Citrus Sinensis ID: 026583

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHHVTYDDETSNSDEEEEEEEDDDDDDEEEQLDPRHSV
cccccccccccccccccccccEEcccccccccccccccccccccccEEHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccccccccccHHHcccccccc
cccEEEEEccccccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccEEEEccccccccccccccHHHHHHHHHcccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccHHccccccccHHHcccccccccc
MGDVVLFVEdfksnpettshcricheeefescnsleapcacsgtvkfahrDCIQRWcyekgnttceiclqeygpgytapskkSQLIEAAVTISlqiprrehvprnpRLVAIAERLsaeshypqcssaagrTAACCRSLALTFTVLLLVKHLFAVltgntddypFALVTVLLLRACGIILPMYVLMRTITAIHNSIRReyhhvtyddetsnsdeeeeeeeddddddeeeqldprhsv
MGDVVLFVedfksnpettshcrICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTIslqiprrehvprNPRLVAIAERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHhvtyddetsnsdeeeeeeeddddddeeeqldprhsv
MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHHVTYDDETSNSdeeeeeeeddddddeeeQLDPRHSV
***VVLFVEDFK****TTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHHVTY********************************
****VLF**************RICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHH***********************************
MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAES************AACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHHVT*********************************
**DVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHH***********************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTITAIHNSIRREYHHVTYDDETSNSDEEEEEEEDDDDDDEEEQLDPRHSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query236 2.2.26 [Sep-21-2011]
Q32L65245 E3 ubiquitin-protein liga yes no 0.241 0.232 0.389 4e-06
Q9H992704 E3 ubiquitin-protein liga yes no 0.216 0.072 0.372 4e-06
Q5R9W2707 E3 ubiquitin-protein liga yes no 0.216 0.072 0.372 4e-06
Q3TZ87348 E3 ubiquitin-protein liga yes no 0.309 0.209 0.337 8e-06
Q86YJ5346 E3 ubiquitin-protein liga no no 0.309 0.210 0.337 9e-06
Q9P0N8246 E3 ubiquitin-protein liga no no 0.241 0.231 0.355 1e-05
Q1LVZ2249 E3 ubiquitin-protein liga no no 0.216 0.204 0.407 1e-05
Q0P496421 E3 ubiquitin-protein liga no no 0.309 0.173 0.337 2e-05
Q5XI50692 E3 ubiquitin-protein liga no no 0.216 0.073 0.355 2e-05
Q9WV66693 E3 ubiquitin-protein liga no no 0.216 0.073 0.355 2e-05
>sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos taurus GN=MARCH2 PE=2 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 14  NPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEY 72
            P     CRICHE    +  SL +PC CSGT+   H+ C++RW      + CE+C  E+
Sbjct: 57  TPSDGPFCRICHEGA--NGESLLSPCGCSGTLGAVHKSCLERWLSSSNTSYCELCHTEF 113
E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
Bos taurus (taxid: 9913)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9H992|MARH7_HUMAN E3 ubiquitin-protein ligase MARCH7 OS=Homo sapiens GN=MARCH7 PE=1 SV=1 Back     alignment and function description
>sp|Q5R9W2|MARH7_PONAB E3 ubiquitin-protein ligase MARCH7 OS=Pongo abelii GN=MARCH7 PE=2 SV=1 Back     alignment and function description
>sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 Back     alignment and function description
>sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 Back     alignment and function description
>sp|Q9P0N8|MARH2_HUMAN E3 ubiquitin-protein ligase MARCH2 OS=Homo sapiens GN=MARCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Danio rerio GN=march2 PE=2 SV=1 Back     alignment and function description
>sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio rerio GN=march4 PE=2 SV=1 Back     alignment and function description
>sp|Q5XI50|MARH7_RAT E3 ubiquitin-protein ligase MARCH7 OS=Rattus norvegicus GN=March7 PE=2 SV=1 Back     alignment and function description
>sp|Q9WV66|MARH7_MOUSE E3 ubiquitin-protein ligase MARCH7 OS=Mus musculus GN=March7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
297743970221 unnamed protein product [Vitis vinifera] 0.817 0.873 0.668 5e-68
225437543220 PREDICTED: uncharacterized protein LOC10 0.813 0.872 0.671 6e-68
388517545234 unknown [Lotus japonicus] 0.915 0.923 0.584 9e-62
356534819227 PREDICTED: uncharacterized protein LOC10 0.923 0.960 0.577 3e-61
356501871220 PREDICTED: uncharacterized protein LOC10 0.902 0.968 0.582 3e-60
357511349219 E3 ubiquitin-protein ligase MARCH3 [Medi 0.906 0.977 0.549 1e-59
388522949215 unknown [Medicago truncatula] 0.889 0.976 0.555 1e-58
255548477213 protein binding protein, putative [Ricin 0.834 0.924 0.613 2e-57
217074272196 unknown [Medicago truncatula] 0.809 0.974 0.580 2e-56
356505627220 PREDICTED: uncharacterized protein LOC10 0.843 0.904 0.558 3e-55
>gi|297743970|emb|CBI36940.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  263 bits (671), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 137/205 (66%), Positives = 164/205 (80%), Gaps = 12/205 (5%)

Query: 1   MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEK 60
           MGDVVLFV+DF+ N     HCRICHE EFESC +LEAPCACSGTVKFAHRDCIQRWC EK
Sbjct: 1   MGDVVLFVDDFELN-SAVPHCRICHEAEFESCKTLEAPCACSGTVKFAHRDCIQRWCNEK 59

Query: 61  GNTTCEICLQEYGPGYTA--PSKKSQLIEAAVTI--SLQIPRREHVPRNPRLVAIAERLS 116
           GNTTCEICLQEY PGYTA  P KK+QL++ AVTI  SL+IPRR     +PR VA+A+   
Sbjct: 60  GNTTCEICLQEYEPGYTAPPPPKKAQLVDVAVTIRGSLEIPRRRQELEDPRRVAMADG-- 117

Query: 117 AESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACG 176
                P+C++AA R A+CCR +AL FTVLLLV+HLFAV+TG+T+DYPF L+T+L+LR  G
Sbjct: 118 -----PECTAAADRGASCCRVVALIFTVLLLVRHLFAVVTGSTEDYPFTLLTLLILRTSG 172

Query: 177 IILPMYVLMRTITAIHNSIRREYHH 201
           IILPMY+++RTI+AI NSIR  Y+ 
Sbjct: 173 IILPMYIVIRTISAIQNSIREHYYQ 197

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225437543|ref|XP_002275880.1| PREDICTED: uncharacterized protein LOC100260678 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388517545|gb|AFK46834.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356534819|ref|XP_003535949.1| PREDICTED: uncharacterized protein LOC100776501 [Glycine max] Back     alignment and taxonomy information
>gi|356501871|ref|XP_003519747.1| PREDICTED: uncharacterized protein LOC100797029 [Glycine max] Back     alignment and taxonomy information
>gi|357511349|ref|XP_003625963.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula] gi|355500978|gb|AES82181.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388522949|gb|AFK49536.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255548477|ref|XP_002515295.1| protein binding protein, putative [Ricinus communis] gi|223545775|gb|EEF47279.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|217074272|gb|ACJ85496.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356505627|ref|XP_003521591.1| PREDICTED: uncharacterized protein LOC100802379 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
TAIR|locus:505006426218 PIT1 "pitchoun 1" [Arabidopsis 0.826 0.894 0.555 1.5e-53
TAIR|locus:504956090259 AT2G01275 [Arabidopsis thalian 0.754 0.687 0.402 1.8e-32
TAIR|locus:2154109307 AT5G62460 [Arabidopsis thalian 0.788 0.605 0.392 4.7e-32
TAIR|locus:2012477265 AT1G14260 [Arabidopsis thalian 0.754 0.671 0.393 8.8e-31
TAIR|locus:2144441259 AT5G38070 [Arabidopsis thalian 0.728 0.664 0.387 1.8e-30
TAIR|locus:2079112288 AT3G47550 [Arabidopsis thalian 0.733 0.600 0.413 2.1e-29
TAIR|locus:2056710275 AT2G02960 [Arabidopsis thalian 0.754 0.647 0.403 3.4e-29
UNIPROTKB|B7Z739144 MARCH1 "E3 ubiquitin-protein l 0.241 0.395 0.379 5.2e-09
UNIPROTKB|D6REN1141 MARCH1 "E3 ubiquitin-protein l 0.241 0.404 0.379 5.2e-09
TAIR|locus:2175158494 AT5G60580 [Arabidopsis thalian 0.262 0.125 0.435 2.4e-08
TAIR|locus:505006426 PIT1 "pitchoun 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 554 (200.1 bits), Expect = 1.5e-53, P = 1.5e-53
 Identities = 115/207 (55%), Positives = 146/207 (70%)

Query:     1 MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEK 60
             MGDV+LF++D KS    T  CRICHEEE ES    E PCACSGTVKFAHR+CIQRWC EK
Sbjct:     1 MGDVILFIDDTKSKVRIT-RCRICHEEEEESF--FEVPCACSGTVKFAHRNCIQRWCNEK 57

Query:    61 GNTTCEICLQEYGPGYTAPSKKSQLIEAAVTISLQIPRREHVPRNPRLVAIAERLSAESH 120
             GNTTCEICLQ Y  GYTA  K+S+LIE  VTI +   RR    R+ RLV+IAE     S 
Sbjct:    58 GNTTCEICLQVYKDGYTAVLKQSKLIEQEVTIRVNGRRRR---RSRRLVSIAE-----SD 109

Query:   121 YPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILP 180
               QC+S A R A+ CRSL  T +V LL+KH F V+ G T++YPF++ TVL L+A GI+LP
Sbjct:   110 ISQCNSVADRGASFCRSLTFTLSVFLLMKHTFDVIYG-TEEYPFSVFTVLTLKAIGILLP 168

Query:   181 MYVLMRTITAIHNSIRREYHHVTYDDE 207
             M++++RTI+ I  ++RR + +   ++E
Sbjct:   169 MFIIIRTISTIQKTLRRRHQYPESEEE 195
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:504956090 AT2G01275 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154109 AT5G62460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012477 AT1G14260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144441 AT5G38070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079112 AT3G47550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056710 AT2G02960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z739 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6REN1 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028100001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (204 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
pfam12428118 pfam12428, DUF3675, Protein of unknown function (D 1e-46
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 2e-18
pfam1290647 pfam12906, RINGv, RING-variant domain 3e-15
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 3e-10
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 1e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 1e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 3e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.003
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.003
>gnl|CDD|221572 pfam12428, DUF3675, Protein of unknown function (DUF3675) Back     alignment and domain information 
 Score =  150 bits (380), Expect = 1e-46
 Identities = 61/120 (50%), Positives = 79/120 (65%), Gaps = 6/120 (5%)

Query: 74  PGYTAPSKKSQLIEAAVTIS--LQIPRREHVPRNPRLVAI--AERLSAESHYPQCSSAAG 129
           PGYTAP K  Q  E A+TI    +I RR+   R+PRL+A+  AER   E+ Y + ++A  
Sbjct: 1   PGYTAPPKLFQPGETAITIRGNWEISRRDL--RDPRLLAMAEAERQFLEAEYDEYAAANP 58

Query: 130 RTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTIT 189
             AACCRS+AL F VLLL++H   V+ G  DDY F L T+LLLRA GI+LP Y++ R IT
Sbjct: 59  SGAACCRSVALIFMVLLLLRHALPVVLGGADDYSFTLFTLLLLRAAGILLPCYIMARAIT 118

This domain family is found in eukaryotes, and is approximately 120 amino acids in length. The family is found in association with pfam00097. There are two completely conserved residues (R and L) that may be functionally important. Length = 118
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 236
PF12428118 DUF3675: Protein of unknown function (DUF3675) ; I 100.0
KOG3053293 consensus Uncharacterized conserved protein [Funct 99.95
PHA02825162 LAP/PHD finger-like protein; Provisional 99.79
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.7
KOG1609323 consensus Protein involved in mRNA turnover and st 99.68
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.66
PHA02862156 5L protein; Provisional 99.66
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.42
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.55
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.3
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.92
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.91
PHA02929238 N1R/p28-like protein; Provisional 97.84
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.72
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.66
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.63
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.6
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.45
PHA02926242 zinc finger-like protein; Provisional 97.38
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.38
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.34
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.27
COG52191525 Uncharacterized conserved protein, contains RING Z 97.2
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.09
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.01
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.97
PF1463444 zf-RING_5: zinc-RING finger domain 96.8
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.55
KOG149384 consensus Anaphase-promoting complex (APC), subuni 96.44
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.18
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.11
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.11
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 95.53
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 95.35
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.27
PF06679163 DUF1180: Protein of unknown function (DUF1180); In 95.04
KOG4445368 consensus Uncharacterized conserved protein, conta 95.0
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 94.77
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.54
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 93.25
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 93.11
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 93.05
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.33
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 91.92
KOG1941518 consensus Acetylcholine receptor-associated protei 91.48
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 91.4
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 91.14
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 90.83
PLN02189 1040 cellulose synthase 90.59
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 90.51
PLN02436 1094 cellulose synthase A 90.1
KOG0825 1134 consensus PHD Zn-finger protein [General function 90.04
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 89.07
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 88.59
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 88.56
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 88.46
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 88.29
PF14851153 FAM176: FAM176 family 87.54
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 86.7
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 86.38
PLN02195 977 cellulose synthase A 85.76
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 85.42
PF10272358 Tmpp129: Putative transmembrane protein precursor; 84.81
KOG1002791 consensus Nucleotide excision repair protein RAD16 84.64
PLN02400 1085 cellulose synthase 83.56
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 81.44
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 81.18
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 80.43
>PF12428 DUF3675: Protein of unknown function (DUF3675) ; InterPro: IPR022143 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information 
Probab=100.00  E-value=4.6e-37  Score=247.83  Aligned_cols=114  Identities=51%  Similarity=0.846  Sum_probs=106.8

Q ss_pred             CCccCCCCcchhHHHHh--hcccccccccCCCCCchhHHHH--hhhhcccCCCccccCCCCchhHHHHHHHHHHHHHHHH
Q 026583           74 PGYTAPSKKSQLIEAAV--TISLQIPRREHVPRNPRLVAIA--ERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVK  149 (236)
Q Consensus        74 ~~y~~~p~~~pl~~~~i--~~~~~i~~~~~~~~~~~~~~~a--~~~~~~s~Y~~~~~~~~~~~~~cr~~a~i~~vlLllr  149 (236)
                      |+||+|||+.+..+++|  |++|++++  +|++|+++++++  ++++++++|++|+++|++|++||||+|+|||++||||
T Consensus         1 PgYTaPp~~~~~~~~~i~ir~~we~~~--~d~~~~~~~a~~~ae~~~l~~~y~e~~~~~~~~a~~CRsvAli~m~LLllR   78 (118)
T PF12428_consen    1 PGYTAPPKKFQPGETAIDIRGNWEISR--RDLRDPRFLAMAAAERQFLESEYDEYAASNTRGAACCRSVALIFMVLLLLR   78 (118)
T ss_pred             CCCCCCCCCCCcCccceEecCCccccc--cCccchhhhhhhhhhhhccccccccccccCCCceeHHHHHHHHHHHHHHHH
Confidence            68999999999988775  88999654  789999999996  5588999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCCCchHHHHHHHHHHHhhhhHHHHHHHHHHH
Q 026583          150 HLFAVLTGNTDDYPFALVTVLLLRACGIILPMYVLMRTIT  189 (236)
Q Consensus       150 h~l~l~~~g~~d~~f~l~tl~~Lra~Gillp~yI~~rai~  189 (236)
                      |+++++++|.++|+|++||+++|||+|||||||||+|+|+
T Consensus        79 hal~l~~~~~~~~s~~lftl~~LRaaGilLP~Yim~rais  118 (118)
T PF12428_consen   79 HALALVTGGAEDYSFTLFTLLLLRAAGILLPCYIMARAIS  118 (118)
T ss_pred             HHHHHhcCCcccccHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence            9999999999999999999999999999999999999974

The family is found in association with PF00097 from PFAM. There are two completely conserved residues (R and L) that may be functionally important.
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF06679 DUF1180: Protein of unknown function (DUF1180); InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14851 FAM176: FAM176 family Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
2d8s_A80 Solution Structure Of The Ring Domain Of The Human 6e-05
>pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
Query: 14 NPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEY 72
           P +   CRICH E  +  + L  PC C+G++ F H+ C+Q+W        CE+C  E+
Sbjct: 11 TPSSQDICRICHCEGDDE-SPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEF 68

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 1e-18
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 3e-18
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 76.9 bits (189), Expect = 1e-18
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 15 PETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEY 72
          P +   CRICH E  +  + L  PC C+G++ F H+ C+Q+W        CE+C  E+
Sbjct: 12 PSSQDICRICHCEG-DDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEF 68
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.77
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.74
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.7
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.69
2ect_A78 Ring finger protein 126; metal binding protein, st 98.65
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.65
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.62
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.61
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.57
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.49
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.36
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.31
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.31
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.27
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.27
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.26
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.21
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.2
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.16
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.14
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.11
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.1
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.09
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.98
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.96
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.95
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.94
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.9
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.88
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.86
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.84
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.83
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.83
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.8
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.77
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.76
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.73
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.72
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.62
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.62
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.59
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.53
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.51
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.46
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.43
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.24
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.2
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.87
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.8
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.79
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.73
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.57
3nw0_A238 Non-structural maintenance of chromosomes element 96.55
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.47
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.47
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.45
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.32
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.18
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.18
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.15
2ea5_A68 Cell growth regulator with ring finger domain prot 96.09
2f42_A179 STIP1 homology and U-box containing protein 1; cha 95.87
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 95.0
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 94.45
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 94.32
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 92.57
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 92.29
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 91.81
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 91.4
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 85.55
1wil_A89 KIAA1045 protein; ring finger domain, structural g 82.16
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.77  E-value=1.9e-19  Score=127.93  Aligned_cols=57  Identities=35%  Similarity=0.731  Sum_probs=50.7

Q ss_pred             CCCCCeeeEcccCcccCCCccccccccCCCcccccHHHHHHHHHhhCCcccccccCcccC
Q 026583           15 PETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGP   74 (236)
Q Consensus        15 s~~~~~CRIC~~e~~e~~~~li~PC~C~GSlk~vH~~CL~rWl~~k~~~~CeiCk~~y~~   74 (236)
                      .++...||||+++.+   ++++.||+|+||++|||+.||++|++++++.+||+|+++|++
T Consensus         3 ~~~~~~CrIC~~~~~---~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            3 DEDVPVCWICNEELG---NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             TCSCCEETTTTEECS---CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCEeEEeecCCC---CceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            356789999998753   348999999999999999999999999999999999999974
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 236
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-06
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 41.4 bits (96), Expect = 3e-06
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 16 ETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEY 72
          E    C IC+EE           C C+G ++  HR C+  W     NT C+IC   Y
Sbjct: 4  EDVPVCWICNEELGNERFR---ACGCTGELENVHRSCLSTWLTISRNTACQICGVVY 57

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.61
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.75
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.59
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.58
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.48
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.42
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.36
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.84
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.84
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.6
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.57
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.21
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.93
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.63
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.47
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 94.55
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 92.66
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 89.26
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 86.22
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 84.98
d1wema_76 Death associated transcription factor 1, Datf1 (DI 83.81
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 83.69
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.61  E-value=1.6e-16  Score=110.13  Aligned_cols=57  Identities=33%  Similarity=0.714  Sum_probs=51.1

Q ss_pred             CCCCCeeeEcccCcccCCCccccccccCCCcccccHHHHHHHHHhhCCcccccccCcccC
Q 026583           15 PETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGP   74 (236)
Q Consensus        15 s~~~~~CRIC~~e~~e~~~~li~PC~C~GSlk~vH~~CL~rWl~~k~~~~CeiCk~~y~~   74 (236)
                      .++...|+||+++.++   .++.||.|+|+.|+||+.||++|++.+++.+||+|+++|++
T Consensus         3 ded~~~C~IC~~~~~~---~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           3 DEDVPVCWICNEELGN---ERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             TCSCCEETTTTEECSC---CCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCCccCCccCCC---ceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            4677899999987643   47899999999999999999999999999999999999975
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure