Citrus Sinensis ID: 026313


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MAEASPAAANAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSISNYFFI
cccccccccccccEEcccccccEEEEEEEEEccHHHHHHHHHHccccEEEEEEEcccccEEEEEEcccccccccEEEEEEcccccccccccccEEEEEEEccHHHHHHHHHHcccEEEEccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEccHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEccccccccEEEEEEEccccccccccccccccccccccccccccc
cccccccccHHHHHccccccccEEEEEEEEEccHHHHHHHHHHHHccHEEEEcccccccEEEEEEEcccccccEEEEEEEcccccccccccccEEEEEEcccHHHHHHHHHHcccEEEEcccccccccEEEEEEEcccccEEEEEEcccccccccEEEEEEccHHHHHHHHHHHHccEEEEEcccccccEEEEEEEcccccccEEEEEEEccccccccccccEEcEccccccccccEEEc
MAEASPAAANAELLewpkkdkrrFLHAVYRVGDLDRTIKFYTECFGmkllrkrdvpeekysnaflgfgpeqSHFVVELTYNygvtsydigtgfghfaIATEDVYKLVENIRAkggnvtrepgplkggtthiafvkdpdgyIFELiqrgptpeplCQVMLRVGDLGRSIKFYEKALGMKLlrtvdkpeyKYTLAMLGYAEEDQTTVLELTYnygvteytkgnayaqvntspsgsisnyffi
MAEASPAAANAellewpkkdkrrfLHAVyrvgdldrtiKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKggnvtrepgplkgGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKAlgmkllrtvdKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNayaqvntspsgsisnyffi
MaeaspaaanaelleWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSISNYFFI
*************LEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQV**************
******A*ANAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSISNYFFI
*********NAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSISNYFFI
*********NAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSISNYFFI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEASPAAANAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSISNYFFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query240 2.2.26 [Sep-21-2011]
Q39366282 Putative lactoylglutathio N/A no 0.908 0.773 0.821 1e-106
Q948T6291 Lactoylglutathione lyase yes no 0.941 0.776 0.798 1e-104
Q8W593350 Probable lactoylglutathio no no 0.937 0.642 0.746 1e-100
P46235138 Probable lactoylglutathio yes no 0.520 0.905 0.616 9e-42
Q9KT93138 Probable lactoylglutathio no no 0.529 0.920 0.590 3e-40
P0A1Q2135 Lactoylglutathione lyase yes no 0.516 0.918 0.588 2e-38
P0A1Q3135 Lactoylglutathione lyase N/A no 0.516 0.918 0.588 2e-38
P0AC83135 Lactoylglutathione lyase yes no 0.516 0.918 0.588 3e-38
P0AC81135 Lactoylglutathione lyase N/A no 0.516 0.918 0.588 3e-38
P0AC82135 Lactoylglutathione lyase N/A no 0.516 0.918 0.588 3e-38
>sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 Back     alignment and function desciption
 Score =  384 bits (987), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 203/219 (92%), Gaps = 1/219 (0%)

Query: 8   AANAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGF 67
           A NA+L+EWPKKDKRRFLH VYRVGDLDRTI+FYTECFGMK+LRKRDVPEEKYSNAFLGF
Sbjct: 2   AENADLVEWPKKDKRRFLHVVYRVGDLDRTIQFYTECFGMKVLRKRDVPEEKYSNAFLGF 61

Query: 68  GPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGG 127
           GPE S+FVVELTYNYGV+SYDIGTGFGHFAI+T+DV K+VE +RAKGGNVTREPGP+KGG
Sbjct: 62  GPETSNFVVELTYNYGVSSYDIGTGFGHFAISTQDVSKMVEAVRAKGGNVTREPGPVKGG 121

Query: 128 TTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPE 187
            + IAFVKDPDGY FELIQRGPTPEPLCQVMLRVGDL R++KF EKALGM+LLR +++PE
Sbjct: 122 GSVIAFVKDPDGYTFELIQRGPTPEPLCQVMLRVGDLDRAVKFMEKALGMRLLRRIERPE 181

Query: 188 YKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQV 226
           Y  T+ M+GYAEE ++ VLELTYNYGVTEYTKGNAYAQ+
Sbjct: 182 YN-TIGMMGYAEEYESIVLELTYNYGVTEYTKGNAYAQI 219




Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.
Brassica oleracea var. gemmifera (taxid: 178616)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 5
>sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 Back     alignment and function description
>sp|Q8W593|LGUC_ARATH Probable lactoylglutathione lyase, chloroplast OS=Arabidopsis thaliana GN=At1g67280 PE=2 SV=1 Back     alignment and function description
>sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 Back     alignment and function description
>sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 Back     alignment and function description
>sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 Back     alignment and function description
>sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
2213425291 hypothetical protein [Citrus x paradisi] 0.891 0.735 0.990 1e-123
211906514289 lactoylglutathione lyase [Gossypium hirs 0.937 0.778 0.864 1e-115
449433964292 PREDICTED: putative lactoylglutathione l 0.941 0.773 0.872 1e-114
255554865280 lactoylglutathione lyase, putative [Rici 0.925 0.792 0.880 1e-113
356555674287 PREDICTED: putative lactoylglutathione l 0.933 0.780 0.871 1e-112
356531939296 PREDICTED: putative lactoylglutathione l 0.933 0.756 0.862 1e-112
359483362292 PREDICTED: lactoylglutathione lyase [Vit 0.937 0.770 0.834 1e-112
224078584294 predicted protein [Populus trichocarpa] 0.954 0.778 0.852 1e-111
312281931289 unnamed protein product [Thellungiella h 0.925 0.768 0.840 1e-111
388520197284 unknown [Lotus japonicus] 0.887 0.75 0.861 1e-108
>gi|2213425|emb|CAB09799.1| hypothetical protein [Citrus x paradisi] Back     alignment and taxonomy information
 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 216/218 (99%), Positives = 216/218 (99%)

Query: 12  ELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQ 71
           ELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQ
Sbjct: 12  ELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQ 71

Query: 72  SHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHI 131
           SHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHI
Sbjct: 72  SHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHI 131

Query: 132 AFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYT 191
           AFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYT
Sbjct: 132 AFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYT 191

Query: 192 LAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTS 229
           LAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQV  S
Sbjct: 192 LAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAIS 229




Source: Citrus x paradisi

Species: Citrus x paradisi

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|211906514|gb|ACJ11750.1| lactoylglutathione lyase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|449433964|ref|XP_004134766.1| PREDICTED: putative lactoylglutathione lyase-like [Cucumis sativus] gi|449479479|ref|XP_004155610.1| PREDICTED: putative lactoylglutathione lyase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255554865|ref|XP_002518470.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223542315|gb|EEF43857.1| lactoylglutathione lyase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356555674|ref|XP_003546155.1| PREDICTED: putative lactoylglutathione lyase-like [Glycine max] Back     alignment and taxonomy information
>gi|356531939|ref|XP_003534533.1| PREDICTED: putative lactoylglutathione lyase-like [Glycine max] Back     alignment and taxonomy information
>gi|359483362|ref|XP_002273346.2| PREDICTED: lactoylglutathione lyase [Vitis vinifera] gi|302144130|emb|CBI23235.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224078584|ref|XP_002305564.1| predicted protein [Populus trichocarpa] gi|222848528|gb|EEE86075.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|312281931|dbj|BAJ33831.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|388520197|gb|AFK48160.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
TAIR|locus:2019574350 AT1G67280 [Arabidopsis thalian 0.879 0.602 0.777 2.7e-91
UNIPROTKB|Q9KT93138 gloA "Probable lactoylglutathi 0.516 0.898 0.604 2.1e-38
TIGR_CMR|VC_1010138 VC_1010 "lactoylglutathione ly 0.516 0.898 0.604 2.1e-38
UNIPROTKB|P0AC81135 gloA "GloA" [Escherichia coli 0.516 0.918 0.588 1.3e-36
TIGR_CMR|SO_2044136 SO_2044 "lactoylglutathione ly 0.516 0.911 0.584 1.5e-35
DICTYBASE|DDB_G0291265136 gloA "glyoxylase I" [Dictyoste 0.516 0.911 0.548 3.2e-33
POMBASE|SPBC12C2.12c302 glo1 "glyoxalase I" [Schizosac 0.658 0.523 0.336 4e-27
RGD|1307010298 Glod4 "glyoxalase domain conta 0.754 0.607 0.349 9e-22
UNIPROTKB|Q9HC38313 GLOD4 "Glyoxalase domain-conta 0.558 0.428 0.377 1.7e-21
ZFIN|ZDB-GENE-040912-38298 glod4 "glyoxalase domain conta 0.712 0.573 0.361 8e-21
TAIR|locus:2019574 AT1G67280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 910 (325.4 bits), Expect = 2.7e-91, P = 2.7e-91
 Identities = 164/211 (77%), Positives = 184/211 (87%)

Query:    16 WPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFV 75
             W K DKRR LH VYRVGD+DRTIKFYTEC GMKLLRKRD+PEEKY+NAFLG+GPE SHFV
Sbjct:    81 WVKNDKRRMLHVVYRVGDMDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFV 140

Query:    76 VELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVK 135
             +ELTYNYGV  YDIG GFGHF IA +DV K VE ++AKGG V+REPGP+KGG T IAF++
Sbjct:   141 IELTYNYGVDKYDIGAGFGHFGIAVDDVAKTVELVKAKGGKVSREPGPVKGGKTVIAFIE 200

Query:   136 DPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAML 195
             DPDGY FEL++RGPTPEPLCQVMLRVGDL R+IKFYEKA GM+LLRT D PEYKYT+AM+
Sbjct:   201 DPDGYKFELLERGPTPEPLCQVMLRVGDLDRAIKFYEKAFGMELLRTRDNPEYKYTIAMM 260

Query:   196 GYAEEDQTTVLELTYNYGVTEYTKGNAYAQV 226
             GY  ED+  VLELTYNYGVTEY KGNAYAQ+
Sbjct:   261 GYGPEDKFPVLELTYNYGVTEYDKGNAYAQI 291


GO:0004462 "lactoylglutathione lyase activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=ISS
GO:0046872 "metal ion binding" evidence=IEA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0010319 "stromule" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
UNIPROTKB|Q9KT93 gloA "Probable lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1010 VC_1010 "lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0AC81 gloA "GloA" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2044 SO_2044 "lactoylglutathione lyase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291265 gloA "glyoxylase I" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC12C2.12c glo1 "glyoxalase I" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|1307010 Glod4 "glyoxalase domain containing 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HC38 GLOD4 "Glyoxalase domain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-38 glod4 "glyoxalase domain containing 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39366LGUL_BRAOG4, ., 4, ., 1, ., 50.82190.90830.7730N/Ano
Q948T6LGUL_ORYSJ4, ., 4, ., 1, ., 50.79820.94160.7766yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.4.1LOW CONFIDENCE prediction!
4th Layer4.4.1.50.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00010980001
SubName- Full=Chromosome chr10 scaffold_297, whole genome shotgun sequence; (292 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00029246001
SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (258 aa)
      0.924
GSVIVG00038137001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (483 aa)
       0.800
GSVIVG00027369001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (458 aa)
       0.800
GSVIVG00023836001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (316 aa)
       0.800
GSVIVG00016002001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (703 aa)
       0.800
GSVIVG00009475001
SubName- Full=Chromosome undetermined scaffold_235, whole genome shotgun sequence; (770 aa)
       0.800
GSVIVG00006903001
SubName- Full=Chromosome chr10 scaffold_179, whole genome shotgun sequence; (407 aa)
       0.800
GSVIVG00000550001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (476 aa)
       0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
PLN02300286 PLN02300, PLN02300, lactoylglutathione lyase 1e-162
TIGR00068150 TIGR00068, glyox_I, lactoylglutathione lyase 4e-85
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 5e-57
PRK10291129 PRK10291, PRK10291, glyoxalase I; Provisional 9e-47
PLN02300286 PLN02300, PLN02300, lactoylglutathione lyase 4e-44
TIGR00068150 TIGR00068, glyox_I, lactoylglutathione lyase 1e-28
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 4e-28
cd08358127 cd08358, Glo_EDI_BRP_like_21, This conserved domai 8e-27
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 1e-25
PRK10291129 PRK10291, PRK10291, glyoxalase I; Provisional 7e-24
cd06587110 cd06587, Glo_EDI_BRP_like, This domain superfamily 3e-19
PLN03042185 PLN03042, PLN03042, Lactoylglutathione lyase; Prov 2e-18
PLN02367233 PLN02367, PLN02367, lactoylglutathione lyase 3e-17
pfam12681109 pfam12681, Glyoxalase_2, Glyoxalase-like domain 6e-14
cd08358127 cd08358, Glo_EDI_BRP_like_21, This conserved domai 2e-13
COG0346138 COG0346, GloA, Lactoylglutathione lyase and relate 2e-11
cd07245114 cd07245, Glo_EDI_BRP_like_9, This conserved domain 7e-10
PLN03042185 PLN03042, PLN03042, Lactoylglutathione lyase; Prov 4e-09
cd08362120 cd08362, BphC5-RrK37_N_like, N-terminal, non-catal 7e-09
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 1e-08
PLN02367233 PLN02367, PLN02367, lactoylglutathione lyase 2e-08
cd07249128 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) 2e-08
cd08354122 cd08354, Glo_EDI_BRP_like_13, This conserved domai 3e-08
TIGR03081128 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epim 5e-08
cd07255125 cd07255, Glo_EDI_BRP_like_12, This conserved domai 1e-06
cd07247114 cd07247, SgaA_N_like, N-terminal domain of Strepto 3e-06
cd07242128 cd07242, Glo_EDI_BRP_like_6, This conserved domain 5e-06
cd07263120 cd07263, Glo_EDI_BRP_like_16, This conserved domai 1e-05
TIGR02295294 TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-di 1e-05
cd08348134 cd08348, BphC2-C3-RGP6_C_like, The single-domain 2 1e-05
cd07253125 cd07253, Glo_EDI_BRP_like_2, This conserved domain 2e-05
cd08346126 cd08346, PcpA_N_like, N-terminal domain of Sphingo 5e-05
pfam13669110 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resi 7e-05
COG0346138 COG0346, GloA, Lactoylglutathione lyase and relate 2e-04
cd08349112 cd08349, BLMA_like, Bleomycin binding protein (BLM 2e-04
cd07251120 cd07251, Glo_EDI_BRP_like_10, This conserved domai 2e-04
COG3324127 COG3324, COG3324, Predicted enzyme related to lact 2e-04
cd08343131 cd08343, ED_TypeI_classII_C, C-terminal domain of 2e-04
cd08345113 cd08345, Fosfomycin_RP, Fosfomycin resistant prote 3e-04
pfam13468174 pfam13468, Glyoxalase_3, Glyoxalase-like domain 4e-04
cd08352125 cd08352, Glo_EDI_BRP_like_1, This conserved domain 9e-04
cd06587110 cd06587, Glo_EDI_BRP_like, This domain superfamily 0.001
cd07255125 cd07255, Glo_EDI_BRP_like_12, This conserved domai 0.001
cd07262123 cd07262, Glo_EDI_BRP_like_19, This conserved domai 0.001
>gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase Back     alignment and domain information
 Score =  450 bits (1159), Expect = e-162
 Identities = 185/226 (81%), Positives = 198/226 (87%)

Query: 1   MAEASPAAANAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKY 60
            A AS AA   +LLEWPKKDKRR LH VYRVGDLDRTIKFYTEC GMKLLRKRD+PEEKY
Sbjct: 2   SAAASTAAEAEDLLEWPKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKY 61

Query: 61  SNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTRE 120
           +NAFLG+GPE S+FVVELTYNYGV  YDIGTGFGHF IA EDV K VE ++AKGG VTRE
Sbjct: 62  TNAFLGYGPEDSNFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVELVKAKGGKVTRE 121

Query: 121 PGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLGRSIKFYEKALGMKLL 180
           PGP+KGG + IAFVKDPDGY FELIQRGPTPEPLCQVMLRVGDL RSIKFYEKA GMKLL
Sbjct: 122 PGPVKGGKSVIAFVKDPDGYKFELIQRGPTPEPLCQVMLRVGDLDRSIKFYEKAFGMKLL 181

Query: 181 RTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQV 226
           R  D PEYKYT+AM+GY  ED+TTVLELTYNYGVTEYTKGNAYAQ+
Sbjct: 182 RKRDNPEYKYTIAMMGYGPEDKTTVLELTYNYGVTEYTKGNAYAQI 227


Length = 286

>gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional Back     alignment and domain information
>gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional Back     alignment and domain information
>gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional Back     alignment and domain information
>gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain Back     alignment and domain information
>gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional Back     alignment and domain information
>gnl|CDD|176710 cd08362, BphC5-RrK37_N_like, N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>gnl|CDD|176702 cd08354, Glo_EDI_BRP_like_13, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|213772 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epimerase Back     alignment and domain information
>gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176671 cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>gnl|CDD|176666 cd07242, Glo_EDI_BRP_like_6, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211353 cd07263, Glo_EDI_BRP_like_16, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|213698 TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>gnl|CDD|176696 cd08348, BphC2-C3-RGP6_C_like, The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>gnl|CDD|222305 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|211357 cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>gnl|CDD|211351 cd07251, Glo_EDI_BRP_like_10, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|225861 COG3324, COG3324, Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>gnl|CDD|211355 cd08343, ED_TypeI_classII_C, C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>gnl|CDD|176693 cd08345, Fosfomycin_RP, Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>gnl|CDD|222152 pfam13468, Glyoxalase_3, Glyoxalase-like domain Back     alignment and domain information
>gnl|CDD|211358 cd08352, Glo_EDI_BRP_like_1, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176683 cd07262, Glo_EDI_BRP_like_19, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
PLN02300286 lactoylglutathione lyase 100.0
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.95
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.95
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.95
KOG2943299 consensus Predicted glyoxalase [Carbohydrate trans 99.94
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.89
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 99.89
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.88
PRK10291129 glyoxalase I; Provisional 99.87
PLN02367233 lactoylglutathione lyase 99.86
PLN02875 398 4-hydroxyphenylpyruvate dioxygenase 99.84
PLN03042185 Lactoylglutathione lyase; Provisional 99.84
PRK11478129 putative lyase; Provisional 99.84
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 99.83
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.82
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.82
KOG0638 381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 99.81
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 99.81
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.81
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 99.8
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 99.8
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 99.8
PRK04101139 fosfomycin resistance protein FosB; Provisional 99.8
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 99.79
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 99.79
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.79
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 99.78
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 99.77
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 99.76
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 99.76
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 99.76
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 99.75
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 99.75
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 99.75
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 99.75
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.74
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 99.74
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 99.74
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 99.74
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 99.74
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 99.74
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 99.73
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 99.73
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 99.73
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 99.73
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 99.73
PLN02300286 lactoylglutathione lyase 99.73
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.72
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 99.72
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 99.72
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 99.72
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 99.71
PRK06724128 hypothetical protein; Provisional 99.71
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 99.71
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 99.71
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.71
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 99.71
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 99.71
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.71
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.7
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 99.69
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.68
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.68
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 99.67
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 99.67
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.66
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.66
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 99.66
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 99.65
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 99.64
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 99.64
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 99.63
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.63
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.63
COG3324127 Predicted enzyme related to lactoylglutathione lya 99.63
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 99.62
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.62
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 99.61
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.61
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 99.6
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.58
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.54
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 99.53
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 99.52
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 99.46
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 99.43
PLN02367233 lactoylglutathione lyase 99.36
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.32
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 99.3
KOG2943 299 consensus Predicted glyoxalase [Carbohydrate trans 99.29
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.27
PLN03042185 Lactoylglutathione lyase; Provisional 99.24
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 99.18
PRK10291129 glyoxalase I; Provisional 99.15
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.13
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 99.13
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 99.07
COG2764136 PhnB Uncharacterized protein conserved in bacteria 99.06
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.04
PLN02875398 4-hydroxyphenylpyruvate dioxygenase 99.04
COG3607133 Predicted lactoylglutathione lyase [General functi 99.03
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 99.03
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.02
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.01
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.0
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 98.95
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 98.93
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 98.92
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 98.9
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 98.86
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 98.84
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 98.81
PRK11478129 putative lyase; Provisional 98.81
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 98.81
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 98.81
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 98.8
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 98.8
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 98.76
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 98.75
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 98.74
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 98.74
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 98.74
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 98.69
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 98.68
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 98.62
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 98.62
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 98.61
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 98.59
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 98.59
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 98.56
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 98.54
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 98.5
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 98.49
PRK10148147 hypothetical protein; Provisional 98.49
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 98.46
PRK04101139 fosfomycin resistance protein FosB; Provisional 98.46
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 98.46
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 98.45
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 98.45
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 98.41
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 98.38
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 98.36
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 98.35
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 98.32
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 98.31
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 98.24
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 98.23
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 98.19
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 98.18
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 98.18
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 98.18
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 98.05
PRK06724128 hypothetical protein; Provisional 98.02
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 98.02
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 97.95
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 97.94
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 97.91
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 97.91
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 97.89
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 97.82
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 97.78
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 97.77
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 97.71
KOG0638381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 97.67
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 97.65
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 97.57
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 97.48
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 97.48
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 97.48
COG3324127 Predicted enzyme related to lactoylglutathione lya 97.33
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 97.25
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 97.23
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 96.92
PF15067236 FAM124: FAM124 family 96.81
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 96.74
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 96.73
PF06983116 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans 96.44
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 95.99
PF14507101 CppA_C: CppA C-terminal; PDB: 3E0R_D. 95.39
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 94.94
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 94.58
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 93.94
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 92.35
COG2764136 PhnB Uncharacterized protein conserved in bacteria 91.96
PF06185185 YecM: YecM protein; InterPro: IPR010393 This famil 90.98
COG3607133 Predicted lactoylglutathione lyase [General functi 88.51
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 87.83
PRK11700187 hypothetical protein; Provisional 86.48
cd07268149 Glo_EDI_BRP_like_4 This conserved domain belongs t 85.63
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
Probab=100.00  E-value=2.1e-36  Score=245.11  Aligned_cols=233  Identities=79%  Similarity=1.295  Sum_probs=185.4

Q ss_pred             CCcccchhhhhcCCcCCcceeeEEEEEECCHHHHHHHhhhhcCCEEEEEEecCCCceeeEEeecCCCcceeEEEEEeccC
Q 026313            4 ASPAAANAELLEWPKKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYG   83 (240)
Q Consensus         4 ~~~~~~~~~~~~~~~~~i~~i~hi~l~v~d~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~l~l~~~~~   83 (240)
                      .|.+++.+++.+.+.|.+.+|+|+.|.|+|++++++||+++|||++..+...+...+..+++..++...++.+++.....
T Consensus         5 ~~~~~~~~~~~~~~~~~i~~l~Hv~l~V~Dle~s~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~lel~~~~~   84 (286)
T PLN02300          5 ASTAAEAEDLLEWPKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSNFVVELTYNYG   84 (286)
T ss_pred             cccChhhhhhhcCCccccceEEEEEEEeCCHHHHHHHHHHhcCCEEEEeeecCCCcEEEEEEccCCCCCceEEEEeccCC
Confidence            34566777888999899999999999999999999999999999998765444445566777766555566677765433


Q ss_pred             CccccCCCCceeEEEEeCcHHHHHHHHHHcCCeeecCCccCCCCceEEEEEECCCCCEEEEEEcCCCCCCceeEEEEecC
Q 026313           84 VTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGD  163 (240)
Q Consensus        84 ~~~~~~~~g~~~i~~~v~dl~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~~DPdG~~iel~~~~~~~~~~~hv~l~~~d  163 (240)
                      ......+.|+.|++|.|+|+++++++|+++|+++...+...+++....+||+||+|+.|||++....+.++.|+.|.++|
T Consensus        85 ~~~~~~~~g~~hia~~v~dvd~~~~~l~~~G~~i~~~~~~~~~g~~~~~~~~DPdG~~iEl~~~~~~~~~~~~~~l~~~d  164 (286)
T PLN02300         85 VDKYDIGTGFGHFGIAVEDVAKTVELVKAKGGKVTREPGPVKGGKSVIAFVKDPDGYKFELIQRGPTPEPLCQVMLRVGD  164 (286)
T ss_pred             CCccccCCCccEEEEEeCCHHHHHHHHHHCCCeeecCCcccCCCceEEEEEECCCCCEEEEEeCCCCCCcceeEEEEeCC
Confidence            33334556889999999999999999999999988877666665555588999999999999999889999999999999


Q ss_pred             ccccHHHHHHhcCCeeeeeecCCCcceeEEEeccccCCceeEEEEEEecCCcccccCcceeEEEEcCCCcccc
Q 026313          164 LGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSISN  236 (240)
Q Consensus       164 ~~~~~~fy~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~g~g~~Hiaf~v~di~~~  236 (240)
                      ++++.+||+++|||+++.....++..+..+++..+.......+++..+.+...+..|++++|++|.|+|+...
T Consensus       165 ~~~a~~Fy~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lel~~~~~~~~~~~g~~~~~i~~~v~di~~~  237 (286)
T PLN02300        165 LDRSIKFYEKAFGMKLLRKRDNPEYKYTIAMMGYGPEDKTTVLELTYNYGVTEYTKGNAYAQIAIGTDDVYKT  237 (286)
T ss_pred             HHHHHHHHHhccCCEEEeeecccccceEEEEEecCCCCCccEEEEeecCCCCccccCCceeEEEEecCCHHHH
Confidence            9999999999999999876555556677787766443334567775554433334578999999999998654



>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>PF15067 FAM124: FAM124 family Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK11700 hypothetical protein; Provisional Back     alignment and domain information
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
1f9z_A135 Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I 2e-39
1f9z_A135 Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I 2e-19
2c21_A144 Specificity Of The Trypanothione-Dependednt Leishma 4e-32
2c21_A144 Specificity Of The Trypanothione-Dependednt Leishma 2e-18
3zi1_A330 Crystal Structure Of Human Glyoxalase Domain-contai 6e-22
3zi1_A 330 Crystal Structure Of Human Glyoxalase Domain-contai 2e-08
2za0_A184 Crystal Structure Of Mouse Glyoxalase I Complexed W 6e-12
2za0_A184 Crystal Structure Of Mouse Glyoxalase I Complexed W 1e-08
3vw9_A187 Human Glyoxalase I With An N-Hydroxypyridone Inhibi 1e-11
3vw9_A187 Human Glyoxalase I With An N-Hydroxypyridone Inhibi 2e-08
1fro_A183 Human Glyoxalase I With Benzyl-Glutathione Inhibito 1e-11
1fro_A183 Human Glyoxalase I With Benzyl-Glutathione Inhibito 3e-08
1bh5_A183 Human Glyoxalase I Q33e, E172q Double Mutant Length 3e-11
1bh5_A183 Human Glyoxalase I Q33e, E172q Double Mutant Length 8e-08
3bqx_A150 High Resolution Crystal Structure Of A Glyoxalase-R 4e-04
>pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 Back     alignment and structure

Iteration: 1

Score = 158 bits (400), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 73/124 (58%), Positives = 92/124 (74%) Query: 23 RFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNY 82 R LH + RVGDL R+I FYT+ GMKLLR + PE KYS AF+G+GPE V+ELTYN+ Sbjct: 2 RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61 Query: 83 GVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIF 142 GV Y++GT +GH A++ ++ + E IR GGNVTRE GP+KGGTT IAFV+DPDGY Sbjct: 62 GVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKI 121 Query: 143 ELIQ 146 ELI+ Sbjct: 122 ELIE 125
>pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 Back     alignment and structure
>pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 Back     alignment and structure
>pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 Back     alignment and structure
>pdb|3ZI1|A Chain A, Crystal Structure Of Human Glyoxalase Domain-containing Protein 4 (glod4) Length = 330 Back     alignment and structure
>pdb|3ZI1|A Chain A, Crystal Structure Of Human Glyoxalase Domain-containing Protein 4 (glod4) Length = 330 Back     alignment and structure
>pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 Back     alignment and structure
>pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 Back     alignment and structure
>pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 Back     alignment and structure
>pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 Back     alignment and structure
>pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 Back     alignment and structure
>pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 Back     alignment and structure
>pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 Back     alignment and structure
>pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 Back     alignment and structure
>pdb|3BQX|A Chain A, High Resolution Crystal Structure Of A Glyoxalase-Related Enzyme From Fulvimarina Pelagi Length = 150 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 2e-62
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 3e-25
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 2e-61
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 3e-24
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 1e-45
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 3e-22
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 4e-40
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 3e-15
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 5e-37
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 2e-14
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 1e-34
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 7e-12
2p25_A126 Glyoxalase family protein; structural genomics, MC 1e-33
2p25_A126 Glyoxalase family protein; structural genomics, MC 3e-10
3r6a_A144 Uncharacterized protein; PSI biology, structural g 1e-31
3r6a_A144 Uncharacterized protein; PSI biology, structural g 7e-09
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 1e-29
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 1e-09
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 4e-27
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 3e-07
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 5e-27
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 3e-06
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 1e-25
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 3e-12
3e5d_A127 Putative glyoxalase I; structural genomics, joint 8e-25
3e5d_A127 Putative glyoxalase I; structural genomics, joint 6e-07
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 4e-24
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 4e-08
1ss4_A153 Glyoxalase family protein; structural genomics, PS 2e-23
1ss4_A153 Glyoxalase family protein; structural genomics, PS 3e-04
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 3e-20
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 1e-05
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 1e-19
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 6e-06
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 2e-19
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 5e-19
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 6e-09
3huh_A152 Virulence protein STM3117; structural genomics, ny 4e-18
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 2e-17
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 3e-04
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 7e-17
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 4e-05
3ghj_A141 Putative integron gene cassette protein; integron 9e-17
3ghj_A141 Putative integron gene cassette protein; integron 5e-05
1npb_A141 Fosfomycin-resistance protein; manganese binding, 3e-16
1npb_A141 Fosfomycin-resistance protein; manganese binding, 5e-04
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 8e-16
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 1e-15
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 3e-15
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 5e-05
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 7e-15
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 2e-04
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 1e-14
1nki_A135 Probable fosfomycin resistance protein; potassium 1e-14
1nki_A135 Probable fosfomycin resistance protein; potassium 4e-04
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 2e-14
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 5e-07
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 3e-14
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 1e-04
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 4e-14
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 6e-14
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 3e-04
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 6e-14
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 4e-04
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 9e-14
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 1e-13
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 2e-13
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 3e-13
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 4e-13
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 6e-06
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 5e-13
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 1e-12
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 2e-12
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 9e-05
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 4e-12
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 3e-08
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 5e-12
3eck_A 365 Protein (homoprotocatechuate 2,3-dioxygenase); oxi 5e-12
2i7r_A118 Conserved domain protein; structural genomics cons 1e-11
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-11
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 5e-04
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 2e-11
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 4e-11
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 2e-10
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 4e-10
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 1e-09
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 1e-07
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 4e-09
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 4e-04
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 1e-08
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 2e-08
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 2e-08
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 4e-08
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 4e-08
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 8e-08
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 9e-08
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 4e-07
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 7e-07
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 8e-07
1xy7_A166 Unknown protein; structural genomics, protein stru 2e-06
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 4e-06
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 6e-06
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
 Score =  191 bits (486), Expect = 2e-62
 Identities = 72/143 (50%), Positives = 87/143 (60%), Gaps = 5/143 (3%)

Query: 21  KRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTY 80
            RR LH + RVGDLDR+IKFYTE  GMK+LRK DVPE+KY+  FLG+GPE S  V+ELTY
Sbjct: 6   SRRMLHTMIRVGDLDRSIKFYTERLGMKVLRKWDVPEDKYTLVFLGYGPEMSSTVLELTY 65

Query: 81  NYGVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGY 140
           NYGVTSY     +GH AI  EDV +LV ++R     +  E       +  +AFV DPDGY
Sbjct: 66  NYGVTSYKHDEAYGHIAIGVEDVKELVADMRKHDVPIDYED-----ESGFMAFVVDPDGY 120

Query: 141 IFELIQRGPTPEPLCQVMLRVGD 163
             EL+      E     M   G 
Sbjct: 121 YIELLNEKTMMEKAEADMKEQGT 143


>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 Back     alignment and structure
>3eck_A Protein (homoprotocatechuate 2,3-dioxygenase); oxidoreductase, extradiol, FEII, crystal packing; HET: XXG; 1.60A {Brevibacterium fuscum} SCOP: d.32.1.3 d.32.1.3 PDB: 3ecj_A* 3ojn_A* 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* Length = 365 Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Length = 297 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Length = 418 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Length = 166 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Length = 393 Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
4ghg_A 365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.97
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 99.97
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 99.97
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.96
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.96
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.96
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.95
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.95
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.95
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.95
2r5v_A 357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.95
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.94
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.94
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 99.94
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.94
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.94
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.93
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.93
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.93
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.92
1cjx_A 357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.91
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.89
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.88
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.88
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 99.87
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.87
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.86
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.86
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.85
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 99.85
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.85
3huh_A152 Virulence protein STM3117; structural genomics, ny 99.84
1ss4_A153 Glyoxalase family protein; structural genomics, PS 99.84
3ghj_A141 Putative integron gene cassette protein; integron 99.84
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.83
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.83
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 99.83
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 99.83
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.83
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 99.83
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 99.82
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 99.81
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.81
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 99.79
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 99.79
2i7r_A118 Conserved domain protein; structural genomics cons 99.79
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 99.79
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 99.78
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 99.78
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 99.78
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.78
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 99.77
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.77
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 99.77
1nki_A135 Probable fosfomycin resistance protein; potassium 99.77
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 99.77
1npb_A141 Fosfomycin-resistance protein; manganese binding, 99.77
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 99.76
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 99.76
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 99.75
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 99.75
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 99.74
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 99.74
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.74
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 99.74
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 99.74
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.73
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 99.73
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.71
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.71
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 99.71
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.7
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.7
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.69
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.69
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 99.69
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.68
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.66
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.66
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 99.66
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.65
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 99.64
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.64
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 99.62
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.62
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 99.61
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.61
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.59
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.57
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.56
1xy7_A166 Unknown protein; structural genomics, protein stru 99.53
4ghg_A365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.5
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.49
3e0r_A244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 99.48
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.46
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.46
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.37
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.34
1tsj_A139 Conserved hypothetical protein; structural genomic 99.33
3isq_A393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.25
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.24
3l20_A172 Putative uncharacterized protein; hypothetical pro 99.21
1sqd_A424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.2
1sp8_A418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.19
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.14
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 99.11
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.1
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.07
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.07
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.06
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.01
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.01
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 98.98
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 98.97
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 98.88
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 98.85
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 98.79
2p25_A126 Glyoxalase family protein; structural genomics, MC 98.77
1ss4_A153 Glyoxalase family protein; structural genomics, PS 98.76
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 98.76
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 98.76
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 98.73
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 98.72
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 98.63
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 98.6
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 98.56
3ghj_A141 Putative integron gene cassette protein; integron 98.54
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 98.48
3huh_A152 Virulence protein STM3117; structural genomics, ny 98.42
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 98.41
1nki_A135 Probable fosfomycin resistance protein; potassium 98.41
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 98.4
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 98.38
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 98.38
1npb_A141 Fosfomycin-resistance protein; manganese binding, 98.37
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 98.37
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 98.36
2i7r_A118 Conserved domain protein; structural genomics cons 98.34
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 98.33
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 98.32
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 98.28
3r6a_A144 Uncharacterized protein; PSI biology, structural g 98.24
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 98.23
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 98.22
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 98.21
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 98.2
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 98.18
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 98.18
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 98.18
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 98.13
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 98.09
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 98.03
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 98.01
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 98.0
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 97.98
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 97.95
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 97.93
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 97.93
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding 97.63
1xy7_A166 Unknown protein; structural genomics, protein stru 97.63
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 97.49
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 97.17
3e0r_A 244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 96.8
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 96.69
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 96.54
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 95.81
3opy_A 989 6-phosphofructo-1-kinase alpha-subunit; ATP bindin 92.99
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 92.37
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 90.31
1k4n_A192 Protein EC4020, protein YECM; structural genomics, 89.79
1tsj_A139 Conserved hypothetical protein; structural genomic 87.39
3l20_A172 Putative uncharacterized protein; hypothetical pro 83.38
3iuz_A340 Putative glyoxalase superfamily protein; struct ge 80.95
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
Probab=99.97  E-value=7.3e-30  Score=212.19  Aligned_cols=195  Identities=21%  Similarity=0.205  Sum_probs=149.5

Q ss_pred             cCCcceeeEEEEEECCHHHHHHHhhhhcCCEEEEEEecCCCceeeEEeecCCCcceeEEEEEeccCCccccCCCCceeEE
Q 026313           18 KKDKRRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFA   97 (240)
Q Consensus        18 ~~~i~~i~hi~l~v~d~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~l~l~~~~~~~~~~~~~g~~~i~   97 (240)
                      .+.|++|+||.|.|+|++++++||+++|||+++.+..      ..+++..+....+..+.+...       ..+++.|++
T Consensus        12 ~p~I~rl~hV~l~V~DLe~s~~FY~dvLGL~~~~~~~------~~~~lr~~~~~~~~~l~l~~~-------~~~gl~~~a   78 (365)
T 4ghg_A           12 APDILRCAYAELVVTDLAKSRNFYVDVLGLHVSYEDE------NQIYLRSFEEFIHHNLVLTKG-------PVAALKAMA   78 (365)
T ss_dssp             CCCEEEEEEEEEEESCHHHHHHHHTTTTCCEEEEECS------SEEEEECTTCCSSCSEEEEEC-------SSCEEEEEE
T ss_pred             CCCCCEEEEEEEEeCCHHHHHHHHhhCCCCEEEEEcC------CEEEEEeCCCCcceEEEeccC-------CCCCcceEE
Confidence            3579999999999999999999999999999987743      256776654444444444432       234789999


Q ss_pred             EEeC---cHHHHHHHHHHcCCeeecCCccCCCCceEEEEEECCCCCEEEEEEcCC---------------CCCCceeEEE
Q 026313           98 IATE---DVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGP---------------TPEPLCQVML  159 (240)
Q Consensus        98 ~~v~---dl~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~~DPdG~~iel~~~~~---------------~~~~~~hv~l  159 (240)
                      |.|.   +++++.++|+++|+.+...+.....+....++|.||+|+.|||+....               .+.+++||++
T Consensus        79 ~~v~s~~dLd~~~~~L~~~Gv~v~~~~~~~~~~~g~~~~f~DPdG~~iEl~~~~~~~~~~~~~~~~~~~~~~~rlgHV~L  158 (365)
T 4ghg_A           79 FRVRTPEDVDKAEAYYQELGCRTERRKDGFVKGIGDALRVEDPLGFPYEFFFETTHVERLHMRYDLYSAGELVRLDHFNQ  158 (365)
T ss_dssp             EEESSHHHHHHHHHHHHHTTCCEEEETTCSSTTBCSEEEEECTTSCEEEEECCBCCCCCCTTCTTTCCTTCCCEEEEEEE
T ss_pred             EEeCCHHHHHHHHHHHHHcCCcceeccccccCCCceEEEEECCCCCEEEEEEEeeccccccccccccccccCcceeEEEE
Confidence            9996   488999999999998876544333333445899999999999986532               1346999999


Q ss_pred             EecCccccHHHHHHhcCCeeeeeecCCCcceeEEEeccccCCceeEEEEEEecCCcccccCcceeEEEEcCCCccc
Q 026313          160 RVGDLGRSIKFYEKALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVNTSPSGSIS  235 (240)
Q Consensus       160 ~~~d~~~~~~fy~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~g~g~~Hiaf~v~di~~  235 (240)
                      .++|++++.+||++ |||++++....+++.....|++|+..++  .+.+...       .+.++||+||.|+|+.+
T Consensus       159 ~v~D~~~t~~Fy~~-LGf~~sd~~~~~~g~~~~~f~~~~~~hH--~la~~~~-------~~~~lhHvaf~v~d~d~  224 (365)
T 4ghg_A          159 VTPDVPRGRKYLED-LGFRVTEDIQDDEGTTYAAWMHRKGTVH--DTALTGG-------NGPRLHHVAFSTHEKHN  224 (365)
T ss_dssp             EESCHHHHHHHHHH-TTCEEEEEEECTTSCEEEEEEESSSSSC--SEEEEES-------SBSEEEEEEEECSSHHH
T ss_pred             eecCHHHHHHHHHh-cCCEEEEEEecCCCceeEEeeecCCccc--ceeeecC-------CCCceeEEEEecCCHHH
Confidence            99999999999965 9999999887777777889999977543  3444321       13489999999998753



>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>3iuz_A Putative glyoxalase superfamily protein; struct genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: MLY P6G PGE; 1.90A {Ralstonia eutropha} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 240
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 7e-29
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 1e-08
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 6e-27
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 4e-08
d1qipa_176 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 2e-25
d1qipa_176 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 5e-09
d1sqda1167 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg 1e-17
d1sqda1167 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg 4e-04
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 2e-17
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 0.002
d1sqia1149 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge 5e-17
d1sp8a1172 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg 1e-16
d1sp8a1172 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg 0.001
d1zswa1144 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B 3e-16
d1zswa1144 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B 0.002
d1mpya2162 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met 2e-15
d1mpya2162 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met 3e-04
d1jc4a_145 d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion 2e-15
d1ss4a_149 d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu 3e-15
d1t47a1163 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg 1e-14
d1t47a1163 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg 6e-04
d1f1ua1146 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge 3e-14
d1r9ca_130 d.32.1.2 (A:) Fosfomycin resistance protein FosX { 5e-14
d1r9ca_130 d.32.1.2 (A:) Fosfomycin resistance protein FosX { 4e-04
d1mpya1145 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap 5e-14
d1f1ua2176 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy 3e-12
d1f1ua2176 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy 0.002
d1nkia_134 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 2e-11
d1zswa2170 d.32.1.10 (A:145-314) Hypothetical protein BC1024 5e-11
d2pjsa1111 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 5e-11
d1npba_140 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 1e-10
d1npba_140 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 0.002
d1xrka_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 3e-10
d1lgta1131 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena 4e-10
d1xqaa_113 d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu 5e-10
d1xqaa_113 d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu 0.004
d1klla_128 d.32.1.2 (A:) Mitomycin resistance protein D, MRD 2e-09
d2i7ra1115 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str 2e-09
d1cjxa2203 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy 1e-08
d1kw3b1132 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygena 3e-08
d1sp8a2224 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy 3e-08
d1xy7a_135 d.32.1.9 (A:) Hypothetical protein At5g48480 {Thal 4e-08
d1ecsa_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {K 5e-08
d1kw3b2156 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxyge 4e-07
d1jifa_122 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 6e-07
d1t47a2199 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxy 2e-06
d1sqia2210 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxy 2e-05
d1u6la_137 d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudom 7e-05
d1sqda2230 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxy 8e-05
d1cjxa1150 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxyge 2e-04
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Glyoxalase I (lactoylglutathione lyase)
domain: Glyoxalase I (lactoylglutathione lyase)
species: Escherichia coli [TaxId: 562]
 Score =  103 bits (258), Expect = 7e-29
 Identities = 74/132 (56%), Positives = 93/132 (70%)

Query: 23  RFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNY 82
           R LH + RVGDL R+I FYT+  GMKLLR  + PE KYS AF+G+GPE    V+ELTYN+
Sbjct: 2   RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61

Query: 83  GVTSYDIGTGFGHFAIATEDVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIF 142
           GV  Y++GT +GH A++ ++  +  E IR  GGNVTRE GP+KGGTT IAFV+DPDGY  
Sbjct: 62  GVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKI 121

Query: 143 ELIQRGPTPEPL 154
           ELI+       L
Sbjct: 122 ELIEEKDAGRGL 133


>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 132 Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 135 Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Length = 120 Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 156 Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 199 Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Length = 137 Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 230 Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 99.87
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 99.86
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.85
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.83
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.83
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.83
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.82
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 99.82
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.81
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 99.8
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.8
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.8
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.79
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 99.78
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.77
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.77
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 99.77
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 99.76
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.76
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 99.76
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.75
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 99.75
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.74
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.74
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 99.71
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.68
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.6
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.56
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.54
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.53
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.43
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.42
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.37
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.31
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.27
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.1
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.08
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.08
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 99.04
d1cjxa2 203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.01
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.01
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.0
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 98.98
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 98.97
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 98.94
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 98.92
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 98.91
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 98.91
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 98.9
d1sp8a2 224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 98.9
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 98.86
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 98.84
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 98.79
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 98.79
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 98.78
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 98.76
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 98.73
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 98.7
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 98.65
d1sqda2 230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 98.63
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 98.6
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 98.52
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 98.48
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 98.45
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 98.37
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 98.32
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 98.25
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 98.23
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 98.17
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 98.0
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 97.5
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 97.28
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 97.08
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 96.8
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 96.48
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 96.43
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 92.11
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 89.83
d1k4na_190 Hypothetical protein YecM (EC4020) {Escherichia co 89.61
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 82.83
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 82.23
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 80.9
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Glyoxalase I (lactoylglutathione lyase)
domain: Glyoxalase I (lactoylglutathione lyase)
species: Escherichia coli [TaxId: 562]
Probab=99.87  E-value=7.8e-21  Score=133.98  Aligned_cols=130  Identities=56%  Similarity=1.000  Sum_probs=97.2

Q ss_pred             ceeeEEEEEECCHHHHHHHhhhhcCCEEEEEEecCCCceeeEEeecCCCcceeEEEEEeccCCccccCCCCceeEEEEeC
Q 026313           22 RRFLHAVYRVGDLDRTIKFYTECFGMKLLRKRDVPEEKYSNAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATE  101 (240)
Q Consensus        22 ~~i~hi~l~v~d~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~l~l~~~~~~~~~~~~~g~~~i~~~v~  101 (240)
                      ++|.|++|.|+|+++|++||+++|||++..+............+..........................+..++++.++
T Consensus         1 Mkl~Hv~i~V~Dl~~s~~FY~~iLG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (135)
T d1f9za_           1 MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVD   80 (135)
T ss_dssp             CCEEEEEEECSCHHHHHHHHHHTTCCEEEEEEEETTTTEEEEEEESSCTTTSCEEEEEEETTCCCCCCCSSEEEEEEECS
T ss_pred             CcceEEEEEcCCHHHHHHHHHHHhCCEEEeeccccccceeeeeeccceeeeccccccccccccccccccccceeeccchH
Confidence            57999999999999999999999999998876655555545555443333333333333333333445567899999999


Q ss_pred             cHHHHHHHHHHcCCeeecCCccCCCCceEEEEEECCCCCEEEEEEcCCCC
Q 026313          102 DVYKLVENIRAKGGNVTREPGPLKGGTTHIAFVKDPDGYIFELIQRGPTP  151 (240)
Q Consensus       102 dl~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~~DPdG~~iel~~~~~~~  151 (240)
                      +++++.++++++|..+..++...+++....+||+||||+.|||+|.....
T Consensus        81 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~DPdG~~iEl~q~~~~~  130 (135)
T d1f9za_          81 NAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAG  130 (135)
T ss_dssp             CHHHHHHHHHHTTCEEEEEEEECTTSCCEEEEEECTTSCEEEEEEC----
T ss_pred             HHHHHHHHHHHcCCCeecCCccccCCCeEEEEEECCCCCEEEEEECCCcc
Confidence            99999999999999988877777776666689999999999999986544



>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure