Citrus Sinensis ID: 026296

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MLTGFHCNTLPFSCLPSRRSRTRTTDIILSALSKTPRFTSACRSSVPIHPTAFNFPTRRFSKVVSALVSEENAVATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVLCIMQVSRQFFTRPTDSLL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccEEEEEEccEEEEEcccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHHcccccEEEEcccHHHHHHcccccEEEEccccEEEEcccccccEEEEEEcccccccccccccccEEEEEccccEEEEccccccc
cccHEcccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccEEcccccHHcccccEEEEEEEcccEEEEEEcccEEEEcccccccccccccHcccccccccccccHHccccccEEEEEccccccccHHHHHHHHHHcccccEEccccHHHHHHHHHcccEEcccccEEEEEcccccEEEEEEcccccccccccccccEEEEEcccccEEEEccccccc
mltgfhcntlpfsclpsrrsrtrTTDIILSALsktprftsacrssvpihptafnfptrRFSKVVSALVSEENAVATDVFKLTYlegnswlwdldgvkvlvdpilvgnldfgipwLFDAGKKFLksfqlsdlpqvdCLLITQslddhchlktlkplskmspnlkviatpnaktlldplfqnvtyvepgqsseiegrngsklrvkatagpvlgppwqrpengvlCIMQVSrqfftrptdsll
mltgfhcntlpfsclpsrrsrtRTTDIILsalsktprftsacrssvpihptafnfptRRFSKVVSALVSEENAVATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTlkplskmspnlKVIATPNAKTLLDPLFQNVTYVepgqsseiegrngskLRVKATagpvlgppwqrpeNGVLCIMQVSrqfftrptdsll
MLTGFHCNTLPFSCLPsrrsrtrttDIILSALSKTPRFTSACRSSVPIHPTAFNFPTRRFSKVVSALVSEENAVATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVLCIMQVSRQFFTRPTDSLL
****FHCNTLPFSCLP******RTTDIILSALSKTPRFTSACRSSVPIHPTAFNFPTRRFSKVVSALVSEENAVATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYV************************VLGPPWQRPENGVLCIMQVSRQFF********
*L*****NT******************************************************************TDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVLCIMQVSRQFFTRPTDSLL
MLTGFHCNTLPFSCLPSRRSRTRTTDIILSALSKTPRFTSACRSSVPIHPTAFNFPTRRFSKVVSALVSEENAVATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVLCIMQVSRQFF********
*LTGFHCNTLPFSCLPS*************************RSSVPIHPTAFNFPTRRFSKVVSALVSEENAVATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVLCIMQVSRQFFTRPTDSLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTGFHCNTLPFSCLPSRRSRTRTTDIILSALSKTPRFTSACRSSVPIHPTAFNFPTRRFSKVVSALVSEENAVATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVLCIMQVSRQFFTRPTDSLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
255576525336 conserved hypothetical protein [Ricinus 0.883 0.630 0.616 3e-73
225423905340 PREDICTED: uncharacterized protein LOC10 0.791 0.558 0.676 7e-73
224101687 345 predicted protein [Populus trichocarpa] 0.795 0.553 0.681 6e-70
18397206 350 metallo-beta-lactamase domain-containing 0.875 0.6 0.615 7e-70
297851388 350 hypothetical protein ARALYDRAFT_473173 [ 0.833 0.571 0.580 7e-70
356499707338 PREDICTED: uncharacterized protein LOC10 0.870 0.618 0.617 7e-70
357488383334 hypothetical protein MTR_5g054360 [Medic 0.937 0.673 0.583 3e-68
449519675339 PREDICTED: uncharacterized protein LOC10 0.683 0.483 0.721 5e-68
449434654339 PREDICTED: uncharacterized protein LOC10 0.683 0.483 0.721 6e-68
116783498 369 unknown [Picea sitchensis] 0.6 0.390 0.673 8e-57
>gi|255576525|ref|XP_002529154.1| conserved hypothetical protein [Ricinus communis] gi|223531433|gb|EEF33267.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 138/224 (61%), Positives = 167/224 (74%), Gaps = 12/224 (5%)

Query: 4   GFHCNTLPFSCLPSRRSRTRTTDIILSALSKTPRFTSACRSSVPIHPTAFNFPTRRFSKV 63
             HCN LP     S   RTR        L      +S C+  + I  ++   P +R  K 
Sbjct: 2   ALHCNYLP-----SNPFRTRPFSHF--TLFSPTHLSSCCKGPICISSSSLKLPKKRLHKG 54

Query: 64  VSALVSEENAVAT-----DVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDA 118
           VSA+VSEE AV +     D  KLTYLEGNSWLW++ G+ +LVDPILVGNLDFGIPWL+DA
Sbjct: 55  VSAVVSEETAVGSSSGTNDAIKLTYLEGNSWLWEVSGINLLVDPILVGNLDFGIPWLYDA 114

Query: 119 GKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLF 178
            KK +K+FQL+DLP+VD LLITQSLDDHCHLKTLKPLS+  PN+++IATPNA+ LLDPLF
Sbjct: 115 AKKLIKNFQLNDLPEVDSLLITQSLDDHCHLKTLKPLSEKLPNIRIIATPNAQPLLDPLF 174

Query: 179 QNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVL 222
            NVTY+EPG+++EIEG+NGSK+RV+ATAGPVLGPPWQRPENG L
Sbjct: 175 CNVTYLEPGENAEIEGKNGSKVRVQATAGPVLGPPWQRPENGYL 218

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225423905|ref|XP_002281785.1| PREDICTED: uncharacterized protein LOC100247534 [Vitis vinifera] gi|297737856|emb|CBI27057.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101687|ref|XP_002312382.1| predicted protein [Populus trichocarpa] gi|222852202|gb|EEE89749.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18397206|ref|NP_564334.1| metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana] gi|12321412|gb|AAG50777.1|AC079288_6 unknown protein [Arabidopsis thaliana] gi|12323515|gb|AAG51727.1|AC068667_6 unknown protein; 129333-127623 [Arabidopsis thaliana] gi|14596083|gb|AAK68769.1| Unknown protein [Arabidopsis thaliana] gi|18377530|gb|AAL66931.1| unknown protein [Arabidopsis thaliana] gi|332192998|gb|AEE31119.1| metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297851388|ref|XP_002893575.1| hypothetical protein ARALYDRAFT_473173 [Arabidopsis lyrata subsp. lyrata] gi|297339417|gb|EFH69834.1| hypothetical protein ARALYDRAFT_473173 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356499707|ref|XP_003518678.1| PREDICTED: uncharacterized protein LOC100798986 [Glycine max] Back     alignment and taxonomy information
>gi|357488383|ref|XP_003614479.1| hypothetical protein MTR_5g054360 [Medicago truncatula] gi|355515814|gb|AES97437.1| hypothetical protein MTR_5g054360 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449519675|ref|XP_004166860.1| PREDICTED: uncharacterized protein LOC101230153 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449434654|ref|XP_004135111.1| PREDICTED: uncharacterized protein LOC101203294 [Cucumis sativus] Back     alignment and taxonomy information
>gi|116783498|gb|ABK22966.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
TAIR|locus:2013723 350 AT1G29700 "AT1G29700" [Arabido 0.870 0.597 0.608 8.2e-67
TAIR|locus:2013723 AT1G29700 "AT1G29700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 679 (244.1 bits), Expect = 8.2e-67, P = 8.2e-67
 Identities = 137/225 (60%), Positives = 160/225 (71%)

Query:     6 HCNTLPFSCLPXXXXXXXXXDIILSALSKTPRFTSACRS-SVPIHPTAFNFPTRRFSKVV 64
             H N+LP S                   S TP   S  RS S+ + P        R   VV
Sbjct:    16 HANSLPLSINTKSRVLSASA---FPLFSSTPHLPS--RSLSIRLSPNV-----SRSLTVV 65

Query:    65 SALVSEENAV-----ATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAG 119
             S+++SE+ A       TD FKLTYLEGNSWLW+  G+K+LVDPILVGNLDFGIPWL+DA 
Sbjct:    66 SSVLSEDRATNVSGSGTDAFKLTYLEGNSWLWETAGLKILVDPILVGNLDFGIPWLYDAA 125

Query:   120 KKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQ 179
             K++LK+F+L DLP+VDCLLITQSLDDHCHL TL+PLS+ SP +KVIATPNAK LLDPLF 
Sbjct:   126 KRYLKAFKLDDLPEVDCLLITQSLDDHCHLNTLRPLSEKSPGIKVIATPNAKPLLDPLFS 185

Query:   180 NVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQRPENGVLCI 224
             NVTY+EPG S E+  RNGSK+RVKATAGPVLGPPWQRPENG L +
Sbjct:   186 NVTYLEPGDSFELNARNGSKVRVKATAGPVLGPPWQRPENGYLLV 230


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.321   0.137   0.426    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      240       231   0.00084  113 3  11 22  0.39    33
                                                     32  0.42    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  608 (65 KB)
  Total size of DFA:  188 KB (2107 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  19.46u 0.11s 19.57t   Elapsed:  00:00:01
  Total cpu time:  19.46u 0.11s 19.57t   Elapsed:  00:00:01
  Start:  Fri May 10 06:22:18 2013   End:  Fri May 10 06:22:19 2013
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030297001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (340 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00023910001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (216 aa)
  ••    0.482
GSVIVG00028499001
RecName- Full=Photosystem II reaction center psb28 protein; (179 aa)
  ••    0.463
GSVIVG00037015001
SubName- Full=Chromosome chr1 scaffold_84, whole genome shotgun sequence; (198 aa)
  ••    0.442
GSVIVG00028771001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (378 aa)
  ••    0.425
GSVIVG00019961001
SubName- Full=Putative uncharacterized protein (Chromosome chr5 scaffold_2, whole genome shotgu [...] (204 aa)
  ••    0.423
GSVIVG00023726001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (204 aa)
  ••    0.421
GSVIVG00001938001
SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (229 aa)
  ••    0.421
GSVIVG00025052001
SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (226 aa)
   •    0.410
GSVIVG00013467001
SubName- Full=Chromosome undetermined scaffold_484, whole genome shotgun sequence; (332 aa)
  ••    0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
pfam13483158 pfam13483, Lactamase_B_3, Beta-lactamase superfami 1e-14
COG2220 258 COG2220, COG2220, Predicted Zn-dependent hydrolase 6e-05
>gnl|CDD|222167 pfam13483, Lactamase_B_3, Beta-lactamase superfamily domain Back     alignment and domain information 
 Score = 69.1 bits (170), Expect = 1e-14
 Identities = 26/143 (18%), Positives = 43/143 (30%), Gaps = 52/143 (36%)

Query: 80  KLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLI 139
            +T+L  +S+L +  G ++L DP LVG      P                     D +LI
Sbjct: 1   TITWLGHSSFLIEGGGKRILTDPFLVG---GRPPP-----------------VDADVVLI 40

Query: 140 TQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSK 199
           + + DDH H   L                           N   +  G S  + G     
Sbjct: 41  SHAHDDHGHPDPLP-------------------------GNPHVLNGGGSYTVGG----- 70

Query: 200 LRVKATAGP--VLGPPWQRPENG 220
           L ++        +G   +   + 
Sbjct: 71  LEIRGVPTDHDRVGGRRRGGNSI 93

This family is part of the beta-lactamase superfamily and is related to pfam00753. Length = 158
>gnl|CDD|225130 COG2220, COG2220, Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
COG2220258 Predicted Zn-dependent hydrolases of the beta-lact 99.91
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 99.89
PRK00685228 metal-dependent hydrolase; Provisional 99.87
KOG3798 343 consensus Predicted Zn-dependent hydrolase (beta-l 99.8
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 99.78
PRK11244250 phnP carbon-phosphorus lyase complex accessory pro 99.33
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 99.27
PRK02113252 putative hydrolase; Provisional 99.26
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 99.24
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.15
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 99.14
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB 99.14
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 99.13
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.11
PRK04286 298 hypothetical protein; Provisional 99.1
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.06
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 99.03
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 98.99
PLN02469 258 hydroxyacylglutathione hydrolase 98.99
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 98.91
TIGR02108302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 98.87
PLN02398 329 hydroxyacylglutathione hydrolase 98.85
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 98.8
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 98.8
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 98.77
PLN02962251 hydroxyacylglutathione hydrolase 98.74
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 98.72
PRK02126 334 ribonuclease Z; Provisional 98.68
COG1782 637 Predicted metal-dependent RNase, consists of a met 98.66
COG1237259 Metal-dependent hydrolases of the beta-lactamase s 98.63
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 98.59
COG2248 304 Predicted hydrolase (metallo-beta-lactamase superf 98.5
PRK00055 270 ribonuclease Z; Reviewed 98.49
KOG0813 265 consensus Glyoxylase [General function prediction 98.45
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 98.43
PRK11539 755 ComEC family competence protein; Provisional 98.18
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 98.15
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 98.02
KOG1136 501 consensus Predicted cleavage and polyadenylation s 98.0
KOG1135 764 consensus mRNA cleavage and polyadenylation factor 97.96
COG2333293 ComEC Predicted hydrolase (metallo-beta-lactamase 97.84
KOG1137 668 consensus mRNA cleavage and polyadenylation factor 97.79
KOG0814237 consensus Glyoxylase [General function prediction 97.71
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 97.54
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 97.34
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 97.03
KOG1361 481 consensus Predicted hydrolase involved in interstr 94.69
KOG2121 746 consensus Predicted metal-dependent hydrolase (bet 93.58
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 92.02
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information 
Probab=99.91  E-value=6.9e-24  Score=185.67  Aligned_cols=143  Identities=22%  Similarity=0.269  Sum_probs=113.7

Q ss_pred             cCCcceEEEeCCcEEEEEeCCcEEEEcCccCCCCcccccccccCCCcccCccCCCCCCCccEEEecCCCCCCCChhhHHH
Q 026296           75 ATDVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKP  154 (240)
Q Consensus        75 ~~~~~~it~lGhss~li~~~g~~ILiDP~~~~~~~~p~~~~~~~~~~~~~~~~~~~lp~iD~VLISH~H~DHld~~tl~~  154 (240)
                      ..+.|+|||+||||++|+.++++||||||++++.+ +..+.+        .....+++++|+|+|||+|+||+|.+++.+
T Consensus         3 ~~~~m~itwlGha~~lie~~~~~iliDP~~~~~~~-~~~~~~--------~~~~~~~~~~D~ilitH~H~DHl~~~~~~~   73 (258)
T COG2220           3 SAEDMKITWLGHAAFLIETGGKRILIDPVLSGAPS-PSNFPG--------GLFEDLLPPIDYILITHDHYDHLDDETLIA   73 (258)
T ss_pred             CCcCceEEEecceEEEEEECCEEEEECcccCCCCC-cccccC--------cCChhhcCCCCEEEEeCCCccccCHHHHHH
Confidence            35689999999999999999999999999998766 322110        122456778999999999999999999888


Q ss_pred             hhhhCCCCeEEEccChHH-HHhhh---cCceEEeCCCCeEEEceecCCcEEEEEEcCCCCCCC-C-------CCCcceEE
Q 026296          155 LSKMSPNLKVIATPNAKT-LLDPL---FQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPP-W-------QRPENGVL  222 (240)
Q Consensus       155 l~~~~p~~~v~~~p~~~~-~l~~~---~~~i~~l~~ge~~~l~~~~~~~~~I~~~Pa~h~g~~-~-------~~~~~G~v  222 (240)
                      +...  ++++++++++.. .+.++   ..++.+++||+++++     ++++|+++++.|.... +       ....+||+
T Consensus        74 ~~~~--~~~~~~~p~~~~~~~~~~g~~~~~~~~~~~~~~~~~-----~~~~i~~~~a~h~~~~~~~~~~~~~~~~~~~~v  146 (258)
T COG2220          74 LRTN--KAPVVVVPLGAGDLLIRDGVEAERVHELGWGDVIEL-----GDLEITAVPAYHVSARHLPGRGIRPTGLWVGYV  146 (258)
T ss_pred             HhcC--CCcEEEeHHHHHHHHHhcCCCcceEEeecCCceEEe-----cCcEEEEEEeecccccccCCCCccccCCceEEE
Confidence            7742  477888899885 55455   457999999999999     8999999999886532 1       12357999


Q ss_pred             EEEeCCCEEEEc
Q 026296          223 CIMQVSRQFFTR  234 (240)
Q Consensus       223 i~~~~~~~~y~~  234 (240)
                      | +..+.++|++
T Consensus       147 i-~~~g~~iyh~  157 (258)
T COG2220         147 I-ETPGGRVYHA  157 (258)
T ss_pred             E-EeCCceEEec
Confidence            9 7788999975

>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>KOG3798 consensus Predicted Zn-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>KOG0813 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>KOG1136 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG1135 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG0814 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>KOG1361 consensus Predicted hydrolase involved in interstrand cross-link repair [Replication, recombination and repair] Back     alignment and domain information
>KOG2121 consensus Predicted metal-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
3kl7_A235 Putative metal-dependent hydrolase; structural gen 1e-06
3rpc_A264 Possible metal-dependent hydrolase; structural gen 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 4e-06
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 1e-04
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Length = 235 Back     alignment and structure
 Score = 47.3 bits (113), Expect = 1e-06
 Identities = 21/126 (16%), Positives = 45/126 (35%), Gaps = 29/126 (23%)

Query: 80  KLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLI 139
            +T+++  S +   D   + VDP+                         +  P+ D +LI
Sbjct: 31  TITFIKHGSLMLTYDNHSIQVDPVSEYAD-------------------YTTFPKADIILI 71

Query: 140 TQSLDDHCHLKTLKPLSKMSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSK 199
           T    DH   K ++ + K   + ++IA  N++  L    +          + I       
Sbjct: 72  THEHGDHLDPKAIQAVEK--SDTEIIANENSQKKLG---KGKVLKNGDTDTSISY----- 121

Query: 200 LRVKAT 205
           ++++A 
Sbjct: 122 MKIEAV 127
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Length = 264 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Length = 379 Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Length = 360 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
3rpc_A264 Possible metal-dependent hydrolase; structural gen 99.9
3kl7_A235 Putative metal-dependent hydrolase; structural gen 99.86
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 99.85
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 99.83
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 99.53
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 99.46
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.42
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.41
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.41
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.4
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.36
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.33
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.31
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.3
2az4_A 429 Hypothetical protein EF2904; structural genomics, 99.3
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.28
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.27
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.24
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.24
4efz_A 298 Metallo-beta-lactamase family protein; structural 99.22
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.2
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.19
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.19
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 99.17
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.17
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.15
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.12
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 99.12
3esh_A280 Protein similar to metal-dependent hydrolase; stru 99.11
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.11
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 99.09
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.09
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.07
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 99.06
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 99.06
3adr_A261 Putative uncharacterized protein ST1585; quorum se 99.04
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.04
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 99.03
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethyl 99.02
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.02
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.01
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 98.99
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 98.99
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 98.98
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 98.98
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 98.98
3r2u_A 466 Metallo-beta-lactamase family protein; structural 98.98
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 98.96
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 98.96
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 98.94
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 98.93
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 98.93
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 98.93
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 98.93
1ztc_A221 Hypothetical protein TM0894; structural genomics, 98.9
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 98.89
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 98.85
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 98.84
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 98.84
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 98.81
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 98.79
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 98.78
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.7
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 98.56
2p97_A201 Hypothetical protein; putative metal-dependent hyd 98.55
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 98.48
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 98.4
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 98.33
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 98.3
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 96.72
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 97.35
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
Probab=99.90  E-value=1.2e-23  Score=182.73  Aligned_cols=149  Identities=15%  Similarity=0.225  Sum_probs=108.0

Q ss_pred             CcceEEEeCCcEEEEEeCCcEEEEcCccCCCCcccccccccCCCcc---cC--ccCCCCCC-CccEEEecCCCCCCCChh
Q 026296           77 DVFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKF---LK--SFQLSDLP-QVDCLLITQSLDDHCHLK  150 (240)
Q Consensus        77 ~~~~it~lGhss~li~~~g~~ILiDP~~~~~~~~p~~~~~~~~~~~---~~--~~~~~~lp-~iD~VLISH~H~DHld~~  150 (240)
                      ..|+|||+|||||+|+.+|++|||||++++++++ .++.+....++   ..  ++++++++ ++|+|||||.|+||++..
T Consensus         3 ~~m~it~lGha~~li~~~g~~iLiDp~~s~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~l~~~id~iliTH~H~DH~~~~   81 (264)
T 3rpc_A            3 AMTQYTHIRNATGKLTIKNTTFLIDPFLAPKDTY-PGFEGTFNYQQRMPMVDLPLSMDDLLSNVTAVVVTHTHLDHWDDT   81 (264)
T ss_dssp             CCCEEEEEETTEEEEEETTEEEEESCCCCCTTCB-CCCTTBTTTTSCBSSSCCSSCHHHHHTTCCEEECSCCCGGGSCHH
T ss_pred             ceEEEEEEeCcEEEEEECCEEEEeCcccCCCcCc-cCCCCcccccccCCCCCCCCCHHHccccCCEEEECCCchhhCCCH
Confidence            3589999999999999999999999999987763 23332111111   11  35556665 899999999999999976


Q ss_pred             hHHHhhhhCCCCeEEEccChH-HHHhhh-cCceEEeCCCCeEEEceecCCcEEEEEEcCCCCCCCC---------CCCcc
Q 026296          151 TLKPLSKMSPNLKVIATPNAK-TLLDPL-FQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPW---------QRPEN  219 (240)
Q Consensus       151 tl~~l~~~~p~~~v~~~p~~~-~~l~~~-~~~i~~l~~ge~~~l~~~~~~~~~I~~~Pa~h~g~~~---------~~~~~  219 (240)
                      ++..+.   .++++|+++.+. ..++++ +.++.++  ++++++     ++++|+++|++|.....         ....+
T Consensus        82 ~~~~~~---~~~~v~~~~~~~~~~l~~~g~~~~~~~--~~~~~~-----~~~~i~~~pa~H~~~~~~~~p~~~~~~~~~~  151 (264)
T 3rpc_A           82 AINSIP---KSLPIFVQNTADKELITSQGFIDVRII--FESLEF-----NGITLRKTGGSHGTVEMYANPVLAPLAGDAM  151 (264)
T ss_dssp             HHHHSC---TTSCEEESSHHHHHHHHHTTCSCEEEC--SSEEEE-----TTEEEEEECCCSSCHHHHTSTTHHHHHCCCC
T ss_pred             HHHhhc---cCCeEEEeCHHHHHHHHhcCCCeeEEe--cccEEE-----CCEEEEEeccccCCccccccccccccccccE
Confidence            655543   378999984444 477776 6667665  689999     89999999999974210         02358


Q ss_pred             eEEEEEeC-CCEEEEccCCC
Q 026296          220 GVLCIMQV-SRQFFTRPTDS  238 (240)
Q Consensus       220 G~vi~~~~-~~~~y~~~~~~  238 (240)
                      ||+| +.+ ++++|+. +|+
T Consensus       152 g~~i-~~~~~~~i~~~-GDt  169 (264)
T 3rpc_A          152 GVIF-EAADEPTVYLV-GDT  169 (264)
T ss_dssp             EEEE-ECTTSCCEEEC-CSC
T ss_pred             EEEE-EeCCccEEEEE-CCc
Confidence            9999 554 7788865 454
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 99.77
d1zkpa1244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.58
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.35
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.19
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 99.1
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 99.05
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.03
d2gmna1264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.01
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 98.97
d1k07a_262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 98.97
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 98.85
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 98.85
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.82
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 98.81
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 98.77
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.75
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 98.72
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 98.7
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.7
d1p9ea_294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 98.63
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 98.6
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 98.51
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 98.51
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.5
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 98.29
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 98.28
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.21
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 98.0
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 97.93
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 97.92
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 97.42
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Hypothetical protein TM0207
domain: Hypothetical protein TM0207
species: Thermotoga maritima [TaxId: 2336]

Probab=99.77  E-value=3.5e-19  Score=148.47  Aligned_cols=108  Identities=11%  Similarity=0.099  Sum_probs=73.2

Q ss_pred             cceEEEeCCcEEEEEeCCcEEEEcCccCCCCcccccccccCCCcccCccCCCCCCCccEEEecCCCCCCCChhhHHHhhh
Q 026296           78 VFKLTYLEGNSWLWDLDGVKVLVDPILVGNLDFGIPWLFDAGKKFLKSFQLSDLPQVDCLLITQSLDDHCHLKTLKPLSK  157 (240)
Q Consensus        78 ~~~it~lGhss~li~~~g~~ILiDP~~~~~~~~p~~~~~~~~~~~~~~~~~~~lp~iD~VLISH~H~DHld~~tl~~l~~  157 (240)
                      .|+|||+|||||+|+.+|.+|||||+++.... +.                .+ .++|+||+||+|+||++...++    
T Consensus         1 ~MkItwlGhs~~lIe~~g~~iliDP~~~~~~~-~~----------------~~-~~~D~VliSH~H~DH~~~~~~~----   58 (209)
T d1vjna_           1 HMKITWFGHACFALEMEGKTIVTDPFDESVGY-PI----------------PN-VTADVVTESHQHFDHNAHHLVK----   58 (209)
T ss_dssp             CEEEEEEETTEEEEEETTEEEEESCCC------CC----------------CC-CBCSEEECSSCC---CGGGGCB----
T ss_pred             CeEEEEecccEEEEEECCEEEEECCCCCccCC-CC----------------cc-CcCCEEEECCCCCCcCchhhcc----
Confidence            38999999999999999999999998654221 11                11 1469999999999998643321    


Q ss_pred             hCCCCeEEEccChHHHHhhhcCceEEeCCCCeEEEceecCCcEEEEEEcCCCCCCCCCC--CcceEEEEEeCCCEEEEc
Q 026296          158 MSPNLKVIATPNAKTLLDPLFQNVTYVEPGQSSEIEGRNGSKLRVKATAGPVLGPPWQR--PENGVLCIMQVSRQFFTR  234 (240)
Q Consensus       158 ~~p~~~v~~~p~~~~~l~~~~~~i~~l~~ge~~~l~~~~~~~~~I~~~Pa~h~g~~~~~--~~~G~vi~~~~~~~~y~~  234 (240)
                                           .+...+.+++++++     ++++|+++|+.|.......  ...||+| +.++.++|+.
T Consensus        59 ---------------------~~~~~~~~~g~~~~-----~~~~i~~v~a~h~~~~~~~~~~~~~~~i-~~~g~~i~~~  110 (209)
T d1vjna_          59 ---------------------GNFRVIDRPGAYTV-----NGVKIKGVETFHDPSHGRERGKNIVFVF-EGEGIKVCHL  110 (209)
T ss_dssp             ---------------------SSCEEECSSEEEEE-----TTEEEEEEEEEEC-------CEEEEEEE-EETTEEEEEC
T ss_pred             ---------------------cccccccCcCcEec-----CCceeeeeeeeecCCCCccCCcceEEEE-EcCCcEEEEe
Confidence                                 11234567788999     8999999999886433221  2368999 7788899975
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure