Citrus Sinensis ID: 026541

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MGSSLQKPIENRECPRQEKENLRQEEIKEEELEDIDGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGNLRDRNDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCIFSNRYLL
ccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHcccccEEcccccccccEEcccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHccccccccccccEEcccccccEEcccccEEcccccccccccc
cccccccccccHHHHHHHHHHHccccccccccccccccccccEEccccccHcccccHcccccHHHHHHHHHHHHEEHHcccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccccccEEEcccccEEEEcccccccccccHHHHHHHcccccHHHHHHHHHcccccccccccEEEEccccccEEEEEEEEHHHcccccccccc
mgsslqkpienrecprqekENLRQEEikeeeledidgtftcdiciepmsvnnkfknnnlcthpfcqdctvkYIEVKvrdnntakiecpglhceqfldpfackhtipsslflKWCDHLCEDyvlgfersycpnrncmAVMVNECegigrvkkaqcpkckqwfCFQCklawhagyrceesgnlrdrnDIAFGKLLEKmnwtrcpgcgncierkkgcriMFCRFIFLSLCLCifsnryll
mgsslqkpienrecprqekenlrqeeikeeeledidgtfTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRceesgnlrdRNDIAFGKLLekmnwtrcpgcgNCIERKKGCRIMFCRFIFLSLCLCIFSNRYLL
MGSSLQKPIENRECPRQekenlrqeeikeeeledidGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGNLRDRNDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCIFSNRYLL
*********************************DIDGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGNLRDRNDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCIFSNRY**
****************************************CDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGN************LEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCIFSNRYLL
MGSSLQKPIENRECPRQEKENLRQEEIKEEELEDIDGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGNLRDRNDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCIFSNRYLL
***SLQKPIENRECPRQEKENLRQE***********GTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGNLRDRNDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCIFS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSSLQKPIENRECPRQEKENLRQEEIKEEELEDIDGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGNLRDRNDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCIFSNRYLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query237 2.2.26 [Sep-21-2011]
P50876292 Probable E3 ubiquitin-pro yes no 0.848 0.688 0.267 1e-10
A4IIY1292 Probable E3 ubiquitin-pro no no 0.852 0.691 0.264 3e-10
Q4KLT0282 Probable E3 ubiquitin-pro N/A no 0.721 0.606 0.272 6e-09
A5PK27304 E3 ubiquitin-protein liga no no 0.759 0.592 0.288 7e-09
Q925F3292 Probable E3 ubiquitin-pro yes no 0.848 0.688 0.262 9e-09
Q7Z419303 E3 ubiquitin-protein liga no no 0.759 0.594 0.288 9e-09
Q6DH94293 Probable E3 ubiquitin-pro no no 0.827 0.668 0.253 1e-08
Q9Z1K6 492 E3 ubiquitin-protein liga no no 0.632 0.304 0.294 9e-08
Q8BKD6301 E3 ubiquitin-protein liga no no 0.860 0.677 0.251 1e-07
Q9JI90485 E3 ubiquitin-protein liga no no 0.658 0.321 0.248 3e-07
>sp|P50876|R144A_HUMAN Probable E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 Back     alignment and function desciption
 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 89/213 (41%), Gaps = 12/213 (5%)

Query: 35  IDGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHC-- 92
           +D   +C +C+    V  +      C   FC  C  +Y+E+ +++     I CP   C  
Sbjct: 14  LDPLVSCKLCLGEYPVE-QMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPK 72

Query: 93  EQFLDPFACKHTIPSSLFLKWCDHLCEDYVLGFE--RSYCPNRNCMAVMVNECEGIGRVK 150
           +  L     +  + + +  ++     E  VL F+  R++CP   C AV   +  G+   +
Sbjct: 73  QGHLQENEIECMVAAEIMQRYKKLQFEREVL-FDPCRTWCPASTCQAVCQLQDVGLQTPQ 131

Query: 151 KAQCPKCKQWFCFQCKLAWHAGYRCEESGN---LRDRNDIAFGKLLEKMNWTRCPGCGNC 207
             QC  C+  FC  CK +WH G  C E+     L      AF    +     RCP C   
Sbjct: 132 PVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVY 191

Query: 208 IERKKGCRIMF---CRFIFLSLCLCIFSNRYLL 237
           IER +GC  M    C+  F   CL    + +LL
Sbjct: 192 IERDEGCAQMMCKNCKHAFCWYCLESLDDDFLL 224
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 Back     alignment and function description
>sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 Back     alignment and function description
>sp|A5PK27|R144B_BOVIN E3 ubiquitin-protein ligase RNF144B OS=Bos taurus GN=RNF144B PE=2 SV=1 Back     alignment and function description
>sp|Q925F3|R144A_MOUSE Probable E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 Back     alignment and function description
>sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 Back     alignment and function description
>sp|Q6DH94|R1442_DANRE Probable E3 ubiquitin-protein ligase RNF144A-B OS=Danio rerio GN=rnf144ab PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BKD6|R144B_MOUSE E3 ubiquitin-protein ligase RNF144B OS=Mus musculus GN=Rnf144b PE=2 SV=2 Back     alignment and function description
>sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
224135813228 predicted protein [Populus trichocarpa] 0.864 0.899 0.518 2e-54
255578926255 zinc finger protein, putative [Ricinus c 0.864 0.803 0.495 2e-53
224146525241 predicted protein [Populus trichocarpa] 0.877 0.863 0.479 3e-51
359478253212 PREDICTED: LOW QUALITY PROTEIN: probable 0.780 0.872 0.5 6e-50
255578922213 zinc finger protein, putative [Ricinus c 0.763 0.849 0.546 8e-49
224068789237 predicted protein [Populus trichocarpa] 0.776 0.776 0.454 7e-41
224142755307 predicted protein [Populus trichocarpa] 0.848 0.654 0.382 3e-33
297738503329 unnamed protein product [Vitis vinifera] 0.772 0.556 0.382 2e-32
255550303 400 zinc finger protein, putative [Ricinus c 0.767 0.455 0.373 3e-32
225444595 358 PREDICTED: probable E3 ubiquitin-protein 0.772 0.511 0.382 3e-32
>gi|224135813|ref|XP_002327310.1| predicted protein [Populus trichocarpa] gi|222835680|gb|EEE74115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 146/220 (66%), Gaps = 15/220 (6%)

Query: 1   MGSSLQKPIENRECPRQEKENLRQEEIKEEELEDIDGTFTCDICIEPMSVNNKFKNNNLC 60
           MG+++QK  E +    +E   LRQEE         D  FTC+IC EPM    KFKN +LC
Sbjct: 1   MGNTMQKSEETK---VEEPGLLRQEE---------DSNFTCEICTEPMLAIRKFKNGSLC 48

Query: 61  THPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFACKHTIPSSLFLKWCDHLCED 120
            HPFC DC  KYIEV V ++ T  IECPGL+C+Q LDP +C+  I   +F KWCDHLC+ 
Sbjct: 49  KHPFCLDCIAKYIEVTVEES-TGCIECPGLNCKQPLDPLSCRRIISKPIFEKWCDHLCDS 107

Query: 121 YVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWHAGYRCEESGN 180
            VLG E  YCP R+C  +++NEC  +  +KK +CP CK+ FCF CK+ WHAGYRC ES +
Sbjct: 108 TVLGSESCYCPYRDCSVLVLNEC--MDNLKKIKCPNCKKNFCFLCKIPWHAGYRCNESRH 165

Query: 181 LRDRNDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCR 220
           LRDRNDI  G+L+E+  WTRC  CG+ +ER  GCR + C+
Sbjct: 166 LRDRNDILVGELIEEKRWTRCYNCGHSVERVSGCRDIKCK 205

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255578926|ref|XP_002530316.1| zinc finger protein, putative [Ricinus communis] gi|223530172|gb|EEF32083.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224146525|ref|XP_002326038.1| predicted protein [Populus trichocarpa] gi|222862913|gb|EEF00420.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359478253|ref|XP_003632093.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein ligase RNF144A-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255578922|ref|XP_002530314.1| zinc finger protein, putative [Ricinus communis] gi|223530170|gb|EEF32081.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224068789|ref|XP_002326200.1| predicted protein [Populus trichocarpa] gi|222833393|gb|EEE71870.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142755|ref|XP_002324718.1| predicted protein [Populus trichocarpa] gi|222866152|gb|EEF03283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297738503|emb|CBI27748.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255550303|ref|XP_002516202.1| zinc finger protein, putative [Ricinus communis] gi|223544688|gb|EEF46204.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225444595|ref|XP_002277363.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-B-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
TAIR|locus:2091030303 AT3G14250 [Arabidopsis thalian 0.818 0.640 0.328 6.3e-37
TAIR|locus:2084116320 AT3G53690 [Arabidopsis thalian 0.784 0.581 0.365 1.1e-34
TAIR|locus:2101074346 AT3G43750 [Arabidopsis thalian 0.759 0.520 0.296 2.3e-23
TAIR|locus:1006230127384 AT2G26135 [Arabidopsis thalian 0.746 0.460 0.306 1e-22
TAIR|locus:2085612348 AT3G45540 [Arabidopsis thalian 0.751 0.511 0.308 9e-22
TAIR|locus:504955785213 AT3G45555 [Arabidopsis thalian 0.763 0.849 0.292 8e-21
TAIR|locus:2085672408 AT3G45580 [Arabidopsis thalian 0.755 0.438 0.310 1.1e-20
TAIR|locus:2057401398 AT2G26130 [Arabidopsis thalian 0.751 0.447 0.279 2.1e-20
TAIR|locus:2133935 532 AT4G19670 [Arabidopsis thalian 0.734 0.327 0.304 3.7e-20
DICTYBASE|DDB_G0286289611 DDB_G0286289 "C3HC4-type zinc 0.822 0.319 0.240 1e-18
TAIR|locus:2091030 AT3G14250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 6.3e-37, P = 6.3e-37
 Identities = 67/204 (32%), Positives = 117/204 (57%)

Query:    41 CDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDPFA 100
             C IC++    ++ F+    CTH +C DCTV+Y+  K+++N  ++I+CP + C + ++P+ 
Sbjct:    95 CMICMDEKPSSDIFRGTTNCTHAYCTDCTVRYVATKIKEN-ASRIKCPDVECTRLIEPYT 153

Query:   101 CKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQW 160
             C+  IP  +F +W   LCE  +  +++ YCP ++C A+MVN   G   V + +C  C + 
Sbjct:   154 CRDLIPKDVFDRWEKILCESLISSWDKFYCPFKDCSAMMVNNENGDANVTQTECRSCHRL 213

Query:   161 FCFQCKLAWHAGYRCEES---GNLR----DRNDIAFGKLLEKMNWTRCPGCGNCIERKKG 213
             FC QCK+ WHAG  C+E    GN +    D +D    ++ +   W RCP C   +++ +G
Sbjct:   214 FCVQCKVTWHAGIGCDEFQRFGNTKKKSSDEDDALLIQMAKNKQWRRCPSCKFYVDKVEG 273

Query:   214 CRIMFCR--FIFLSLCLCIFSNRY 235
             C+ + CR  + F   C  ++S+ +
Sbjct:   274 CQHIKCRCGYQFCYGCGSVWSSSH 297
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101074 AT3G43750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085612 AT3G45540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955785 AT3G45555 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085672 AT3G45580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057401 AT2G26130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133935 AT4G19670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286289 DDB_G0286289 "C3HC4-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00410007
hypothetical protein (228 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
smart0064764 smart00647, IBR, In Between Ring fingers 2e-06
pfam0148563 pfam01485, IBR, IBR domain 2e-04
>gnl|CDD|214763 smart00647, IBR, In Between Ring fingers Back     alignment and domain information 
 Score = 43.6 bits (103), Expect = 2e-06
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 112 KWCDHLCEDYVL-GFERSYCPNRNCMAVMVNECEGIGRVKKAQCPKCKQWFCFQCKLAWH 170
           K+   L E YV    +  +CP  +C A +           +  CPKC   FCF+CK+ WH
Sbjct: 2   KYERLLLESYVESNPDLKWCPAPDCSAAI--IVTEEEGCNRVTCPKCGFSFCFRCKVPWH 59

Query: 171 AGYRC 175
           +   C
Sbjct: 60  SPVSC 64

the domains occurs between pairs og RING fingers. Length = 64
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 99.95
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 99.93
smart0064764 IBR In Between Ring fingers. the domains occurs be 99.34
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 99.27
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.63
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.49
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.45
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.43
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.39
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.32
PF1463444 zf-RING_5: zinc-RING finger domain 98.23
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.17
PHA02926242 zinc finger-like protein; Provisional 98.09
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.07
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.05
PHA02929238 N1R/p28-like protein; Provisional 97.88
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.83
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.83
smart0064764 IBR In Between Ring fingers. the domains occurs be 97.82
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.69
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.69
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.67
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.62
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.62
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 97.57
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.48
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.39
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 97.09
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.03
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.0
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.0
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.68
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.64
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.42
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.38
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.2
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.07
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 95.95
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 95.9
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 95.83
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 95.76
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.56
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.51
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.39
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.33
KOG2660 331 consensus Locus-specific chromosome binding protei 95.01
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.22
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.05
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 93.93
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 93.54
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 93.3
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 93.25
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.09
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 92.88
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.84
KOG4739233 consensus Uncharacterized protein involved in syna 92.78
smart0066152 RPOL9 RNA polymerase subunit 9. 92.76
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.73
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 92.49
KOG3039303 consensus Uncharacterized conserved protein [Funct 92.08
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 91.68
PRK0043250 30S ribosomal protein S27ae; Validated 91.49
PF04641260 Rtf2: Rtf2 RING-finger 91.47
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.2
KOG4445368 consensus Uncharacterized conserved protein, conta 91.16
COG5152259 Uncharacterized conserved protein, contains RING a 91.05
PHA0062659 hypothetical protein 91.01
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 89.98
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 89.52
KOG3002299 consensus Zn finger protein [General function pred 88.82
PF1371937 zinc_ribbon_5: zinc-ribbon domain 88.67
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 88.66
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 88.45
PF1371736 zinc_ribbon_4: zinc-ribbon domain 88.39
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 88.07
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 87.89
KOG149384 consensus Anaphase-promoting complex (APC), subuni 87.76
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 87.61
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 87.09
KOG3053293 consensus Uncharacterized conserved protein [Funct 86.75
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 86.66
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 86.33
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 86.31
PLN03086567 PRLI-interacting factor K; Provisional 86.04
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 85.83
PHA03096284 p28-like protein; Provisional 85.71
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 85.71
KOG1940276 consensus Zn-finger protein [General function pred 85.5
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 85.39
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 85.36
KOG2906105 consensus RNA polymerase III subunit C11 [Transcri 85.19
KOG4367 699 consensus Predicted Zn-finger protein [Function un 85.16
KOG1941518 consensus Acetylcholine receptor-associated protei 85.09
COG52191525 Uncharacterized conserved protein, contains RING Z 84.45
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 84.42
KOG0297 391 consensus TNF receptor-associated factor [Signal t 84.21
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 83.42
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 82.19
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 82.07
COG5236 493 Uncharacterized conserved protein, contains RING Z 81.86
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 81.68
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 81.58
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 81.2
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 81.15
PF1495244 zf-tcix: Putative treble-clef, zinc-finger, Zn-bin 80.08
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 80.05
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-36  Score=263.03  Aligned_cols=208  Identities=31%  Similarity=0.591  Sum_probs=170.5

Q ss_pred             hHHHHHHHHHhhhhhcCCCCccccccccCCCccccccccCCCCCcccHHHHHHHHHhhcccCCceeecCCCCcCCCCCCH
Q 026541           19 KENLRQEEIKEEELEDIDGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQFLDP   98 (237)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~C~iC~~~~~~~~~~~~~~~C~H~~C~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~i~~   98 (237)
                      .+.++.+.+.+ ......+..+|.||+.+....+.+..+..|+|.||.+|+++|++++.  .....|+||..+|...++.
T Consensus       128 ~~~lA~e~i~s-~~~~~~~~~~C~iC~~e~~~~~~~f~~~~C~H~fC~~C~k~~iev~~--~~~~~~~C~~~~C~~~l~~  204 (384)
T KOG1812|consen  128 AYKLAREAIVS-QLPSKLPKEECGICFVEDPEAEDMFSVLKCGHRFCKDCVKQHIEVKL--LSGTVIRCPHDGCESRLTL  204 (384)
T ss_pred             HHHHHHHhhcc-ccccccccccCccCccccccHhhhHHHhcccchhhhHHhHHHhhhhh--ccCCCccCCCCCCCccCCH
Confidence            34444444433 23333468899999966655533334789999999999999999993  3568899999999999999


Q ss_pred             HHHhccCChhHHHHHHHHHHHHhhcCCCcccCCccccCceeeeccccC-CcccceeCcccchhhccccccCcCCCCCChh
Q 026541           99 FACKHTIPSSLFLKWCDHLCEDYVLGFERSYCPNRNCMAVMVNECEGI-GRVKKAQCPKCKQWFCFQCKLAWHAGYRCEE  177 (237)
Q Consensus        99 ~~i~~~l~~~~~~~y~~~~~~~~~~~~~~~~Cp~~~C~~~~~~~~~~~-~~~~~~~C~~C~~~~C~~C~~~~H~~~~C~~  177 (237)
                      +....+|++.+.++|.+.+.+.++...+.+|||+++|...+...+... .+.....|+.|+..||.+|+.+||++.+|++
T Consensus       205 ~~c~~llt~kl~e~~e~~~~e~~i~~~~~~ycp~~~C~~l~~~~el~~~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~e  284 (384)
T KOG1812|consen  205 ESCRKLLTPKLREMWEQRLKEEVIPSLDRVYCPYPRCSSLMSKTELSSEVKSKRRPCVKCHELFCVKCKVPWHANLSCEE  284 (384)
T ss_pred             HHHhhhcCHHHHHHHHHHHHHHhhhhhhcccCCCCCchHhhhhhhhccchhhcccccccCCCceeecCCCcCCCCCCHHH
Confidence            999999999999999999999998866666999999999998766432 2356678999999999999999999999999


Q ss_pred             hhccccc--chHHHHHHHhcCCcccCCCCCcceeecCCCcceEecCCcEEEeccc
Q 026541          178 SGNLRDR--NDIAFGKLLEKMNWTRCPGCGNCIERKKGCRIMFCRFIFLSLCLCI  230 (237)
Q Consensus       178 ~~~~~~~--~~~~~~~~~~~~~~k~CP~C~~~iek~~GCnhm~C~C~~~fc~~c~  230 (237)
                      ++++..+  .+......++ .+||+||+|+..|++++|||||+|+||+.|||.|.
T Consensus       285 ykk~~~~~~~d~~~~~~la-~~wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~  338 (384)
T KOG1812|consen  285 YKKLNPEEYVDDITLKYLA-KRWRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCG  338 (384)
T ss_pred             HHHhCCcccccHHHHHHHH-HhcCcCcccceeeeecCCcceEEeeccccchhhcC
Confidence            9998754  3333333444 89999999999999999999999999999999998

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 7e-09
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 2e-05
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
 Score = 51.0 bits (122), Expect = 7e-09
 Identities = 16/88 (18%), Positives = 32/88 (36%), Gaps = 3/88 (3%)

Query: 37  GTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHC--EQ 94
           G+  C +C+    V         C   FC  C  +Y+E+ +++     I CP   C  + 
Sbjct: 4   GSSGCKLCLGEYPVEQMTTIAQ-CQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQG 62

Query: 95  FLDPFACKHTIPSSLFLKWCDHLCEDYV 122
            L     +  + + +  ++     E   
Sbjct: 63  HLQENEIECMVAAEIMQRYKKLQFERSG 90
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.72
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 99.48
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 99.37
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 99.34
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.02
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.77
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.73
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.71
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.69
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.66
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.66
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.65
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.65
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.65
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.62
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.62
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.6
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.56
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.56
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.56
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.54
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.53
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.52
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.51
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.51
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.5
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.5
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.46
2ect_A78 Ring finger protein 126; metal binding protein, st 98.45
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.43
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.42
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.42
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.41
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.38
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.36
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.35
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.33
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.33
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.31
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.3
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.29
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.25
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.2
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.19
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.15
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.15
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.15
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.11
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.08
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.03
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.95
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.95
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.95
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.89
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.86
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.83
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.79
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.78
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.71
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.58
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.58
2ea5_A68 Cell growth regulator with ring finger domain prot 97.54
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.52
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.48
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.47
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.22
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.2
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.75
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.61
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 96.51
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.11
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.96
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 95.73
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 95.64
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 95.56
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.72
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 93.34
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 91.0
3nw0_A238 Non-structural maintenance of chromosomes element 89.25
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 87.9
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 84.8
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 84.2
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 83.79
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 83.2
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 81.64
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.72  E-value=5.4e-18  Score=118.31  Aligned_cols=88  Identities=18%  Similarity=0.464  Sum_probs=76.5

Q ss_pred             CCCccccccccCCCccccccccCCCCCcccHHHHHHHHHhhcccCCceeecCCCCcCCCC--CCHHHHhccCChhHHHHH
Q 026541           36 DGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQF--LDPFACKHTIPSSLFLKW  113 (237)
Q Consensus        36 ~~~~~C~iC~~~~~~~~~~~~~~~C~H~~C~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~--i~~~~i~~~l~~~~~~~y  113 (237)
                      ...++|+||++++...+ ++.+.+|+|.||.+||.+|+..++.+|...+|+||.++|...  ++++.++.+|+++++++|
T Consensus         3 ~~~~~C~IC~~~~~~~~-~~~l~~CgH~FC~~Cl~~~~~~~i~~g~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky   81 (94)
T 1wim_A            3 SGSSGCKLCLGEYPVEQ-MTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRY   81 (94)
T ss_dssp             CSBCCCSSSCCCCBGGG-EEEETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHH
T ss_pred             CCCcCCcccCccccccc-ceEcCCCCCcccHHHHHHHHHHHhhcCCcccccCccccCCCCCccCHHHHHHHCCHHHHHHH
Confidence            45789999999986543 333457999999999999999999886667899999999999  999999999999999999


Q ss_pred             HHHHHHHhhcC
Q 026541          114 CDHLCEDYVLG  124 (237)
Q Consensus       114 ~~~~~~~~~~~  124 (237)
                      .+++.+.++..
T Consensus        82 ~~~~~~~~v~~   92 (94)
T 1wim_A           82 KKLQFERSGPS   92 (94)
T ss_dssp             HHHHHHSSCSS
T ss_pred             HHHHHHhhhcc
Confidence            99998887764
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 237
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-06
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.8 bits (100), Expect = 2e-06
 Identities = 16/89 (17%), Positives = 32/89 (35%), Gaps = 3/89 (3%)

Query: 36  DGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQ- 94
            G+  C +C+    V         C   FC  C  +Y+E+ +++     I CP   C + 
Sbjct: 3   SGSSGCKLCLGEYPVEQMTTIAQ-CQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQ 61

Query: 95  -FLDPFACKHTIPSSLFLKWCDHLCEDYV 122
             L     +  + + +  ++     E   
Sbjct: 62  GHLQENEIECMVAAEIMQRYKKLQFERSG 90

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.71
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 99.48
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.26
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.89
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.72
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 98.7
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.68
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.58
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.56
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.41
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.36
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.36
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.33
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.33
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.21
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.17
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.04
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.58
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.32
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 96.9
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 92.91
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 92.38
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 90.45
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.71  E-value=5.3e-18  Score=116.68  Aligned_cols=88  Identities=18%  Similarity=0.468  Sum_probs=76.1

Q ss_pred             CCCCccccccccCCCccccccccCCCCCcccHHHHHHHHHhhcccCCceeecCCCCcCCC--CCCHHHHhccCChhHHHH
Q 026541           35 IDGTFTCDICIEPMSVNNKFKNNNLCTHPFCQDCTVKYIEVKVRDNNTAKIECPGLHCEQ--FLDPFACKHTIPSSLFLK  112 (237)
Q Consensus        35 ~~~~~~C~iC~~~~~~~~~~~~~~~C~H~~C~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~--~i~~~~i~~~l~~~~~~~  112 (237)
                      +.++..|+||+++++.. .++.++.|+|.||.+||..|++++|.+|...+|+||..+|..  .+++.+|+.+|+++++++
T Consensus         2 ~~~~~~C~IC~~~~~~~-~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~k   80 (94)
T d1wima_           2 SSGSSGCKLCLGEYPVE-QMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQR   80 (94)
T ss_dssp             CCSBCCCSSSCCCCBGG-GEEEETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHH
T ss_pred             CCCCCcCccCCCcccCC-ceEEECCCCCEeCCcCHHHHHHHHHhcCCccccCCcCCCCCCCcccCHHHHHHhCCHHHHHH
Confidence            35688999999999554 444577899999999999999999998778899999988864  588999999999999999


Q ss_pred             HHHHHHHHhhc
Q 026541          113 WCDHLCEDYVL  123 (237)
Q Consensus       113 y~~~~~~~~~~  123 (237)
                      |.++.++++..
T Consensus        81 y~~~~l~~~~~   91 (94)
T d1wima_          81 YKKLQFERSGP   91 (94)
T ss_dssp             HHHHHHHSSCS
T ss_pred             HHHHHHHhccc
Confidence            99998887654
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure