||+.|..  ++||+...+..||..+||++          .||++||||||+++|.
T Consensus         1 ~T~ft~~Ql~~Le~~F~~--~~yp~~~~r~~LA~~l~l~~----------~qV~~WFqNRR~k~kr   54 (56)
T 3a03_A            1 MTSFSRSQVLELERRFLR--QKYLASAERAALAKALRMTD----------AQVKTWFQNRRTKWRR   54 (56)
T ss_dssp             ---CCHHHHHHHHHHHHH--CSSCCHHHHHHHHHHHTCCH----------HHHHHHHHHHHHHHHH
T ss_pred             CCccCHHHHHHHHHHHHh--cCCcCHHHHHHHHHHhCcCH----------HHhhHhhHHhhhhhcc
Confidence            478999999999999998  69999999999999999999          9999999999999874
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.71
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.69
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.69
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.68
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.68
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.68
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.65
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.64
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.62
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.62
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.61
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.61
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.61
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.6
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.6
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.59
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.59
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.59
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.58
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.56
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.56
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.55
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.55
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.54
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.51
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.5
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.5
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.49
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.47
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.41
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.26
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 95.8
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 95.52
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 94.42
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 93.94
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 93.81
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 93.22
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 92.16
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 91.6
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 91.31
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 89.48
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 89.16
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 88.81
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 88.41
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 87.96
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 86.41
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 84.83
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 84.81
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 84.51
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 83.62
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 83.38
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 82.77
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 82.61
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 82.05
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 81.15
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 80.99
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 80.8
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 80.7
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Engrailed Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

Probab=99.71  E-value=4.2e-18  Score=117.77  Aligned_cols=51  Identities=18%  Similarity=0.458  Sum_probs=48.4

Q ss_pred             cCCCCHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHcCCCcccCCCCcCCcchhhhhhhccccc
Q 026004            7 WPDFTLAEIKEMESMYKEIGEASLTQEYCKALATSFSFSASRAARPAITWLQVQSWFRDKQKK   69 (245)
Q Consensus         7 ~~~FT~~Ql~eMEk~f~~~~~~y~~~~~rq~LA~~f~lS~~r~Gk~~v~~~QVk~WFQNRR~k   69 (245)
                      =+.||++|+..||+.|..  ++||+...|++||.++|||+          +||++||||||+|
T Consensus         3 Rt~ft~~Q~~~Le~~F~~--~~yp~~~~r~~LA~~lgL~~----------~qV~vWFqNrRaK   53 (53)
T d1p7ia_           3 RTAFSSEQLARLKREFNE--NRYLTERRRQQLSSELGLNE----------AQIKIWFQNARAK   53 (53)
T ss_dssp             CCCCCHHHHHHHHHHHHH--CSSCCHHHHHHHHHHHTCCH----------HHHHHHHHHHHHC
T ss_pred             CccCCHHHHHHHHHHHHH--CCCCCHHHHHHHHHHhCCCh----------HHhhhcccccCCC
Confidence            367999999999999999  58999999999999999999          9999999999986
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure