Citrus Sinensis ID: 026102

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRLKVLGDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
ccEEEEHHcccccEEEEEccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHHcccccccccccccccccEEEccccccHHHHcccccccEEcccccccccccccccccccccccccccEEEEccccccccc
cEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHccccHHHHcccccccHHHHccccccccccccccEEEEEHHHHHHHEcccccEcccccccccHHHHcccccccccccccccccccEEEccHHHHHHHHccccccEEEccccccEEcEEEccccEcccccEEEEEEEEccccccEEcc
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCesvcpndgfLEQLKMFEEMgfkvnrgspiykrfRLKVLgdsynrgekidsskfgadpglpvevlsgveaipnggdnrtpayrckkcRRVVALQENvvdhipgegetAFEWHKrksgnrfnrsdesecssifvePLRWMTAVEEGALEGKLSCAHCEarlgyfnwsgiqcscgswitpafqlhksrvdkstv
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFkvnrgspiykrfRLKVLGDSYNrgekidsskfgadpgLPVEVLSGveaipnggdnrtpayrCKKCRRVVALQenvvdhipgegetafewhkrksgnrfnrsdesecssIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAfqlhksrvdkstv
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRLKVLGDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
*YVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQL**********QSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRLKVLGDSYNR*************GLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWH***************CSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQL**********
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRLKVLGDSYNRGEKIDSSKFGADPGLPVEVL********GGDNRTPAYRCKKCRRVVALQENVVD****************************CSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRLKVLGDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSG***********SSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLH*********
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRLKVLGDSYNRGEKIDSSKFGADPGLP*E*************NRTPAYRCKKCRRVVALQENVVDHI*************************ECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYVLISLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRLKVLGDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q9UNI6340 Dual specificity protein yes no 0.827 0.591 0.387 4e-42
Q9JIM4339 Dual specificity protein yes no 0.814 0.584 0.374 2e-41
Q9D0T2339 Dual specificity protein yes no 0.814 0.584 0.356 2e-38
Q02256364 Tyrosine-protein phosphat yes no 0.851 0.568 0.337 2e-29
O13632330 Tyrosine-protein phosphat yes no 0.753 0.554 0.293 4e-24
Q54T76394 Probable dual specificity yes no 0.522 0.322 0.342 2e-20
Q8WTR2217 Dual specificity protein no no 0.185 0.207 0.4 0.0004
>sp|Q9UNI6|DUS12_HUMAN Dual specificity protein phosphatase 12 OS=Homo sapiens GN=DUSP12 PE=1 SV=1 Back     alignment and function desciption
 Score =  171 bits (434), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 128/222 (57%), Gaps = 21/222 (9%)

Query: 27  AIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFR 86
           AIITA+LM+T+QL  E A E L+        N+GF  QLK+++ MG++V+  S IYK++R
Sbjct: 124 AIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYR 183

Query: 87  LKVLGDSYNRGEKIDSSKFGADP-----GLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRV 141
           L+ + + Y   + +    F  DP     GL  EVL                Y+C+KCRR 
Sbjct: 184 LQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVL----------------YKCRKCRRS 227

Query: 142 VALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGK 201
           +    +++DH  G G  AF   +    +      +++C+S F+EP++WM +   G ++G+
Sbjct: 228 LFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQ 287

Query: 202 LSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV 243
           L C  C A+LG FNW G QCSCG WITPAFQ+HK+RVD+  +
Sbjct: 288 LLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKI 329

Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q9JIM4|DUS12_RAT Dual specificity protein phosphatase 12 OS=Rattus norvegicus GN=Dusp12 PE=2 SV=1 Back     alignment and function description
>sp|Q9D0T2|DUS12_MOUSE Dual specificity protein phosphatase 12 OS=Mus musculus GN=Dusp12 PE=2 SV=1 Back     alignment and function description
>sp|Q02256|PVH1_YEAST Tyrosine-protein phosphatase YVH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVH1 PE=1 SV=1 Back     alignment and function description
>sp|O13632|PVH1_SCHPO Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yvh1 PE=3 SV=1 Back     alignment and function description
>sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 Back     alignment and function description
>sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
255562308 364 Dual specificity protein phosphatase, pu 0.897 0.598 0.844 1e-106
224137682 355 predicted protein [Populus trichocarpa] 0.897 0.614 0.839 1e-104
224089979 352 predicted protein [Populus trichocarpa] 0.897 0.619 0.821 1e-102
225440081 366 PREDICTED: dual specificity protein phos 0.897 0.595 0.817 1e-102
87241169 360 Dual specificity protein phosphatase [Me 0.897 0.605 0.766 5e-97
449489501 365 PREDICTED: dual specificity protein phos 0.897 0.597 0.793 3e-96
449446728 365 PREDICTED: dual specificity protein phos 0.897 0.597 0.793 4e-96
356571921 354 PREDICTED: dual specificity protein phos 0.897 0.615 0.761 5e-96
357509359 370 Dual specificity protein phosphatase [Me 0.897 0.589 0.732 1e-94
356504682 354 PREDICTED: dual specificity protein phos 0.897 0.615 0.747 1e-94
>gi|255562308|ref|XP_002522161.1| Dual specificity protein phosphatase, putative [Ricinus communis] gi|223538599|gb|EEF40202.1| Dual specificity protein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 197/218 (90%)

Query: 26  GAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRF 85
            AIITAYLMRTEQLS E ALESLR+SCE VCPNDGFL+QLKMFE+MGFKV+R S IYKRF
Sbjct: 147 AAIITAYLMRTEQLSQEDALESLRESCEFVCPNDGFLDQLKMFEDMGFKVDRASSIYKRF 206

Query: 86  RLKVLGDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQ 145
           RLKVLGDSYNRGEKIDSSKFGADPG+   V S VEA PNG + RTPAYRCKKCRRVVALQ
Sbjct: 207 RLKVLGDSYNRGEKIDSSKFGADPGMSTGVSSEVEASPNGENKRTPAYRCKKCRRVVALQ 266

Query: 146 ENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCA 205
           ENVVDHIPGEGET+F W+KRKSGN F++SDE ECSSIFVEPL+WM + EEGALEGKLSCA
Sbjct: 267 ENVVDHIPGEGETSFAWNKRKSGNPFDKSDEPECSSIFVEPLKWMASAEEGALEGKLSCA 326

Query: 206 HCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV 243
           HCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVD S +
Sbjct: 327 HCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDISII 364

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224137682|ref|XP_002322618.1| predicted protein [Populus trichocarpa] gi|222867248|gb|EEF04379.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224089979|ref|XP_002308890.1| predicted protein [Populus trichocarpa] gi|222854866|gb|EEE92413.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225440081|ref|XP_002282532.1| PREDICTED: dual specificity protein phosphatase 12 [Vitis vinifera] gi|297741650|emb|CBI32782.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|87241169|gb|ABD33027.1| Dual specificity protein phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449489501|ref|XP_004158331.1| PREDICTED: dual specificity protein phosphatase 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449446728|ref|XP_004141123.1| PREDICTED: dual specificity protein phosphatase 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356571921|ref|XP_003554119.1| PREDICTED: dual specificity protein phosphatase 12-like [Glycine max] Back     alignment and taxonomy information
>gi|357509359|ref|XP_003624968.1| Dual specificity protein phosphatase [Medicago truncatula] gi|355499983|gb|AES81186.1| Dual specificity protein phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356504682|ref|XP_003521124.1| PREDICTED: dual specificity protein phosphatase 12-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
UNIPROTKB|Q2QY35356 LOC_Os12g03990 "Os12g0133700 p 0.876 0.598 0.669 3.9e-76
UNIPROTKB|Q2RAU9356 Os11g0136800 "Os11g0136800 pro 0.876 0.598 0.674 8.1e-76
UNIPROTKB|F1MW70345 DUSP12 "Uncharacterized protei 0.831 0.585 0.390 2e-40
RGD|68375339 Dusp12 "dual specificity phosp 0.831 0.595 0.395 4.2e-40
UNIPROTKB|Q9UNI6340 DUSP12 "Dual specificity prote 0.843 0.602 0.399 5.3e-40
ZFIN|ZDB-GENE-050626-91305 dusp12 "dual specificity phosp 0.839 0.668 0.383 5.3e-40
UNIPROTKB|F1S1C7340 LOC100626531 "Uncharacterized 0.831 0.594 0.395 1.1e-39
UNIPROTKB|F1N842316 DUSP12 "Uncharacterized protei 0.835 0.642 0.398 2.3e-39
UNIPROTKB|I3LL40327 I3LL40 "Uncharacterized protei 0.831 0.617 0.390 2.9e-39
MGI|MGI:1890614339 Dusp12 "dual specificity phosp 0.831 0.595 0.372 4.9e-37
UNIPROTKB|Q2QY35 LOC_Os12g03990 "Os12g0133700 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 767 (275.1 bits), Expect = 3.9e-76, P = 3.9e-76
 Identities = 144/215 (66%), Positives = 169/215 (78%)

Query:    28 IITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFRL 87
             II AYLMRTEQ S E ALESL++  ES CPNDGFLEQLK+FEEMGFKV+  SP+YKRFRL
Sbjct:   143 IIVAYLMRTEQKSLEEALESLKEVNESACPNDGFLEQLKLFEEMGFKVDTSSPLYKRFRL 202

Query:    88 KVLGDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQEN 147
             K+LG SY  GEKI S  F  DPGL  +  S  + +PN    + PAYRCKKCRR++A+Q N
Sbjct:   203 KLLGQSYKIGEKIGSYVFEDDPGLSGQPNSSTQNLPNK-QTQQPAYRCKKCRRIIAVQGN 261

Query:   148 VVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHC 207
             VV H PGEGE+ F+W  ++ G R + S E +CSS+FVEPL+WMT VE+GALEGKLSC HC
Sbjct:   262 VVSHTPGEGESCFQWQNKRKGER-SYSKEQDCSSLFVEPLKWMTPVEDGALEGKLSCIHC 320

Query:   208 EARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKST 242
              ARLGYFNWSGIQC+CGSWITPAFQ+ KS+VD ST
Sbjct:   321 GARLGYFNWSGIQCNCGSWITPAFQISKSKVDIST 355
GO:0000188 "inactivation of MAPK activity" evidence=IBA
GO:0006470 "protein dephosphorylation" evidence=IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IBA
GO:0033549 "MAP kinase phosphatase activity" evidence=IBA
GO:0043405 "regulation of MAP kinase activity" evidence=IBA
UNIPROTKB|Q2RAU9 Os11g0136800 "Os11g0136800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|F1MW70 DUSP12 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|68375 Dusp12 "dual specificity phosphatase 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNI6 DUSP12 "Dual specificity protein phosphatase 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050626-91 dusp12 "dual specificity phosphatase 12" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1C7 LOC100626531 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N842 DUSP12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL40 I3LL40 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1890614 Dusp12 "dual specificity phosphatase 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.48LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 9e-10
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 8e-09
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 2e-07
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
 Score = 55.0 bits (133), Expect = 9e-10
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 26  GAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEM 71
             +I AYLM+T  +S   A + ++     + PN GFL QL  +E  
Sbjct: 93  ATLIIAYLMKTRNMSLNDAYDFVKDRRPIISPNFGFLRQLIEYERK 138

Length = 138
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG1718198 consensus Dual specificity phosphatase [Defense me 99.83
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.78
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.78
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.77
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.7
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.69
PRK12361 547 hypothetical protein; Provisional 99.53
PTZ00242166 protein tyrosine phosphatase; Provisional 99.52
KOG1719183 consensus Dual specificity phosphatase [Defense me 99.49
PTZ00393241 protein tyrosine phosphatase; Provisional 99.48
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.33
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.28
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 98.76
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 98.76
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.55
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 98.41
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 98.38
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 98.31
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 97.95
PHA02742303 protein tyrosine phosphatase; Provisional 97.69
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 97.68
PHA02740298 protein tyrosine phosphatase; Provisional 97.63
PHA02747312 protein tyrosine phosphatase; Provisional 97.58
PHA02746323 protein tyrosine phosphatase; Provisional 97.48
PHA02738320 hypothetical protein; Provisional 97.41
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 97.36
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 97.01
KOG2283434 consensus Clathrin coat dissociation kinase GAK/PT 96.9
KOG2386393 consensus mRNA capping enzyme, guanylyltransferase 96.86
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 96.74
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 96.44
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 96.2
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 96.18
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 95.84
PF0322696 Yippee-Mis18: Yippee zinc-binding/DNA-binding /Mis 94.72
KOG0791374 consensus Protein tyrosine phosphatase, contains f 94.7
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 94.43
PLN02727 986 NAD kinase 93.45
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 93.18
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 91.03
PF01641124 SelR: SelR domain; InterPro: IPR002579 Peptide met 85.9
PRK05508119 methionine sulfoxide reductase B; Provisional 85.79
PRK00222142 methionine sulfoxide reductase B; Provisional 82.89
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 82.28
COG3453130 Uncharacterized protein conserved in bacteria [Fun 82.01
>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information 
Probab=99.83  E-value=1.1e-20  Score=156.66  Aligned_cols=68  Identities=24%  Similarity=0.280  Sum_probs=63.6

Q ss_pred             HHHcCCcEEEEeCCCCchhHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHcCCC
Q 026102            7 LIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFK   74 (243)
Q Consensus         7 ~i~~~~~VLVHC~~G~sRS~avv~AyLm~~~~~~~~~A~~~vr~~rp~~~pn~~f~~qL~~~~~~~~~   74 (243)
                      .+.++|++||||.||+|||+++++||||+..++++.||+.++|++||.++||.||++||..||...+.
T Consensus        90 v~~~gG~TLvHC~AGVSRSAsLClAYLmK~~~msLreAy~~vKa~RpiIRPN~GFw~QLi~YE~qL~g  157 (198)
T KOG1718|consen   90 VIMRGGKTLVHCVAGVSRSASLCLAYLMKYHCMSLREAYHWVKARRPIIRPNVGFWRQLIDYEQQLFG  157 (198)
T ss_pred             HHhcCCcEEEEEccccchhHHHHHHHHHHHccchHHHHHHHHHhhCceeCCCccHHHHHHHHHHHhcC
Confidence            34457899999999999999999999999999999999999999999999999999999999997654

>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>PF03226 Yippee-Mis18: Yippee zinc-binding/DNA-binding /Mis18, centromere assembly; InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>PF01641 SelR: SelR domain; InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine [] Back     alignment and domain information
>PRK05508 methionine sulfoxide reductase B; Provisional Back     alignment and domain information
>PRK00222 methionine sulfoxide reductase B; Provisional Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
3s4e_A144 Crystal Structrue Of A Novel Mitogen-Activated Prot 2e-05
>pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 Back     alignment and structure 
Iteration: 1

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)
Query: 26  GAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEE 70
            AI+  +LM +EQ S   A   ++ +  S+CPN GF+EQL+ ++E
Sbjct: 96  AAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQE 140

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 2e-14
3emu_A161 Leucine rich repeat and phosphatase domain contain 1e-13
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 7e-13
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 3e-12
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 3e-12
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 4e-12
2hcm_A164 Dual specificity protein phosphatase; structural g 9e-12
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 2e-11
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 4e-11
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 8e-11
2oud_A177 Dual specificity protein phosphatase 10; A central 9e-11
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 1e-10
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 1e-10
2hxp_A155 Dual specificity protein phosphatase 9; human phos 2e-10
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 2e-10
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 2e-10
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 2e-10
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 3e-10
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 5e-10
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 1e-09
2q05_A195 Late protein H1, dual specificity protein phosphat 2e-08
3cm3_A176 Late protein H1, dual specificity protein phosphat 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
 Score = 69.0 bits (169), Expect = 2e-14
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 3/114 (2%)

Query: 27  AIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMGFKVNRGSPIYKRFR 86
            I  AYLM+T+Q   + A + ++Q    V PN GF+ QL  +E      +  +P     +
Sbjct: 99  TICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILP-STPNPQPPSCQ 157

Query: 87  LKVLGDSY-NRGEKIDSSKFGADPGLPVEVLSGVEA-IPNGGDNRTPAYRCKKC 138
            +  G S     + +     GA    P  VL+ V         +R+P      C
Sbjct: 158 GEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC 211
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2j16_A SDP-1, tyrosine-protein phosphatase YIL113W; hydrolase, hypothetical protein; 2.7A {Saccharomyces cerevisiae} PDB: 2j17_A* 2j16_B Length = 182 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
3emu_A161 Leucine rich repeat and phosphatase domain contain 99.83
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.81
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 99.81
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.81
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.79
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.79
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.78
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.78
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.77
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.77
2hcm_A164 Dual specificity protein phosphatase; structural g 99.76
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.76
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.75
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.75
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.75
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.75
2oud_A177 Dual specificity protein phosphatase 10; A central 99.74
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.73
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.73
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.72
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.7
2q05_A195 Late protein H1, dual specificity protein phosphat 99.65
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.65
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.62
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.59
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.54
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.53
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.49
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.45
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.42
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.41
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.39
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.39
1xri_A151 AT1G05000; structural genomics, protein structure 98.99
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 98.95
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 98.82
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 98.81
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.58
2f46_A156 Hypothetical protein; structural genomics, joint c 98.41
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 98.41
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 98.38
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 98.37
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 98.3
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 98.29
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 98.27
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 98.25
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 98.25
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 98.23
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 98.23
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 98.23
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 98.22
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 98.21
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 98.21
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 98.2
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 98.18
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 98.18
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 98.17
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 98.17
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 98.17
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 98.17
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 98.14
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 98.14
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 98.11
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 98.04
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 98.03
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 97.97
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 97.95
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 97.89
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 97.88
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 97.85
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 97.81
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 97.78
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 97.78
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 97.76
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 97.75
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 97.65
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 97.65
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 97.63
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 97.62
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 97.54
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 97.5
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 97.49
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 97.0
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 96.48
2kao_A124 Methionine-R-sulfoxide reductase B1; mouse reduced 84.13
3mao_A105 Methionine-R-sulfoxide reductase B1; oxidoreductas 83.37
2kv1_A124 Methionine-R-sulfoxide reductase B1; MSRB1, SELR, 82.4
2k8d_A151 Peptide methionine sulfoxide reductase MSRB; therm 81.33
3cxk_A164 Methionine-R-sulfoxide reductase; structural genom 80.83
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=99.83  E-value=1.2e-20  Score=154.95  Aligned_cols=69  Identities=25%  Similarity=0.224  Sum_probs=63.7

Q ss_pred             HHHHHHc----CCcEEEEeCCCCchhHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHcC
Q 026102            4 LISLIGE----ERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEMG   72 (243)
Q Consensus         4 ~i~~i~~----~~~VLVHC~~G~sRS~avv~AyLm~~~~~~~~~A~~~vr~~rp~~~pn~~f~~qL~~~~~~~   72 (243)
                      +++||++    +++|||||.+|+|||+++++||||+.+++++++|+++|+++||.+.||.||++||..||+..
T Consensus        76 ~~~fI~~~~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L  148 (161)
T 3emu_A           76 AIKFIIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKL  148 (161)
T ss_dssp             HHHHHHHHHHTTCEEEEEESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCeEEEEcCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHH
Confidence            4556644    67999999999999999999999999999999999999999999999999999999999864
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>3mao_A Methionine-R-sulfoxide reductase B1; oxidoreductase, structural genomics consortium, SGC, cytoplasm, metal-binding, nucleus, selenocysteine, zinc; HET: MLI; 1.42A {Homo sapiens} Back     alignment and structure
>2kv1_A Methionine-R-sulfoxide reductase B1; MSRB1, SELR, metal-binding, nucleus, oxidoreductase, seleniu; NMR {Mus musculus} Back     alignment and structure
>2k8d_A Peptide methionine sulfoxide reductase MSRB; thermophilic, Zn binding, metal-binding, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3cxk_A Methionine-R-sulfoxide reductase; structural genomics, MSRB, oxidoreductase, MIC labcard, PSI-2, protein structure initiative; 1.70A {Burkholderia pseudomallei strain} PDB: 3cez_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-08
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-08
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 1e-07
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 6e-05
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

 Score = 49.8 bits (118), Expect = 2e-08
 Identities = 14/45 (31%), Positives = 22/45 (48%)

Query: 26  GAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEE 70
             +  AYLM+   LS   A + ++    ++ PN  F+ QL  FE 
Sbjct: 98  VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFER 142
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.83
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.8
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.78
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.6
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.47
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.4
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.3
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.12
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 98.16
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 98.05
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 97.94
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 97.76
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 97.73
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 97.72
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 97.67
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 97.65
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 97.56
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 97.56
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 97.54
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 97.52
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 97.5
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 97.49
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 96.74
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 92.53
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 89.69
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 87.86
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 86.88
d1xm0a1143 Peptide methionine sulfoxide reductase MsrB {Bacil 84.03
d1l1da_144 C-terminal MsrB domain of peptide methionine sulfo 81.38
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=99.83  E-value=3.2e-21  Score=153.24  Aligned_cols=66  Identities=24%  Similarity=0.278  Sum_probs=61.9

Q ss_pred             HHHHcCCcEEEEeCCCCchhHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHc
Q 026102            6 SLIGEERRGVFWFIALQECPGAIITAYLMRTEQLSSEGALESLRQSCESVCPNDGFLEQLKMFEEM   71 (243)
Q Consensus         6 ~~i~~~~~VLVHC~~G~sRS~avv~AyLm~~~~~~~~~A~~~vr~~rp~~~pn~~f~~qL~~~~~~   71 (243)
                      +.+.++++|||||.+|+|||+++++||||+++++++++|+++|+++||.+.||.+|++||..||+.
T Consensus        78 ~~~~~~~~VlVHC~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~  143 (144)
T d1mkpa_          78 EARGKNCGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERT  143 (144)
T ss_dssp             HHHHTTCEEEEECSSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHT
T ss_pred             HhhhccceEEEEecccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhh
Confidence            344567899999999999999999999999999999999999999999999999999999999985
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm0a1 b.88.1.3 (A:1-143) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l1da_ b.88.1.3 (A:) C-terminal MsrB domain of peptide methionine sulfoxide reductase PilB {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure