Citrus Sinensis ID: 026149

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MAKFLVSYTWIQGAGQGRERDHTMIRCFAPVRSVHAFHNHTIRFVTPKLTANSSSSSLLSTRREALTVSIVTTTLEILISSFSASSSAAAAAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLRH
ccccccccEEEEccccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccEEEEEEEccccccccccEEEEEEEEEEEcccccEEEccccccccccccccEEEEcccccccccHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcc
ccEEEEEEEEEEccccccccccEEEEEcccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccccccccccEEEEEEEEEEEcccccEEcccccccccccccccEEEEcccccEEccHHHHHHHcccccEEEEEEcHHHccccccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEEEEccc
MAKFLVSYTWIqgagqgrerdhtmircfapvrsvhafhnhtirfvtpkltansssssLLSTRREALTVSIVTTTLEILISSFSASSSAAAAAAAELLelpnsggvkaldlrlgrgpvpvdgdqvAIHYYGRLAakqgwrfdstydhkdqsgepipflfilgsgkvipGIEAAVRSMKVGGIcrvvippsqgyqntsqepippnffdrqrlfttifnptrlangegstlgtLIFDIELVSLRH
MAKFLVSYTWiqgagqgrerDHTMIRCFAPVRSVHAFHNHTIRfvtpkltansssssllstrrEALTVSIVTTTLEILISSFSASSSAAAAAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEPIPPNFFDRQRLFTTIFNPtrlangegstlgtlifdieLVSLRH
MAKFLVSYTWIQGAGQGRERDHTMIRCFAPVRSVHAFHNHTIRFVTPKLTANsssssllsTRREALTVSIVTTTLEILIssfsasssaaaaaaaELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLRH
***FLVSYTWIQGAGQGRERDHTMIRCFAPVRSVHAFHNHTIRFVT******************ALTVSIVTTTLEILISSFS*******AAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPS************PNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELV****
***F*VSYTWIQGAGQGRERDHTM********************************************************************************VKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLRH
MAKFLVSYTWIQGAGQGRERDHTMIRCFAPVRSVHAFHNHTIRFVTPKLT***********RREALTVSIVTTTLEILISSFS********AAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLRH
MAKFLVSYTWIQGAGQGRERDHTMIRCFAPVRSVHAFHNHTIRFVTPKLTANSSSSSLLSTRREALTVSIVTTTLEILISSFSASSSAAAAAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDS*********EPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKFLVSYTWIQGAGQGRERDHTMIRCFAPVRSVHAFHNHTIRFVTPKLTANSSSSSLLSTRREALTVSIVTTTLEILISSFSASSSAAAAAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLRH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
O81864229 Peptidyl-prolyl cis-trans yes no 0.884 0.934 0.640 4e-73
Q9LYR5256 Peptidyl-prolyl cis-trans no no 0.524 0.496 0.335 5e-12
P27124 458 Peptidyl-prolyl cis-trans yes no 0.471 0.248 0.368 6e-11
Q9FJL3 578 Peptidyl-prolyl cis-trans no no 0.520 0.217 0.312 6e-11
Q9XSI2 457 Peptidyl-prolyl cis-trans N/A no 0.520 0.275 0.326 6e-11
Q13451 457 Peptidyl-prolyl cis-trans yes no 0.471 0.249 0.346 1e-10
Q5RF88 457 Peptidyl-prolyl cis-trans yes no 0.471 0.249 0.346 1e-10
Q6BSE7437 FK506-binding protein 3 O yes no 0.433 0.240 0.366 1e-10
Q9XSH5 457 Peptidyl-prolyl cis-trans N/A no 0.479 0.253 0.348 1e-10
Q59VR3426 FK506-binding protein 3 O N/A no 0.433 0.246 0.374 2e-10
>sp|O81864|FK171_ARATH Peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic OS=Arabidopsis thaliana GN=FKBP17-1 PE=2 SV=1 Back     alignment and function desciption
 Score =  274 bits (701), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 175/231 (75%), Gaps = 17/231 (7%)

Query: 24  MIRCFAPVRSVHAFHNHTIRFVTP------------KLTANSSSSSLLSTRREALTVSIV 71
           MIRCFA    V A    T+ F +P              +++SSSS++ +  R ++++SI+
Sbjct: 1   MIRCFAWTPLVGAPLITTVHFTSPPSLRIFASRSSAPSSSSSSSSTVAAASRRSISLSII 60

Query: 72  TTTLEILISSFSASSSAAAAAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGR 131
             T     SS  +S   ++ A A+  E+PNSGGVKALDLR+G G VP++GDQ+ IHYYGR
Sbjct: 61  AVT-----SSVVSSFCFSSPALADFSEIPNSGGVKALDLRIGDGDVPIEGDQIEIHYYGR 115

Query: 132 LAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQG 191
           LAAKQGWRFDSTYDHKD +GE +PF F+LGS KVIPGIE AVRSMKVGGI RVVIPPSQG
Sbjct: 116 LAAKQGWRFDSTYDHKDSNGEAVPFTFVLGSSKVIPGIETAVRSMKVGGIRRVVIPPSQG 175

Query: 192 YQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLRH 242
           YQNTSQEP+PPNFFDRQRLFTTIFNPTRLANGEGSTLGTL+FDIELVS R 
Sbjct: 176 YQNTSQEPLPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLVFDIELVSTRR 226
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9LYR5|FKB19_ARATH Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic OS=Arabidopsis thaliana GN=FKBP19 PE=1 SV=1 Back     alignment and function description
>sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 Back     alignment and function description
>sp|Q5RF88|FKBP5_PONAB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Pongo abelii GN=FKBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q6BSE7|FKBP3_DEBHA FK506-binding protein 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR3 PE=3 SV=1 Back     alignment and function description
>sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q59VR3|FKBP3_CANAL FK506-binding protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FPR3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
225423674220 PREDICTED: probable FKBP-type peptidyl-p 0.876 0.963 0.705 3e-78
449522925225 PREDICTED: peptidyl-prolyl cis-trans iso 0.731 0.786 0.730 7e-73
297800068229 hypothetical protein ARALYDRAFT_492887 [ 0.900 0.951 0.662 2e-72
449455431225 PREDICTED: peptidyl-prolyl cis-trans iso 0.731 0.786 0.719 9e-72
15235203229 FKBP-like peptidyl-prolyl cis-trans isom 0.884 0.934 0.640 2e-71
356537045232 PREDICTED: 39 kDa FK506-binding nuclear 0.743 0.775 0.705 3e-70
357136937206 PREDICTED: FK506-binding protein 4-like 0.599 0.703 0.848 5e-70
326488763207 predicted protein [Hordeum vulgare subsp 0.599 0.700 0.855 5e-70
242064146207 hypothetical protein SORBIDRAFT_04g00462 0.599 0.700 0.841 1e-69
115444473213 Os02g0168700 [Oryza sativa Japonica Grou 0.599 0.680 0.841 3e-69
>gi|225423674|ref|XP_002276516.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic [Vitis vinifera] gi|297737981|emb|CBI27182.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 158/224 (70%), Positives = 178/224 (79%), Gaps = 12/224 (5%)

Query: 24  MIRCFAPVRSVHAFHNHTIRFVTPK----LTANSSSSSLLSTRREALTVSIVTTTLEILI 79
           +IR  AP  ++   H+ T RF  PK    + A SSS +  ST R AL++S++        
Sbjct: 3   IIRWCAPPPTLLLPHHPTARFSCPKPPSVVYAKSSSPASSSTTRRALSLSLI-------F 55

Query: 80  SSFSASS-SAAAAAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGW 138
           SSF+ S  S++ AA +E  EL  SGGVKALDLR G G VPVDGDQVA+HYYGRLAAKQGW
Sbjct: 56  SSFTCSYYSSSEAATSEFFELQGSGGVKALDLRTGSGEVPVDGDQVAVHYYGRLAAKQGW 115

Query: 139 RFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQE 198
           RFDSTYDHKD++GEPIPF+F LGSGKVI GIEAAVRSMKVG I RV+IPPSQGYQNTSQE
Sbjct: 116 RFDSTYDHKDETGEPIPFVFTLGSGKVISGIEAAVRSMKVGSIRRVIIPPSQGYQNTSQE 175

Query: 199 PIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLRH 242
           PIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSL+H
Sbjct: 176 PIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLKH 219

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449522925|ref|XP_004168476.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297800068|ref|XP_002867918.1| hypothetical protein ARALYDRAFT_492887 [Arabidopsis lyrata subsp. lyrata] gi|297313754|gb|EFH44177.1| hypothetical protein ARALYDRAFT_492887 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449455431|ref|XP_004145456.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15235203|ref|NP_193718.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|75100452|sp|O81864.1|FK171_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic; Short=PPIase FKBP17-1; AltName: Full=FK506-binding protein 17-1; Short=AtFKBP17-1; AltName: Full=Immunophilin FKBP17-1; AltName: Full=Rotamase; Flags: Precursor gi|3250692|emb|CAA19700.1| putative protein [Arabidopsis thaliana] gi|6686800|emb|CAB64722.1| FKBP like protein [Arabidopsis thaliana] gi|7268779|emb|CAB78985.1| putative protein [Arabidopsis thaliana] gi|88196737|gb|ABD43011.1| At4g19830 [Arabidopsis thaliana] gi|332658831|gb|AEE84231.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356537045|ref|XP_003537041.1| PREDICTED: 39 kDa FK506-binding nuclear protein-like [Glycine max] Back     alignment and taxonomy information
>gi|357136937|ref|XP_003570059.1| PREDICTED: FK506-binding protein 4-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326488763|dbj|BAJ97993.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|242064146|ref|XP_002453362.1| hypothetical protein SORBIDRAFT_04g004620 [Sorghum bicolor] gi|102139873|gb|ABF70026.1| peptidylprolyl isomerase, FKBP-type family protein [Musa acuminata] gi|241933193|gb|EES06338.1| hypothetical protein SORBIDRAFT_04g004620 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|115444473|ref|NP_001046016.1| Os02g0168700 [Oryza sativa Japonica Group] gi|49388601|dbj|BAD25716.1| putative immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase [Oryza sativa Japonica Group] gi|113535547|dbj|BAF07930.1| Os02g0168700 [Oryza sativa Japonica Group] gi|215692588|dbj|BAG88008.1| unnamed protein product [Oryza sativa Japonica Group] gi|218190144|gb|EEC72571.1| hypothetical protein OsI_06011 [Oryza sativa Indica Group] gi|222622258|gb|EEE56390.1| hypothetical protein OsJ_05539 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
TAIR|locus:2134035229 AT4G19830 "AT4G19830" [Arabido 0.880 0.930 0.608 4.4e-68
UNIPROTKB|Q6H6D3213 P0669G09.14 "Peptidyl-prolyl c 0.723 0.821 0.705 1.2e-65
UNIPROTKB|A9WGZ8237 Caur_0860 "Peptidyl-prolyl cis 0.400 0.409 0.415 1.6e-16
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.388 0.602 0.436 4.2e-15
TIGR_CMR|GSU_2274156 GSU_2274 "FKBP-type peptidyl-p 0.388 0.602 0.436 4.2e-15
UNIPROTKB|A8JEI4181 FKB16-8 "Peptidyl-prolyl cis-t 0.351 0.469 0.408 2.4e-14
TAIR|locus:2181660256 AT5G13410 "AT5G13410" [Arabido 0.541 0.511 0.359 7.9e-14
UNIPROTKB|Q6ZLL2258 OJ1118_D07.22 "Peptidyl-prolyl 0.462 0.434 0.346 4.2e-13
UNIPROTKB|Q8F361129 fkpA "Peptidyl-prolyl cis-tran 0.359 0.674 0.416 5.6e-13
UNIPROTKB|P73037201 ytfC "Peptidyl-prolyl cis-tran 0.380 0.457 0.386 1.2e-12
TAIR|locus:2134035 AT4G19830 "AT4G19830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 691 (248.3 bits), Expect = 4.4e-68, P = 4.4e-68
 Identities = 140/230 (60%), Positives = 164/230 (71%)

Query:    24 MIRCFA--P------VRSVHAFHNHTIRFVTPKLTANXXXXXXXXT----RREALTVSIV 71
             MIRCFA  P      + +VH     ++R    + +A         T     R ++++SI+
Sbjct:     1 MIRCFAWTPLVGAPLITTVHFTSPPSLRIFASRSSAPSSSSSSSSTVAAASRRSISLSII 60

Query:    72 TTTLEILIXXXXXXXXXXXXXXXELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGR 131
               T  ++                +  E+PNSGGVKALDLR+G G VP++GDQ+ IHYYGR
Sbjct:    61 AVTSSVV-----SSFCFSSPALADFSEIPNSGGVKALDLRIGDGDVPIEGDQIEIHYYGR 115

Query:   132 LAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQG 191
             LAAKQGWRFDSTYDHKD +GE +PF F+LGS KVIPGIE AVRSMKVGGI RVVIPPSQG
Sbjct:   116 LAAKQGWRFDSTYDHKDSNGEAVPFTFVLGSSKVIPGIETAVRSMKVGGIRRVVIPPSQG 175

Query:   192 YQNTSQEPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLR 241
             YQNTSQEP+PPNFFDRQRLFTTIFNPTRLANGEGSTLGTL+FDIELVS R
Sbjct:   176 YQNTSQEPLPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLVFDIELVSTR 225
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
UNIPROTKB|Q6H6D3 P0669G09.14 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A9WGZ8 Caur_0860 "Peptidyl-prolyl cis-trans isomerase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|A8JEI4 FKB16-8 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
TAIR|locus:2181660 AT5G13410 "AT5G13410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZLL2 OJ1118_D07.22 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8F361 fkpA "Peptidyl-prolyl cis-trans isomerase" [Leptospira interrogans serovar Lai str. 56601 (taxid:189518)] Back     alignment and assigned GO terms
UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81864FK171_ARATH5, ., 2, ., 1, ., 80.64060.88420.9344yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 5e-24
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 6e-20
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 9e-12
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 6e-09
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 2e-05
PRK01490 435 PRK01490, tig, trigger factor; Provisional 2e-04
TIGR00115 408 TIGR00115, tig, trigger factor 0.003
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score = 91.5 bits (228), Expect = 5e-24
 Identities = 40/123 (32%), Positives = 53/123 (43%), Gaps = 35/123 (28%)

Query: 118 PVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMK 177
              GD V +HY G+L  + G  FDS+ D         PF F LGSG+VIPG +  +  MK
Sbjct: 5   AKKGDTVTVHYTGKL--EDGTVFDSSKDRGK------PFEFTLGSGQVIPGWDEGLLGMK 56

Query: 178 VGGICRVVIPPSQGYQNTSQEP--IPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDI 235
           VG   ++ IPP   Y         IPPN                          TL+F++
Sbjct: 57  VGEKRKLTIPPELAYGEEGLAGGVIPPN-------------------------ATLVFEV 91

Query: 236 ELV 238
           EL+
Sbjct: 92  ELL 94

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|234956 PRK01490, tig, trigger factor; Provisional Back     alignment and domain information
>gnl|CDD|232831 TIGR00115, tig, trigger factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.95
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.94
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.92
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.92
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.91
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.9
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.88
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.86
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.86
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.83
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.83
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.56
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.12
PRK01490 435 tig trigger factor; Provisional 99.06
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.92
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.79
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 97.69
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.22
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.95  E-value=1.3e-27  Score=198.74  Aligned_cols=109  Identities=40%  Similarity=0.731  Sum_probs=101.7

Q ss_pred             ccCCCCCeEEEEEecCCCCCCCCCCEEEEEEEEEEecCCCcEEeeccccCCCCCCCccEEEEcCCCCchHHHHHHHhcCC
Q 026149           98 ELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMK  177 (242)
Q Consensus        98 ~~~~~sGl~~~~l~eG~G~~~~~gd~V~v~Y~~~~~~~dG~~~dss~~~~~~~g~~~p~~f~lG~~~~ipgleeaL~gmk  177 (242)
                      ....++|++|++++.|+|..+..+|.|.+||++++.  ||++||||+++      ++|+.|.+|  .+|+||.++|.+|+
T Consensus        96 v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~--~G~vFDsS~~r------g~p~~f~l~--~vI~Gw~egl~~M~  165 (205)
T COG0545          96 VKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLI--DGTVFDSSYDR------GQPAEFPLG--GVIPGWDEGLQGMK  165 (205)
T ss_pred             ceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecC--CCCcccccccc------CCCceeecC--CeeehHHHHHhhCC
Confidence            334689999999999999999999999999999996  99999999986      569999998  99999999999999


Q ss_pred             CCcEEEEEEcCCCCCCCCCCCC-CCCCccccccccccccccccccCCCCCcceEEEEEEEEEEee
Q 026149          178 VGGICRVVIPPSQGYQNTSQEP-IPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLR  241 (242)
Q Consensus       178 vGe~~~v~Ipp~~aYG~~~~~~-iP~~~f~~~~~~~~~~~~~~~~~~~g~~~~~L~f~vell~vr  241 (242)
                      +|++++++|||++|||.++... ||||                         ++|+|+|||++|.
T Consensus       166 vG~k~~l~IP~~laYG~~g~~g~Ippn-------------------------s~LvFeVeLl~v~  205 (205)
T COG0545         166 VGGKRKLTIPPELAYGERGVPGVIPPN-------------------------STLVFEVELLDVK  205 (205)
T ss_pred             CCceEEEEeCchhccCcCCCCCCCCCC-------------------------CeEEEEEEEEecC
Confidence            9999999999999999999544 9999                         9999999999984

>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 5e-13
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 7e-13
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 8e-13
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 8e-13
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 9e-13
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 9e-13
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-12
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 6e-12
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-11
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 3e-11
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 5e-11
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 5e-11
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 5e-11
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 6e-11
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 9e-11
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 1e-10
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 1e-10
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 1e-10
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 1e-10
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 2e-10
2ki3_A126 Structural And Biochemical Characterization Of Fk50 2e-09
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 7e-09
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 7e-09
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-07
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-07
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 5e-07
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 7e-07
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 1e-06
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 2e-06
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 3e-06
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 6e-06
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 6e-06
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 6e-06
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 6e-06
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 1e-05
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 1e-05
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-05
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 2e-05
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 2e-05
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 3e-05
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 3e-05
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 4e-05
2pbc_A102 Fk506-Binding Protein 2 Length = 102 1e-04
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 1e-04
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 2e-04
1ix5_A151 Solution Structure Of The Methanococcus Thermolitho 3e-04
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 5e-04
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 54/101 (53%), Gaps = 9/101 (8%)
Query: 104 GVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSG 163
           G+K  DL  G G     G  V++HY G L    G +FDS+ D  D      PF F+LG G
Sbjct: 105 GLKYEDLTEGSGAEARAGQTVSVHYTGWLT--DGQKFDSSKDRND------PFAFVLGGG 156
Query: 164 KVIPGIEAAVRSMKVGGICRVVIPPSQGY-QNTSQEPIPPN 203
            VI G +  V+ MKVGG+ R+ IPP  GY    +   IPPN
Sbjct: 157 MVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAAGVIPPN 197
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1IX5|A Chain A, Solution Structure Of The Methanococcus Thermolithotrophicus Fkbp Length = 151 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 9e-29
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-27
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-27
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 6e-27
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 3e-26
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 6e-26
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 7e-26
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 8e-26
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 1e-25
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 1e-25
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 1e-25
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-25
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-17
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-25
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 6e-25
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 1e-24
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-24
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-24
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-20
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-18
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 6e-24
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 9e-24
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-15
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 1e-23
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 2e-23
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 5e-23
1fd9_A213 Protein (macrophage infectivity potentiator prote; 8e-23
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-22
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 5e-21
1jvw_A167 Macrophage infectivity potentiator; chagas disease 2e-20
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 6e-16
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 2e-14
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 7e-14
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 1e-13
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 3e-13
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 3e-13
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 7e-13
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 3e-11
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 2e-10
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 4e-04
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
 Score =  104 bits (262), Expect = 9e-29
 Identities = 37/158 (23%), Positives = 56/158 (35%), Gaps = 33/158 (20%)

Query: 83  SASSSAAAAAAAELLELPNSGGVKALDLRLGRGPVPVDGDQVAIHYYGRLAAKQGWRFDS 142
           +   S     +  +L++    GV    +R G G +      V + Y G L       FDS
Sbjct: 6   APGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLE-HMDRPFDS 64

Query: 143 TYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVGGICRVVIPPSQGY-QNTSQEPIP 201
            Y  K       P L  LG    + G+E  + SM+ G + R +  P+  Y        IP
Sbjct: 65  NYFRKT------PRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIP 118

Query: 202 PNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVS 239
           PN                          T++F+IEL+ 
Sbjct: 119 PN-------------------------TTVLFEIELLD 131
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Length = 432 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.93
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.93
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.93
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.93
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.93
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.93
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.93
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.93
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.93
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.92
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.92
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.91
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.91
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.91
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.91
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.91
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.91
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.91
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.91
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.9
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.9
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.89
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.88
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.87
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.87
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.87
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.86
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.85
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.85
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.84
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.84
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.84
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.84
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.83
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.82
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.82
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.79
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.75
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.6
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.46
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.33
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.21
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 98.35
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
Probab=99.93  E-value=1.1e-25  Score=172.37  Aligned_cols=108  Identities=39%  Similarity=0.673  Sum_probs=99.8

Q ss_pred             CCCCeEEEEEecCCCCC-CCCCCEEEEEEEEEEecCCCcEEeeccccCCCCCCCccEEEEcCCCCchHHHHHHHhcCCCC
Q 026149          101 NSGGVKALDLRLGRGPV-PVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKVG  179 (242)
Q Consensus       101 ~~sGl~~~~l~eG~G~~-~~~gd~V~v~Y~~~~~~~dG~~~dss~~~~~~~g~~~p~~f~lG~~~~ipgleeaL~gmkvG  179 (242)
                      .++|++|+++++|+|.. ++.||.|.+||++++.  ||++|++++++      ..|+.|.+|.++++|||+++|.+|++|
T Consensus         4 ~~~g~~~~~~~~G~g~~~~~~gd~V~v~y~~~~~--dG~~~d~s~~~------~~p~~f~lG~~~~i~g~e~~l~gm~~G   75 (113)
T 1yat_A            4 IEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLE--NGQKFDSSVDR------GSPFQCNIGVGQVIKGWDVGIPKLSVG   75 (113)
T ss_dssp             CGGGCEEEEEECCCSSCCCCTTCEEEEEEEEEET--TSCEEEESTTT------TCCEEEETTSSSSCHHHHHHGGGCCTT
T ss_pred             CCCCeEEEEEECCCCcccCCCCCEEEEEEEEEEC--CCCEEEecCCC------CCcEEEEeCCCCccHHHHHHHhCCCCC
Confidence            45899999999999988 9999999999999985  99999999853      359999999999999999999999999


Q ss_pred             cEEEEEEcCCCCCCCCCC-CCCCCCccccccccccccccccccCCCCCcceEEEEEEEEEEee
Q 026149          180 GICRVVIPPSQGYQNTSQ-EPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLR  241 (242)
Q Consensus       180 e~~~v~Ipp~~aYG~~~~-~~iP~~~f~~~~~~~~~~~~~~~~~~~g~~~~~L~f~vell~vr  241 (242)
                      ++++|.|||+++||+++. ..||++                         ++|+|+|+|++|+
T Consensus        76 e~~~v~ip~~~ayG~~~~~~~Ip~~-------------------------~~l~f~vel~~ik  113 (113)
T 1yat_A           76 EKARLTIPGPYAYGPRGFPGLIPPN-------------------------STLVFDVELLKVN  113 (113)
T ss_dssp             CEEEEEECGGGTTTTTCBTTTBCTT-------------------------CCEEEEEEEEEEC
T ss_pred             CEEEEEECHHHCcCCCCCCCCcCCC-------------------------CeEEEEEEEEEeC
Confidence            999999999999999885 449999                         9999999999984
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 1e-15
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 2e-15
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-15
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-15
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 4e-15
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 3e-14
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9e-14
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-13
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 1e-12
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-12
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 3e-12
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 4e-11
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 7e-09
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 3e-08
d1t11a3113 d.26.1.1 (A:135-247) Trigger factor PPIase domain 9e-04
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKB-6, N-terminal domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 69.0 bits (168), Expect = 1e-15
 Identities = 43/139 (30%), Positives = 55/139 (39%), Gaps = 35/139 (25%)

Query: 103 GGVKALDLRLGRG-PVPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILG 161
           GGV  L  + G+G   P  G  V +HY G L  + G +FDS+ D  DQ      F F LG
Sbjct: 10  GGVLKLIKKEGQGVVKPTTGTTVKVHYVGTL--ENGTKFDSSRDRGDQ------FSFNLG 61

Query: 162 SGKVIPGIEAAVRSMKVGGICRVVIPPSQGYQNTSQEP-IPPNFFDRQRLFTTIFNPTRL 220
            G VI G +  V +M  G +    I    GY +    P IP                   
Sbjct: 62  RGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGG----------------- 104

Query: 221 ANGEGSTLGTLIFDIELVS 239
                    TLIF++EL  
Sbjct: 105 --------ATLIFEVELFE 115
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.94
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.94
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.94
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.94
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.93
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.93
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.93
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.92
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.9
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.9
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.86
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.84
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.66
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.34
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.25
d2f23a279 GreA transcript cleavage factor, C-terminal domain 80.27
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP52, N-terminal domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=1.4e-26  Score=177.96  Aligned_cols=109  Identities=39%  Similarity=0.706  Sum_probs=101.2

Q ss_pred             CCCCCeEEEEEecCCCC-CCCCCCEEEEEEEEEEecCCCcEEeeccccCCCCCCCccEEEEcCCCCchHHHHHHHhcCCC
Q 026149          100 PNSGGVKALDLRLGRGP-VPVDGDQVAIHYYGRLAAKQGWRFDSTYDHKDQSGEPIPFLFILGSGKVIPGIEAAVRSMKV  178 (242)
Q Consensus       100 ~~~sGl~~~~l~eG~G~-~~~~gd~V~v~Y~~~~~~~dG~~~dss~~~~~~~g~~~p~~f~lG~~~~ipgleeaL~gmkv  178 (242)
                      ..++|++|+++++|+|. .|..||.|.+||++++.  ||++||+|+++      ..|+.|.+|.+.+++||+++|.+|++
T Consensus         8 ~~d~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l~--dG~~fdss~~~------~~p~~f~~g~~~~i~G~~~~l~~M~~   79 (120)
T d1q1ca1           8 KQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLL--DGTKFDSSLDR------KDKFSFDLGKGEVIKAWDIAIATMKV   79 (120)
T ss_dssp             SCSSSEEEEEEECCSSSCCCCTTCEEEEEEEEEET--TSCEEEESTTS------SSCEEEETTTTSSCHHHHHHHTTCCT
T ss_pred             CCCCCEEEEEEEcccCCcCCCCCCEEEEEEEEEEc--CCCEEEecccc------ccceeeecCCCceeeeeeeeeccccC
Confidence            46799999999999995 58999999999999996  99999999975      45999999999999999999999999


Q ss_pred             CcEEEEEEcCCCCCCCCCC-CCCCCCccccccccccccccccccCCCCCcceEEEEEEEEEEee
Q 026149          179 GGICRVVIPPSQGYQNTSQ-EPIPPNFFDRQRLFTTIFNPTRLANGEGSTLGTLIFDIELVSLR  241 (242)
Q Consensus       179 Ge~~~v~Ipp~~aYG~~~~-~~iP~~~f~~~~~~~~~~~~~~~~~~~g~~~~~L~f~vell~vr  241 (242)
                      ||+++|+|||++|||+.+. ..||++                         ++|+|+|||++|+
T Consensus        80 Ge~~~~~ip~~laYG~~g~~~~IPp~-------------------------s~LifeIeLl~v~  118 (120)
T d1q1ca1          80 GEVCHITCKPEYAYGSAGSPPKIPPN-------------------------ATLVFEVELFEFK  118 (120)
T ss_dssp             TCEEEEEECGGGTTTTTCBTTTBCTT-------------------------CCEEEEEEEEEEE
T ss_pred             CcEEEEEECHHHhCCCcCCCCCCCcC-------------------------CcEEEEEEEEEEe
Confidence            9999999999999999875 459999                         9999999999997
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f23a2 d.26.1.2 (A:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure