Citrus Sinensis ID: 026154

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLSTARREK
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccccccccccEEEEccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHEccccEEEEcccccHHHccccccEEEEEEcccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccEEccHHHHHHHHHHHHHcccccHccc
MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALashpsinlpmllgkksdgsfpiwsiilfspyIYFVRIFSVLRrlnsgeepysEVCEGlyvggwpnsmttlppgnpaiidctcefpklrefeghsylcvptwdtrspqpgeiESAVKWgsrkraqnrpvfvhcayGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLSTARREK
MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVptwdtrspqPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKlikkrrpniqmnalqrkaleewskhrlstarrek
MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFlyaslvsllialasHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSvavacallvalSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLSTARREK
**VGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDT***********VKWG****AQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIK*******************************
*GVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEE*************
MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWS***********
*GVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRL*******
oooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLSTARREK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
P76093430 Uncharacterized protein Y N/A no 0.665 0.374 0.301 2e-15
Q99N11184 Dual specificity protein yes no 0.582 0.766 0.243 8e-05
>sp|P76093|YNBD_ECOLI Uncharacterized protein YnbD OS=Escherichia coli (strain K12) GN=ynbD PE=3 SV=1 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 78/179 (43%), Gaps = 18/179 (10%)

Query: 60  GKKSDGSFPIWSIILFSPYIYF------VRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNS 113
           GK S G  P        P +Y+      + ++  +R      EP S++  G+Y+G +P  
Sbjct: 263 GKDSQGKLP--------PAVYWLTLPCRIGMWLSMRWFCRRLEPVSKMTAGVYLGAFPRH 314

Query: 114 MTTLPPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNR 173
           +    P   A++D T EFP+ R  +   Y CVP  D   P+ GE+  AV      R +  
Sbjct: 315 I----PAQNAVLDVTFEFPRGRATKDRLYFCVPMLDLVVPEEGELRQAVAMLETLREEQG 370

Query: 174 PVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSK 232
            V VHCA G  RS  V  A L+     +   EA   I+ RRP I +    +  L  W  
Sbjct: 371 SVLVHCALGLSRSALVVAAWLLCYGHCKTVNEAISYIRARRPQIVLTDEHKAMLRLWEN 429

Escherichia coli (strain K12) (taxid: 83333)
>sp|Q99N11|DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus GN=Dusp22 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
224100609239 predicted protein [Populus trichocarpa] 0.979 0.991 0.746 1e-104
356575498241 PREDICTED: uncharacterized protein LOC10 0.991 0.995 0.717 1e-101
225450248260 PREDICTED: uncharacterized protein ynbD 1.0 0.930 0.706 1e-101
147769337260 hypothetical protein VITISV_005246 [Viti 1.0 0.930 0.702 1e-100
388518543238 unknown [Lotus japonicus] 0.975 0.991 0.713 1e-97
255560327198 conserved hypothetical protein [Ricinus 0.818 1.0 0.747 1e-86
242055045256 hypothetical protein SORBIDRAFT_03g04052 0.987 0.933 0.615 1e-86
357125968249 PREDICTED: uncharacterized protein LOC10 0.991 0.963 0.591 5e-85
449446281243 PREDICTED: uncharacterized protein YnbD- 0.987 0.983 0.644 9e-85
218189418 350 hypothetical protein OsI_04510 [Oryza sa 0.991 0.685 0.591 2e-84
>gi|224100609|ref|XP_002311945.1| predicted protein [Populus trichocarpa] gi|222851765|gb|EEE89312.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/237 (74%), Positives = 208/237 (87%)

Query: 1   MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLG 60
           M VG+S L+ L+AT  F++FV L++L FTLLSLPFLYASLVSLL++LASHPSIN+P LL 
Sbjct: 1   MDVGLSILMGLQATALFLIFVSLQNLDFTLLSLPFLYASLVSLLVSLASHPSINIPTLLR 60

Query: 61  KKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPG 120
           KK DG+FPIWS+I+FSPY+YFVRIFS LRR  SGEEPY+E+CEG+YVGGWP S+  LPPG
Sbjct: 61  KKQDGTFPIWSLIIFSPYLYFVRIFSFLRRFTSGEEPYNEICEGVYVGGWPYSVDKLPPG 120

Query: 121 NPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCA 180
           NPAIIDCTCEFP+  EF+G SYLC+PTWDTR+PQPGEIES V+W SRKRAQN PVF+HCA
Sbjct: 121 NPAIIDCTCEFPRKEEFKGRSYLCLPTWDTRAPQPGEIESTVEWASRKRAQNVPVFIHCA 180

Query: 181 YGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLST 237
           YGHGRSVAV CALLVAL +VEDW++AE  I++RRP I MN++Q KALEEWSKHRLST
Sbjct: 181 YGHGRSVAVMCALLVALGVVEDWKKAELFIRERRPYISMNSVQYKALEEWSKHRLST 237

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356575498|ref|XP_003555877.1| PREDICTED: uncharacterized protein LOC100804705 [Glycine max] Back     alignment and taxonomy information
>gi|225450248|ref|XP_002268686.1| PREDICTED: uncharacterized protein ynbD [Vitis vinifera] gi|296080990|emb|CBI18588.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147769337|emb|CAN74774.1| hypothetical protein VITISV_005246 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388518543|gb|AFK47333.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255560327|ref|XP_002521180.1| conserved hypothetical protein [Ricinus communis] gi|223539627|gb|EEF41211.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|242055045|ref|XP_002456668.1| hypothetical protein SORBIDRAFT_03g040520 [Sorghum bicolor] gi|241928643|gb|EES01788.1| hypothetical protein SORBIDRAFT_03g040520 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357125968|ref|XP_003564661.1| PREDICTED: uncharacterized protein LOC100839588 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|449446281|ref|XP_004140900.1| PREDICTED: uncharacterized protein YnbD-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|218189418|gb|EEC71845.1| hypothetical protein OsI_04510 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
UNIPROTKB|Q5N7C8259 P0489B03.12-1 "cDNA clone:J023 0.991 0.926 0.525 1.4e-69
UNIPROTKB|Q2QXL1239 LOC_Os12g05660 "cDNA clone:J03 0.983 0.995 0.414 1.3e-54
UNIPROTKB|A8HPP7 296 CHLREDRAFT_146306 "Predicted p 0.694 0.567 0.388 1e-29
UNIPROTKB|P76093430 ynbD [Escherichia coli K-12 (t 0.673 0.379 0.300 5.7e-13
UNIPROTKB|A6V4S3449 PSPA7_2698 "Membrane protein, 0.611 0.329 0.277 2.9e-05
MGI|MGI:1915926184 Dusp22 "dual specificity phosp 0.582 0.766 0.229 0.00069
UNIPROTKB|Q5N7C8 P0489B03.12-1 "cDNA clone:J023106K01, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 705 (253.2 bits), Expect = 1.4e-69, P = 1.4e-69
 Identities = 126/240 (52%), Positives = 165/240 (68%)

Query:     1 MGVGISFLISLKATVHFIVFVFLRSLGFTLLSLPFXXXXXXXXXXXXXXHPSINLPMLLG 60
             MG GIS LI LKA V   V  F   L  TLLS P               HPSI+LP+LLG
Sbjct:     1 MGWGISRLIGLKAAVFLSVAYFFHRLDMTLLSFPLIYASVIAMLVSIASHPSIDLPLLLG 60

Query:    61 KKSDGSFPIWSIILFSPYIYFVRIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMTTLPPG 120
             K S+GSFP+WS I+FSP++ F+ +F +LRR    E  Y+E+ +G+YVGGWP+S+  LPPG
Sbjct:    61 KGSNGSFPVWSWIMFSPFLLFIHLFVLLRRFVKNEPLYTEIADGVYVGGWPSSVERLPPG 120

Query:   121 NPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCA 180
              PA+IDCTCE P+      +SYLCV TWDTR+PQP +IESAV+W  RKR+QN+ V+VHCA
Sbjct:   121 EPAVIDCTCELPRSSTISENSYLCVATWDTRAPQPSQIESAVRWALRKRSQNKAVYVHCA 180

Query:   181 YGHGRSXXXXXXXXXXXSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLSTARR 240
             YGHGRS            + EDW+ AE++I+++RP+I MN+L RK+LEEW+KH L+ ++R
Sbjct:   181 YGHGRSVCVMCALLVALGLAEDWKAAEQMIREKRPSISMNSLHRKSLEEWAKHLLTPSKR 240
GO:0000188 "inactivation of MAPK activity" evidence=IBA
GO:0006470 "protein dephosphorylation" evidence=IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IBA
GO:0033549 "MAP kinase phosphatase activity" evidence=IBA
GO:0043405 "regulation of MAP kinase activity" evidence=IBA
UNIPROTKB|Q2QXL1 LOC_Os12g05660 "cDNA clone:J033044P20, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8HPP7 CHLREDRAFT_146306 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|P76093 ynbD [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|A6V4S3 PSPA7_2698 "Membrane protein, putative" [Pseudomonas aeruginosa PA7 (taxid:381754)] Back     alignment and assigned GO terms
MGI|MGI:1915926 Dusp22 "dual specificity phosphatase 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.16LOW CONFIDENCE prediction!
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 2e-27
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 1e-14
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 9e-14
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 8e-11
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 4e-07
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  108 bits (273), Expect = 2e-27
 Identities = 62/210 (29%), Positives = 95/210 (45%), Gaps = 8/210 (3%)

Query: 30  LLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFVRIFSVLR 89
           LL+  F + SL   L+  A     NL  +  K+ DG+ P +   +F P++   R+++   
Sbjct: 29  LLTFLFAWISLSLFLVGSAY--WFNLASIFRKRQDGTIPWYIRWVFIPFLLGTRLYNAWA 86

Query: 90  RLNSGEEPYSEVCEGLYVGG--WPNSMTTLPPGN-PAIIDCTCEFPKLR--EFEGH-SYL 143
           R         ++ E LY+G   +P  +  L      AI+D T EF  L     E    YL
Sbjct: 87  RKRDSVPAIQKIDENLYLGCRLFPADLEKLKSNKITAILDVTAEFDGLDWSLTEEDIDYL 146

Query: 144 CVPTWDTRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDW 203
            +P  D   P   ++  A+ W  R+   N+ V VHCA G GRSV V  A L+        
Sbjct: 147 NIPILDHSVPTLAQLNQAINWIHRQVRANKSVVVHCALGRGRSVLVLAAYLLCKDPDLTV 206

Query: 204 REAEKLIKKRRPNIQMNALQRKALEEWSKH 233
            E  + IK+ R   ++N  Q +ALE+  + 
Sbjct: 207 EEVLQQIKQIRKTARLNKRQLRALEKMLEQ 236

Length = 547
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
PRK12361 547 hypothetical protein; Provisional 100.0
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.97
KOG1719183 consensus Dual specificity phosphatase [Defense me 99.96
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.96
KOG1718198 consensus Dual specificity phosphatase [Defense me 99.96
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.95
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.94
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.94
PTZ00242166 protein tyrosine phosphatase; Provisional 99.92
PTZ00393241 protein tyrosine phosphatase; Provisional 99.9
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.84
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.8
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.59
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.58
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.51
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.51
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.5
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 99.39
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 99.31
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.3
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.29
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.28
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 99.26
PHA02740298 protein tyrosine phosphatase; Provisional 99.25
PLN02727 986 NAD kinase 99.21
PHA02746323 protein tyrosine phosphatase; Provisional 99.17
PHA02738320 hypothetical protein; Provisional 99.15
PHA02742303 protein tyrosine phosphatase; Provisional 99.14
PHA02747312 protein tyrosine phosphatase; Provisional 99.09
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 99.03
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 98.99
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.96
COG3453130 Uncharacterized protein conserved in bacteria [Fun 98.86
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 98.83
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.78
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 98.7
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 98.66
KOG1572249 consensus Predicted protein tyrosine phosphatase [ 98.53
KOG0791374 consensus Protein tyrosine phosphatase, contains f 98.49
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 98.46
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 98.3
KOG2386 393 consensus mRNA capping enzyme, guanylyltransferase 98.21
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.18
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 98.02
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 97.92
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 97.91
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 96.72
KOG4471 717 consensus Phosphatidylinositol 3-phosphate 3-phosp 93.6
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 93.52
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 92.62
PLN02160136 thiosulfate sulfurtransferase 91.12
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 89.73
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 88.82
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 88.78
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 88.39
KOG1089 573 consensus Myotubularin-related phosphatidylinosito 87.89
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 84.88
PRK01415247 hypothetical protein; Validated 84.44
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 83.67
PRK05320257 rhodanese superfamily protein; Provisional 80.85
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 80.55
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.7e-51  Score=390.23  Aligned_cols=230  Identities=28%  Similarity=0.401  Sum_probs=204.8

Q ss_pred             chhHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHhhccCCCCcccccCCCCCCchHHHHHHHhhhhHHH
Q 026154            3 VGISFLISLKATVHFIVFVFLRSLGFTLLSLPFLYASLVSLLIALASHPSINLPMLLGKKSDGSFPIWSIILFSPYIYFV   82 (242)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~v~~ay~~~~~~~~~f~K~~~G~~~~~~~~l~~P~~~~~   82 (242)
                      |.++..++++|++++++++.+.+   ++++++++|+|+++++||+||.  ++.|++|||++||++|++++|+|+||++++
T Consensus         5 ~~~~~~y~~ga~~~~~~~~~~~~---~~~~~~~~w~~~~~~~v~~~y~--~~~~~~f~k~~~g~~~~~~~~l~~P~l~~~   79 (547)
T PRK12361          5 IHIKYYYLAGALLLLYLAVTGPS---ILLTFLFAWISLSLFLVGSAYW--FNLASIFRKRQDGTIPWYIRWVFIPFLLGT   79 (547)
T ss_pred             hHHHHHHHHHHHHHHHHHHHccH---HHHHHHHHHHHHHHHHHHHHHH--hcccHhhCCCCCCcchHHHHHHHHHHHHHH
Confidence            67899999998666663333333   3678899999999999999995  899999999999999999999999999999


Q ss_pred             HHHHHHHHhhcCCCCCceecCCeEEcCCcCccc--cC-CCCCcEEEEcCCCCCCc---ccCCCceEEEEEcCCCCCCChh
Q 026154           83 RIFSVLRRLNSGEEPYSEVCEGLYVGGWPNSMT--TL-PPGNPAIIDCTCEFPKL---REFEGHSYLCVPTWDTRSPQPG  156 (242)
Q Consensus        83 ~~~~~~~~~~~~~p~~~~I~~~L~lG~~p~~~~--~L-~~gi~~Vi~l~~e~~~~---~~~~g~~y~~iPi~D~~~p~~~  156 (242)
                      |+||.|.|..+++|++++|.|+||+|+.+...+  .| +.||++||||++|.+..   ....+++|+++|+.|+..|+.+
T Consensus        80 ~~~~~~~r~~~~~~~~~~I~~~l~lG~~~~a~d~~~L~~~gI~~Vldlt~E~~~~~~~~~~~~i~yl~iPi~D~~~p~~~  159 (547)
T PRK12361         80 RLYNAWARKRDSVPAIQKIDENLYLGCRLFPADLEKLKSNKITAILDVTAEFDGLDWSLTEEDIDYLNIPILDHSVPTLA  159 (547)
T ss_pred             HHHHHHHhcccCCCcceEEcCcEEECCCCCcccHHHHHHcCCCEEEEcccccccccccccccCceEEEeecCCCCCCcHH
Confidence            999988777778899999999999999998776  34 47999999999987652   2346789999999999999999


Q ss_pred             HHHHHHHHHHHHhhCCCcEEEEcCCCCChHHHHHHHHHHHcCCCCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHHHHhc
Q 026154          157 EIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLS  236 (242)
Q Consensus       157 ~l~~av~~i~~~~~~~~~VlVHC~~G~~RS~~vv~ayLm~~~~~~~~~eA~~~vr~~Rp~i~~n~~~~~~L~~~~~~~~~  236 (242)
                      ++++++++|++.+++|++|||||++|+|||+++++||||.++..++++||++.||++||.+.||++|+++|++|+++..-
T Consensus       160 ~l~~a~~~i~~~~~~~~~VlVHC~~G~sRSa~vv~ayLm~~~~~~~~~eA~~~vr~~Rp~v~~n~~q~~~l~~~~~~~~~  239 (547)
T PRK12361        160 QLNQAINWIHRQVRANKSVVVHCALGRGRSVLVLAAYLLCKDPDLTVEEVLQQIKQIRKTARLNKRQLRALEKMLEQGKL  239 (547)
T ss_pred             HHHHHHHHHHHHHHCCCeEEEECCCCCCcHHHHHHHHHHHhccCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHcCCc
Confidence            99999999999999999999999999999999999999987655899999999999999999999999999999887554


Q ss_pred             c
Q 026154          237 T  237 (242)
Q Consensus       237 ~  237 (242)
                      .
T Consensus       240 ~  240 (547)
T PRK12361        240 N  240 (547)
T ss_pred             c
Confidence            3

>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 7e-20
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 6e-17
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 3e-12
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 6e-11
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 6e-11
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 7e-11
3cm3_A176 Late protein H1, dual specificity protein phosphat 1e-10
3emu_A161 Leucine rich repeat and phosphatase domain contain 2e-10
2oud_A177 Dual specificity protein phosphatase 10; A central 2e-10
2hcm_A164 Dual specificity protein phosphatase; structural g 3e-10
2q05_A195 Late protein H1, dual specificity protein phosphat 4e-10
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 1e-09
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 2e-09
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 6e-09
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 7e-09
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 8e-09
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 9e-09
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 2e-08
2hxp_A155 Dual specificity protein phosphatase 9; human phos 3e-08
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 8e-08
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 1e-07
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 2e-07
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 2e-07
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-07
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 3e-07
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 3e-07
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 4e-07
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 8e-07
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 1e-06
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 1e-06
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 8e-06
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 2e-05
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 5e-05
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 8e-05
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 1e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 6e-04
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
 Score = 82.1 bits (203), Expect = 7e-20
 Identities = 36/159 (22%), Positives = 60/159 (37%), Gaps = 20/159 (12%)

Query: 98  YSEVCEGLYVGGWPNSMTTLP----PGNPAIIDCTCEFP--------KLREFEGHSYLCV 145
           Y  +   + +G  P    T           +I    E+         K  +  G   L +
Sbjct: 2   YHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRL 61

Query: 146 PTWD-TRSPQPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVA---LSIVE 201
            T D T  P    +   V++  + +A  + V+VHC  G  RS  +  A L+     S   
Sbjct: 62  STVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWS--- 118

Query: 202 DWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLSTARR 240
              EA + I K R +I +   Q + L+E+ K   + A +
Sbjct: 119 -PEEAIEAIAKIRSHISIRPSQLEVLKEFHKEITARAAK 156
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
3emu_A161 Leucine rich repeat and phosphatase domain contain 100.0
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 100.0
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 100.0
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.98
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.97
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.97
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.97
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.97
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.97
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.97
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.97
2hcm_A164 Dual specificity protein phosphatase; structural g 99.97
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.97
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.97
2oud_A177 Dual specificity protein phosphatase 10; A central 99.97
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.97
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.97
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.97
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.96
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.96
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.96
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.96
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.96
2q05_A195 Late protein H1, dual specificity protein phosphat 99.95
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.92
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.91
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.91
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.89
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.88
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.88
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.87
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.86
1xri_A151 AT1G05000; structural genomics, protein structure 99.85
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.84
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.82
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.76
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.72
2f46_A156 Hypothetical protein; structural genomics, joint c 99.68
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.68
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.43
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.43
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.39
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.37
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.35
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.33
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.33
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.32
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.32
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.31
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.3
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.3
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.29
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.29
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.29
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.27
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.27
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.26
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.26
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.26
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.26
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.26
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.25
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.25
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.24
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.23
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.22
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.21
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.19
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.18
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.17
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.17
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.14
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.13
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.08
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.08
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.07
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.05
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.04
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 99.0
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.99
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.99
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.93
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.87
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 97.38
1vee_A134 Proline-rich protein family; hypothetical protein, 90.22
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 90.01
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 88.75
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 86.96
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 81.49
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 80.28
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=100.00  E-value=4.7e-34  Score=231.03  Aligned_cols=147  Identities=14%  Similarity=0.110  Sum_probs=126.7

Q ss_pred             cCCCCCceecCCeEEcCCcCccc--cC-CCCCcEEEEcCCCCCCcccCCCceEEEEEcCCCCCCCh-hHHHHHHHHHHHH
Q 026154           93 SGEEPYSEVCEGLYVGGWPNSMT--TL-PPGNPAIIDCTCEFPKLREFEGHSYLCVPTWDTRSPQP-GEIESAVKWGSRK  168 (242)
Q Consensus        93 ~~~p~~~~I~~~L~lG~~p~~~~--~L-~~gi~~Vi~l~~e~~~~~~~~g~~y~~iPi~D~~~p~~-~~l~~av~~i~~~  168 (242)
                      ...+.+++|.|+||+|+.+.+.+  .| +.||++|||++.+.+. ....+++|+++|+.|...++. +.++++++||++.
T Consensus         5 ~p~~~~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~~-~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~   83 (161)
T 3emu_A            5 FPTLSPTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEVPS-LFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRS   83 (161)
T ss_dssp             CGGGSCEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC--------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHH
T ss_pred             CCCCCceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCCcc-ccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHH
Confidence            34567899999999999998766  34 4799999999988765 356689999999999887777 4599999999999


Q ss_pred             hhCCCcEEEEcCCCCChHHHHHHHHHHHcCCCCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHHHHhcccccC
Q 026154          169 RAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHRLSTARRE  241 (242)
Q Consensus       169 ~~~~~~VlVHC~~G~~RS~~vv~ayLm~~~~~~~~~eA~~~vr~~Rp~i~~n~~~~~~L~~~~~~~~~~~~~~  241 (242)
                      ++++++|||||.+|+|||+++++||||+..+ +++++|++.||++||.+.||++|++||.+|++++.++++++
T Consensus        84 ~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~~-~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~~~~~  155 (161)
T 3emu_A           84 IQRKEGVLIISGTGVNKAPAIVIAFLMYYQR-LSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKMNSEG  155 (161)
T ss_dssp             HHTTCEEEEEESSSSSHHHHHHHHHHHHHTT-CCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHHTCC-
T ss_pred             HhcCCeEEEEcCCCCcHHHHHHHHHHHHHhC-CCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcCCCCC
Confidence            9999999999999999999999999999886 89999999999999999999999999999999999877664
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 7e-15
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-13
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 1e-11
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 9e-11
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 3e-09
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 6e-08
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 1e-05
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 0.002
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

 Score = 67.5 bits (164), Expect = 7e-15
 Identities = 35/140 (25%), Positives = 54/140 (38%), Gaps = 6/140 (4%)

Query: 99  SEVCEGLYVGGWPNSM---TTLPPGNPAIIDCTCEFPKLREFEGH-SYLCVPTWDTRS-P 153
            E+   LY+G   +S         G   I++ T   P L E  G   Y  +P  D  S  
Sbjct: 5   VEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQN 64

Query: 154 QPGEIESAVKWGSRKRAQNRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKR 213
                  A+ +    R +N  V VH   G  RSV V  A L+   +     +A  ++K +
Sbjct: 65  LSQFFPEAISFIDEARGKNCGVLVHSLAGISRSVTVTVAYLM-QKLNLSMNDAYDIVKMK 123

Query: 214 RPNIQMNALQRKALEEWSKH 233
           + NI  N      L ++ + 
Sbjct: 124 KSNISPNFNFMGQLLDFERT 143
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 100.0
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.97
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.97
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.92
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.9
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.86
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.86
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.85
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.74
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.33
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.29
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.21
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.19
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.08
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.03
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.03
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.02
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.02
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.02
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 98.99
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 98.44
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 96.92
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 92.53
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 91.27
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 81.27
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=100.00  E-value=2.4e-33  Score=220.66  Aligned_cols=137  Identities=25%  Similarity=0.256  Sum_probs=123.0

Q ss_pred             CCceecCCeEEcCCcCccc--cC-CCCCcEEEEcCCCCCCc-ccCCCceEEEEEcCCCCCCCh-hHHHHHHHHHHHHhhC
Q 026154           97 PYSEVCEGLYVGGWPNSMT--TL-PPGNPAIIDCTCEFPKL-REFEGHSYLCVPTWDTRSPQP-GEIESAVKWGSRKRAQ  171 (242)
Q Consensus        97 ~~~~I~~~L~lG~~p~~~~--~L-~~gi~~Vi~l~~e~~~~-~~~~g~~y~~iPi~D~~~p~~-~~l~~av~~i~~~~~~  171 (242)
                      .|+||.|+||+|+...+.+  .+ +.||++|||++.|.+.. ....++.|+++|+.|.+.++. +.++++++++++.+++
T Consensus         3 ~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~   82 (144)
T d1mkpa_           3 FPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGK   82 (144)
T ss_dssp             CCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCCCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHT
T ss_pred             CCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCCccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhc
Confidence            4689999999999988776  34 47999999999888764 235779999999999877766 6799999999999999


Q ss_pred             CCcEEEEcCCCCChHHHHHHHHHHHcCCCCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHHHH
Q 026154          172 NRPVFVHCAYGHGRSVAVACALLVALSIVEDWREAEKLIKKRRPNIQMNALQRKALEEWSKHR  234 (242)
Q Consensus       172 ~~~VlVHC~~G~~RS~~vv~ayLm~~~~~~~~~eA~~~vr~~Rp~i~~n~~~~~~L~~~~~~~  234 (242)
                      |++|||||.+|+|||+++++||||++.+ +++++|+++||++||.+.||++|++||++||+.+
T Consensus        83 ~~~VlVHC~~G~~RS~~vv~aYLm~~~~-~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L  144 (144)
T d1mkpa_          83 NCGVLVHSLAGISRSVTVTVAYLMQKLN-LSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL  144 (144)
T ss_dssp             TCEEEEECSSCSHHHHHHHHHHHHHHHT-CCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred             cceEEEEecccccchHHHHHHHHHHHhC-CCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence            9999999999999999999999999875 7999999999999999999999999999998864
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure