Citrus Sinensis ID: 026356
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| 297739793 | 350 | unnamed protein product [Vitis vinifera] | 0.770 | 0.528 | 0.572 | 3e-63 | |
| 225441543 | 353 | PREDICTED: F-box protein At3g58530 [Viti | 0.770 | 0.524 | 0.572 | 4e-63 | |
| 255580692 | 351 | ubiquitin-protein ligase, putative [Rici | 0.833 | 0.569 | 0.548 | 7e-63 | |
| 147789108 | 349 | hypothetical protein VITISV_044261 [Viti | 0.712 | 0.489 | 0.605 | 1e-62 | |
| 224088164 | 341 | predicted protein [Populus trichocarpa] | 0.575 | 0.404 | 0.710 | 2e-61 | |
| 356530677 | 353 | PREDICTED: F-box protein At3g58530-like | 0.779 | 0.529 | 0.508 | 2e-57 | |
| 297817168 | 353 | hypothetical protein ARALYDRAFT_486305 [ | 0.591 | 0.402 | 0.684 | 1e-54 | |
| 388498858 | 357 | unknown [Lotus japonicus] | 0.775 | 0.521 | 0.495 | 2e-53 | |
| 18410977 | 353 | F-box protein [Arabidopsis thaliana] gi| | 0.608 | 0.413 | 0.671 | 5e-53 | |
| 15450960 | 353 | putative protein [Arabidopsis thaliana] | 0.608 | 0.413 | 0.671 | 5e-53 |
| >gi|297739793|emb|CBI29975.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 247 bits (631), Expect = 3e-63, Method: Compositional matrix adjust.
Identities = 131/229 (57%), Positives = 158/229 (68%), Gaps = 44/229 (19%)
Query: 3 MEEEKVKAAEEEETWSKETVPKVI------------------------------------ 26
MEE + +A + + WS+ET+PKV+
Sbjct: 1 MEETEARAGGDLK-WSRETIPKVLRIVGTRLPQRDLISLLLVSPWIHRTLVSCSSLWLVL 59
Query: 27 DLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLN 86
D RE NNAGNRLVAALS+ RY+HV++INLEFAQDIED+HL+LLKTKCL SLQ+LESLNLN
Sbjct: 60 DFRETNNAGNRLVAALSLFRYQHVKQINLEFAQDIEDKHLDLLKTKCLDSLQELESLNLN 119
Query: 87 GCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDK 146
CQKISD+G+E I+S CP+LKVFSIYWNVRVTDIG+ HLVKNCKHI+DLNLSGCKN+ DK
Sbjct: 120 VCQKISDRGVETITSACPKLKVFSIYWNVRVTDIGMTHLVKNCKHIVDLNLSGCKNITDK 179
Query: 147 SLQLIADNYQELESLNLTRYVNM-------ILLGLFYIWSNNILLMSEF 188
SLQLIADNY +LE LNLTR + + ILL + S N+ +S F
Sbjct: 180 SLQLIADNYPDLELLNLTRCIKLTDGGLQQILLKCSSLQSLNLYALSSF 228
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225441543|ref|XP_002276459.1| PREDICTED: F-box protein At3g58530 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255580692|ref|XP_002531168.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223529238|gb|EEF31211.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147789108|emb|CAN73494.1| hypothetical protein VITISV_044261 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224088164|ref|XP_002308350.1| predicted protein [Populus trichocarpa] gi|222854326|gb|EEE91873.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356530677|ref|XP_003533907.1| PREDICTED: F-box protein At3g58530-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297817168|ref|XP_002876467.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] gi|297322305|gb|EFH52726.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|388498858|gb|AFK37495.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|18410977|ref|NP_567069.1| F-box protein [Arabidopsis thaliana] gi|75154905|sp|Q8LB33.1|FB330_ARATH RecName: Full=F-box protein At3g58530 gi|21593045|gb|AAM64994.1| unknown [Arabidopsis thaliana] gi|332646275|gb|AEE79796.1| F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15450960|gb|AAK96751.1| putative protein [Arabidopsis thaliana] gi|17978711|gb|AAL47349.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| TAIR|locus:2076376 | 353 | AT3G58530 [Arabidopsis thalian | 0.687 | 0.467 | 0.630 | 4e-51 | |
| ZFIN|ZDB-GENE-040426-2440 | 310 | fbxl15 "F-box and leucine-rich | 0.625 | 0.483 | 0.270 | 7.7e-13 | |
| UNIPROTKB|B5X441 | 292 | fbxl15 "F-box/LRR-repeat prote | 0.579 | 0.476 | 0.236 | 2.9e-12 | |
| TAIR|locus:2027082 | 360 | SKP2A [Arabidopsis thaliana (t | 0.529 | 0.352 | 0.298 | 5.9e-12 | |
| WB|WBGene00015350 | 466 | C02F5.7 [Caenorhabditis elegan | 0.437 | 0.225 | 0.314 | 1.4e-11 | |
| DICTYBASE|DDB_G0287415 | 1012 | DDB_G0287415 "SCF E3 ubiquitin | 0.387 | 0.091 | 0.408 | 3.7e-10 | |
| UNIPROTKB|E6ZHJ8 | 292 | fbxl15 "F-box/LRR-repeat prote | 0.55 | 0.452 | 0.242 | 4.8e-10 | |
| UNIPROTKB|A6H779 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.633 | 0.359 | 0.303 | 5.8e-10 | |
| UNIPROTKB|F1PWK1 | 422 | FBXL2 "Uncharacterized protein | 0.633 | 0.360 | 0.291 | 8.3e-10 | |
| TAIR|locus:2149805 | 665 | AT5G01720 "AT5G01720" [Arabido | 0.370 | 0.133 | 0.348 | 8.8e-10 |
| TAIR|locus:2076376 AT3G58530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 531 (192.0 bits), Expect = 4.0e-51, P = 4.0e-51
Identities = 104/165 (63%), Positives = 130/165 (78%)
Query: 26 IDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNL 85
I+LREM NAG+RL+AALS+PRYR V+ INLEFAQ + D HL+L+KT+C +L LE LNL
Sbjct: 59 INLREMTNAGDRLLAALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNL 118
Query: 86 NGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLD 145
N CQKISD GIE I+S CP+LKVFSIYWNVRVTD GI++LVKNC+HI DLNLSGCK+L D
Sbjct: 119 NVCQKISDNGIEAITSICPKLKVFSIYWNVRVTDAGIRNLVKNCRHITDLNLSGCKSLTD 178
Query: 146 KSLQLIADNYQELESLNLTRYVNMILLGLFYIWSNNILLMSEFIY 190
KS+QL+A++Y +LESLN+TR V + GL + L + +Y
Sbjct: 179 KSMQLVAESYPDLESLNITRCVKITDDGLLQVLQKCFSLQTLNLY 223
|
|
| ZFIN|ZDB-GENE-040426-2440 fbxl15 "F-box and leucine-rich repeat protein 15" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B5X441 fbxl15 "F-box/LRR-repeat protein 15" [Salmo salar (taxid:8030)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2027082 SKP2A [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015350 C02F5.7 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0287415 DDB_G0287415 "SCF E3 ubiquitin ligase complex F-box protein GRR1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E6ZHJ8 fbxl15 "F-box/LRR-repeat protein 15" [Dicentrarchus labrax (taxid:13489)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149805 AT5G01720 "AT5G01720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-11 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 3e-09 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 0.002 | |
| smart00367 | 26 | smart00367, LRR_CC, Leucine-rich repeat - CC (cyst | 0.004 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 61.6 bits (150), Expect = 1e-11
Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 3/93 (3%)
Query: 74 LGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHII 133
L + L+ L L G + I D+G+ ++ +CP L+V + +TD GI L NC +
Sbjct: 48 LSNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQ 107
Query: 134 DLNLS---GCKNLLDKSLQLIADNYQELESLNL 163
+NL + D SL + N L+++
Sbjct: 108 TINLGRHRNGHLITDVSLSALGKNCTFLQTVGF 140
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.86 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.79 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.65 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.64 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.54 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.53 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.52 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.45 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.14 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.96 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.76 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.69 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.68 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.56 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.56 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.55 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.52 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.47 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.28 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.27 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.22 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.12 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.06 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 98.01 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.9 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.88 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.8 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.66 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.65 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.4 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.18 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.08 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.9 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.84 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.79 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.78 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.69 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.49 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.44 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.34 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.3 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.25 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.23 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.2 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.04 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.94 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.87 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 95.83 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.79 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.78 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.58 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.56 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.55 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.45 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.41 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.65 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.55 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 93.88 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 92.3 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 92.12 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 91.3 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 91.21 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 90.81 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 88.4 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 86.02 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 85.86 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 84.63 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 84.59 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 84.57 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 82.56 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 82.1 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.86 E-value=9.4e-23 Score=169.40 Aligned_cols=210 Identities=19% Similarity=0.309 Sum_probs=153.1
Q ss_pred CcCeEEeccCCCCCChHHHHHhhhhcCCCCceEeccCCCCCcHHHHHHHHHHccCCCCCccEEecCCCCCCcHHHHHHHH
Q 026356 21 TVPKVIDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIIS 100 (240)
Q Consensus 21 ~~~~~L~l~~~~~~~~~~l~~l~~~~~~~L~~L~l~~c~~i~~~~~~~l~~~~~~~~~~L~~L~l~~c~~l~~~~~~~l~ 100 (240)
.|++-|.++||..+.+..+..+. .+||++++|++.+|.+++|..+..+++.| ++|++|++-.|+.+|+..++.++
T Consensus 138 g~lk~LSlrG~r~v~~sslrt~~-~~CpnIehL~l~gc~~iTd~s~~sla~~C----~~l~~l~L~~c~~iT~~~Lk~la 212 (483)
T KOG4341|consen 138 GFLKELSLRGCRAVGDSSLRTFA-SNCPNIEHLALYGCKKITDSSLLSLARYC----RKLRHLNLHSCSSITDVSLKYLA 212 (483)
T ss_pred cccccccccccccCCcchhhHHh-hhCCchhhhhhhcceeccHHHHHHHHHhc----chhhhhhhcccchhHHHHHHHHH
Confidence 46777999999999888888775 59999999999999999999999999988 99999999999999999999999
Q ss_pred hcCCCCCEEEecCCCCCCHHHHHHHHHcCCcCCEEecc--------------------------CCCCCCHHHHHHHHHh
Q 026356 101 STCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLS--------------------------GCKNLLDKSLQLIADN 154 (240)
Q Consensus 101 ~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~L~~L~l~--------------------------~c~~ltd~~l~~l~~~ 154 (240)
..|++|+.++++||+.+++.+++.+.+++..++.+... +|..+||+++..++.+
T Consensus 213 ~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~ 292 (483)
T KOG4341|consen 213 EGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACG 292 (483)
T ss_pred HhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhh
Confidence 99999999999999998888887777766655555333 4444555555555545
Q ss_pred CCCCcEEeccCCCCCCHHHHHHHHHhChhhhhHH---------------HhcCCccceeecccCCCCCchhHHHHHHHhh
Q 026356 155 YQELESLNLTRYVNMILLGLFYIWSNNILLMSEF---------------IYHGIRFFQAVQINSSNGGDHLAFAYIIETN 219 (240)
Q Consensus 155 ~~~L~~L~l~~c~~it~~~~~~l~~~~~~~l~~l---------------~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~ 219 (240)
|..|+.++.++|..++|..+..+..+|+. ++.+ ..++|+.|+.+++.-+....+..+.... .
T Consensus 293 c~~lq~l~~s~~t~~~d~~l~aLg~~~~~-L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls--~ 369 (483)
T KOG4341|consen 293 CHALQVLCYSSCTDITDEVLWALGQHCHN-LQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASLS--R 369 (483)
T ss_pred hhHhhhhcccCCCCCchHHHHHHhcCCCc-eEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhhc--c
Confidence 55555555555555555555555555443 2222 2234445666666433333332444444 6
Q ss_pred cccccchhhhhhhhhhhcc
Q 026356 220 TYKHGKEKHIIETIKTGQQ 238 (240)
Q Consensus 220 ~~~~L~~L~l~~c~~~~d~ 238 (240)
+|+.|++|++..|..|+|-
T Consensus 370 ~C~~lr~lslshce~itD~ 388 (483)
T KOG4341|consen 370 NCPRLRVLSLSHCELITDE 388 (483)
T ss_pred CCchhccCChhhhhhhhhh
Confidence 7888888888888887764
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-20 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-17 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-09 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 5e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-17 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-15 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-12 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-12 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-10 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-09 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-17 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-16 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 9e-16 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 9e-12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-04 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-13 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 5e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 7e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 8e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 3e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 88.0 bits (218), Expect = 1e-20
Identities = 27/142 (19%), Positives = 62/142 (43%), Gaps = 9/142 (6%)
Query: 28 LREMNNAGNRL--VAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNL 85
L+ ++ G RL ++ + ++ +NL + L+ L + C L+ LNL
Sbjct: 120 LQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSC----SRLDELNL 175
Query: 86 NGCQKISDKGIE-IISSTCPELKVFSIY-WNVRVTDIGIQHLVKNCKHIIDLNLSGCKNL 143
+ C ++K ++ ++ + ++ + + + LV+ C +++ L+LS L
Sbjct: 176 SWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVML 235
Query: 144 LDKSLQLIADNYQELESLNLTR 165
+ Q L+ L+L+R
Sbjct: 236 KNDCFQEFF-QLNYLQHLSLSR 256
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.76 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.75 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.74 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.73 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.72 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.68 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.67 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.67 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.67 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.67 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.66 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.65 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.65 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.64 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.54 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.5 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.49 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.39 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 99.15 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.01 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.01 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.98 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.98 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.94 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.93 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.91 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.9 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.89 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.88 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.86 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.85 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.85 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.85 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.81 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.79 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.79 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.78 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.78 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.78 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.77 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.77 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.76 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.74 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.74 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.73 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.7 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.7 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.67 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.66 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.66 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.66 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.65 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.64 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.63 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.62 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.61 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.61 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.6 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.6 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.58 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.57 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.57 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.56 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.55 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.55 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.54 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.54 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.54 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.52 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.52 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.5 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.49 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.49 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.48 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.47 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.47 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.46 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.45 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.45 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.44 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.43 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.42 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.41 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.41 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.41 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.4 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.4 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.4 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.38 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.38 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.38 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.37 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.34 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.34 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.32 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.31 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.31 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.3 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.27 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.27 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.23 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.23 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.23 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.22 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.19 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.17 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.17 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.17 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.14 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.12 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.11 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.08 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.08 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.06 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.03 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.03 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.01 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.01 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.01 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.01 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.95 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.85 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.85 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.74 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.74 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.69 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.68 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.61 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.55 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.55 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.53 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.52 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.41 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.39 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.37 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.34 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.31 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.21 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.18 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.03 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.72 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.65 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.62 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.5 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.46 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.17 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.07 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.31 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.19 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 95.12 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.76 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 91.02 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.76 E-value=1.2e-17 Score=139.89 Aligned_cols=182 Identities=19% Similarity=0.295 Sum_probs=122.5
Q ss_pred EeccCCCCCChHHHHHhhhhcCCCCceEeccCCCCCcHHHHHHHHHHccCCCCCccEEecCCCCCCcHHHHHHHHhcCCC
Q 026356 26 IDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPE 105 (240)
Q Consensus 26 L~l~~~~~~~~~~l~~l~~~~~~~L~~L~l~~c~~i~~~~~~~l~~~~~~~~~~L~~L~l~~c~~l~~~~~~~l~~~~~~ 105 (240)
|++++|. +....+.... ..+++|++|++++| .+++.....++. +++|++|++++|..+++.++..+...+++
T Consensus 98 L~L~~~~-l~~~~~~~~~-~~~~~L~~L~L~~~-~l~~~~~~~l~~-----~~~L~~L~L~~~~~l~~~~l~~~~~~~~~ 169 (336)
T 2ast_B 98 MDLSNSV-IEVSTLHGIL-SQCSKLQNLSLEGL-RLSDPIVNTLAK-----NSNLVRLNLSGCSGFSEFALQTLLSSCSR 169 (336)
T ss_dssp EECTTCE-ECHHHHHHHH-TTBCCCSEEECTTC-BCCHHHHHHHTT-----CTTCSEEECTTCBSCCHHHHHHHHHHCTT
T ss_pred EEccCCC-cCHHHHHHHH-hhCCCCCEEeCcCc-ccCHHHHHHHhc-----CCCCCEEECCCCCCCCHHHHHHHHhcCCC
Confidence 7777776 4544444433 46778888888875 477666665533 47788888888767777777666666788
Q ss_pred CCEEEecCCCCCCHHHHHHHHHcCC-cCCEEeccCCC-CCCHHHHHHHHHhCCCCcEEeccCCCCCCHHHHHHHHHhChh
Q 026356 106 LKVFSIYWNVRVTDIGIQHLVKNCK-HIIDLNLSGCK-NLLDKSLQLIADNYQELESLNLTRYVNMILLGLFYIWSNNIL 183 (240)
Q Consensus 106 L~~L~l~~~~~l~~~~~~~l~~~~~-~L~~L~l~~c~-~ltd~~l~~l~~~~~~L~~L~l~~c~~it~~~~~~l~~~~~~ 183 (240)
|++|++++|..+++.++..+...++ +|++|++++|. .+++..+..+..++++|+.|++++|..+++.++..
T Consensus 170 L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~------- 242 (336)
T 2ast_B 170 LDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQE------- 242 (336)
T ss_dssp CCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGG-------
T ss_pred CCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHHHHH-------
Confidence 8888888776777777777777777 88888888875 57777776666677888888888775466644332
Q ss_pred hhhHHHhcCCccceeecccCCC-CCchhHHHHHHHhhcccccchhhhhhh
Q 026356 184 LMSEFIYHGIRFFQAVQINSSN-GGDHLAFAYIIETNTYKHGKEKHIIET 232 (240)
Q Consensus 184 ~l~~l~~~~~~~L~~l~l~~~~-~~~~~~~~~~~~~~~~~~L~~L~l~~c 232 (240)
+..++.|+.++++.+. +.+. ++.. + ..+++|+.|++.+|
T Consensus 243 ------l~~l~~L~~L~l~~~~~~~~~-~~~~-l--~~~~~L~~L~l~~~ 282 (336)
T 2ast_B 243 ------FFQLNYLQHLSLSRCYDIIPE-TLLE-L--GEIPTLKTLQVFGI 282 (336)
T ss_dssp ------GGGCTTCCEEECTTCTTCCGG-GGGG-G--GGCTTCCEEECTTS
T ss_pred ------HhCCCCCCEeeCCCCCCCCHH-HHHH-H--hcCCCCCEEeccCc
Confidence 2345667777776663 3333 2211 2 45778888888777
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 240 | ||||
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 6e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.003 |
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: 28-residue LRR domain: Ribonuclease inhibitor species: Human (Homo sapiens) [TaxId: 9606]
Score = 43.4 bits (100), Expect = 1e-05
Identities = 15/92 (16%), Positives = 40/92 (43%), Gaps = 10/92 (10%)
Query: 79 DLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHL---VKNCKHIIDL 135
D++SL++ C+++SD + + +V + +T+ + + ++ + +L
Sbjct: 3 DIQSLDIQ-CEELSDARWAELLPLLQQCQVVRLDDC-GLTEARCKDISSALRVNPALAEL 60
Query: 136 NLSGCKNLLDKSLQLIAD----NYQELESLNL 163
NL L D + + +++ L+L
Sbjct: 61 NLRSN-ELGDVGVHCVLQGLQTPSCKIQKLSL 91
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.88 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.88 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.54 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.53 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.46 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.42 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.31 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.28 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.21 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.16 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.48 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.47 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.46 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.42 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.42 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.31 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.3 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.2 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.2 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.19 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.03 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.01 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.95 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.87 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.83 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.78 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.7 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.62 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.53 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.42 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.35 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.18 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.76 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.73 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.14 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.62 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.53 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.47 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.31 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.18 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.11 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 92.86 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=2.6e-22 Score=163.27 Aligned_cols=184 Identities=19% Similarity=0.283 Sum_probs=147.0
Q ss_pred eEEeccCCCCCChHHHHHhhhhcCCCCceEeccCCCCCcHHHHHHHHHHccCCCCCccEEecCCCCCCcHHHHHHHHhcC
Q 026356 24 KVIDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTC 103 (240)
Q Consensus 24 ~~L~l~~~~~~~~~~l~~l~~~~~~~L~~L~l~~c~~i~~~~~~~l~~~~~~~~~~L~~L~l~~c~~l~~~~~~~l~~~~ 103 (240)
+.|++++|. ++...+..+. .++++|++|++++| .+++.++..++. +++|++|++++|..+++.++..++..|
T Consensus 49 ~~LdLs~~~-i~~~~l~~l~-~~c~~L~~L~L~~~-~l~~~~~~~l~~-----~~~L~~L~Ls~c~~itd~~l~~l~~~~ 120 (284)
T d2astb2 49 QHMDLSNSV-IEVSTLHGIL-SQCSKLQNLSLEGL-RLSDPIVNTLAK-----NSNLVRLNLSGCSGFSEFALQTLLSSC 120 (284)
T ss_dssp CEEECTTCE-ECHHHHHHHH-TTBCCCSEEECTTC-BCCHHHHHHHTT-----CTTCSEEECTTCBSCCHHHHHHHHHHC
T ss_pred CEEECCCCc-cCHHHHHHHH-HhCCCccccccccc-CCCcHHHHHHhc-----CCCCcCccccccccccccccchhhHHH
Confidence 349999885 6677777764 58999999999997 589988887753 489999999999999999999999999
Q ss_pred CCCCEEEecCCCCCCHHHHHHH-HHcCCcCCEEeccCC-CCCCHHHHHHHHHhCCCCcEEeccCCCCCCHHHHHHHHHhC
Q 026356 104 PELKVFSIYWNVRVTDIGIQHL-VKNCKHIIDLNLSGC-KNLLDKSLQLIADNYQELESLNLTRYVNMILLGLFYIWSNN 181 (240)
Q Consensus 104 ~~L~~L~l~~~~~l~~~~~~~l-~~~~~~L~~L~l~~c-~~ltd~~l~~l~~~~~~L~~L~l~~c~~it~~~~~~l~~~~ 181 (240)
++|++|++++|..+++.++... ...+++|++|++++| ..+++.++..++.++|+|++|++++|..+++.++..+
T Consensus 121 ~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l---- 196 (284)
T d2astb2 121 SRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF---- 196 (284)
T ss_dssp TTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGG----
T ss_pred HhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhh----
Confidence 9999999999989999988664 455689999999987 4689999999998999999999999988998766543
Q ss_pred hhhhhHHHhcCCccceeecccCC-CCCchhHHHHHHHhhcccccchhhhhhh
Q 026356 182 ILLMSEFIYHGIRFFQAVQINSS-NGGDHLAFAYIIETNTYKHGKEKHIIET 232 (240)
Q Consensus 182 ~~~l~~l~~~~~~~L~~l~l~~~-~~~~~~~~~~~~~~~~~~~L~~L~l~~c 232 (240)
..++.|+.++++++ .+++. ++..+ ..+|+|+.|++++|
T Consensus 197 ---------~~~~~L~~L~L~~C~~i~~~-~l~~L---~~~~~L~~L~l~~~ 235 (284)
T d2astb2 197 ---------FQLNYLQHLSLSRCYDIIPE-TLLEL---GEIPTLKTLQVFGI 235 (284)
T ss_dssp ---------GGCTTCCEEECTTCTTCCGG-GGGGG---GGCTTCCEEECTTS
T ss_pred ---------cccCcCCEEECCCCCCCChH-HHHHH---hcCCCCCEEeeeCC
Confidence 23566777777654 44444 33332 35778888887776
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|