Citrus Sinensis ID: 026651

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----

MIHQAIWKPSNSISYSIPSKIRCESRTDTVKMKPPQRQQMGLHTGRDPDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGLVMQV

cccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHcccccccccccccccHHHHccccccccccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccccccccHHcccHHHccccccccccc

cHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHccccHHHccccccHHHccccccccccEEccc

mihqaiwkpsnsisysipskircesrtdtvkmkppqrqqmglhtgrdpdvkkpewlrqkapqgqrFQEVKESLSSlklntvceeaqcpnigecwngggdgiATATIMLLgdtctrgcrfcavktsrnpappdpmepentAKAIASWGVDYIVLtsvdrddipdggsghFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIvrdpraglvmqv

mihqaiwkpsnsisysipskircesrtdtvkmkppqrqqmglhtgrdpdvkkpEWLRqkapqgqrfqeVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTsrnpappdpmepENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARtvkamkkqkpdIMVECLTSDFRGDLRAVETLVHSGldvfahnietvkrlqrivrdpraglvmqv

***************************************************************************LKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVK******************AIASWGVDYIVLTSVDRDDIPD***GHFARTVKAM**QKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVR**********

******************************************************WLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGLVMQ*

MIHQAIWKPSNSISYSIPSKIRCESRTDTVKMKPPQRQQMGLHTGRDPDVKKPEWL****************LSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGLVMQV

************************************************DVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPR*GL****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		235	2.2.26 [Sep-21-2011]
B9RX57		364	Lipoyl synthase, chloropl	N/A	no	0.974	0.629	0.769	1e-108
B9I666		376	Lipoyl synthase 1, chloro	yes	no	0.978	0.611	0.741	1e-100
Q8LEE8		394	Lipoyl synthase, chloropl	yes	no	0.978	0.583	0.693	6e-97
B9N2B0		397	Lipoyl synthase 2, chloro	no	no	0.982	0.581	0.660	3e-93
B8B016		384	Lipoyl synthase 2, chloro	N/A	no	0.808	0.494	0.739	5e-81
Q6L534		384	Lipoyl synthase 2, chloro	yes	no	0.808	0.494	0.734	3e-80
C0PN26		367	Lipoyl synthase 2, chloro	N/A	no	0.825	0.528	0.725	2e-77
B6TN12		361	Lipoyl synthase 1, chloro	N/A	no	0.825	0.537	0.73	5e-77
C5XKZ1		368	Lipoyl synthase, chloropl	N/A	no	0.902	0.576	0.683	6e-77
Q5ZAQ2		370	Lipoyl synthase 1, chloro	no	no	0.902	0.572	0.692	7e-77

>sp\|B9RX57\|LISC_RICCO Lipoyl synthase, chloroplastic OS=Ricinus communis GN=LIP1P PE=3 SV=1	Back alignment and function desciption

 Score =  390 bits (1002), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/243 (76%), Positives = 208/243 (85%), Gaps = 14/243 (5%)

Query: 2   IHQAIWKPSNSISYS-------IPSKIRCE-------SRTDTVKMKPPQRQQMGLHTGRD 47
           + Q ++ PS S+  S       I S+I+C+       S T T  +  P ++ MG +TGRD
Sbjct: 1   MEQTLFNPSISMPKSFYHKHITISSRIQCQLSTNSPSSNTKTTTVTVPSKKTMGPYTGRD 60

Query: 48  PDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 107
           P+VKKPEWLRQ+APQG+RFQEVK SLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM
Sbjct: 61  PNVKKPEWLRQRAPQGERFQEVKHSLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 120

Query: 108 LLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSG 167
           LLGDTCTRGCRFCAVKTSRNP+PPDP+EP+NTA AIASWGVDYIVLTSVDRDD+PDGGSG
Sbjct: 121 LLGDTCTRGCRFCAVKTSRNPSPPDPLEPQNTALAIASWGVDYIVLTSVDRDDLPDGGSG 180

Query: 168 HFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDP 227
           HF+ TV+AMKK KP+IMVECLTSDFRGDL AVETLVHSGLDVFAHNIETVKRLQRIVRDP
Sbjct: 181 HFSETVQAMKKLKPEIMVECLTSDFRGDLEAVETLVHSGLDVFAHNIETVKRLQRIVRDP 240

Query: 228 RAG 230
           RAG
Sbjct: 241 RAG 243

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.
Ricinus communis (taxid: 3988)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 8

>sp\|B9I666\|LISC1_POPTR Lipoyl synthase 1, chloroplastic OS=Populus trichocarpa GN=LIP1P-1 PE=3 SV=1	Back alignment and function description

>sp\|Q8LEE8\|LISC_ARATH Lipoyl synthase, chloroplastic OS=Arabidopsis thaliana GN=LIP1P PE=2 SV=2	Back alignment and function description

>sp\|B9N2B0\|LISC2_POPTR Lipoyl synthase 2, chloroplastic OS=Populus trichocarpa GN=LIP1P-2 PE=3 SV=1	Back alignment and function description

>sp\|B8B016\|LISC2_ORYSI Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-2 PE=3 SV=1	Back alignment and function description

>sp\|Q6L534\|LISC2_ORYSJ Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-2 PE=2 SV=1	Back alignment and function description

>sp\|C0PN26\|LISC2_MAIZE Lipoyl synthase 2, chloroplastic OS=Zea mays GN=LIP1P-2 PE=2 SV=1	Back alignment and function description

>sp\|B6TN12\|LISC1_MAIZE Lipoyl synthase 1, chloroplastic OS=Zea mays GN=LIP1P-1 PE=2 SV=1	Back alignment and function description

>sp\|C5XKZ1\|LISC_SORBI Lipoyl synthase, chloroplastic OS=Sorghum bicolor GN=LIP1P PE=3 SV=1	Back alignment and function description

>sp\|Q5ZAQ2\|LISC1_ORYSJ Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		235
356575490		364	PREDICTED: lipoyl synthase, chloroplasti	0.974	0.629	0.786	1e-106
255554575		364	lipoic acid synthetase, putative [Ricinu	0.974	0.629	0.769	1e-106
225463795		372	PREDICTED: lipoyl synthase, chloroplasti	0.808	0.510	0.915	1e-101
449458724		398	PREDICTED: lipoyl synthase, chloroplasti	0.834	0.492	0.887	1e-100
224126729		376	predicted protein [Populus trichocarpa]	0.978	0.611	0.741	5e-98
356534404		358	PREDICTED: LOW QUALITY PROTEIN: lipoyl s	0.953	0.625	0.772	1e-95
18415808		394	lipoyl synthase [Arabidopsis thaliana] g	0.978	0.583	0.693	4e-95
21553591		393	lipoic acid synthase-like protein [Arabi	0.978	0.585	0.693	4e-95
224127031		397	predicted protein [Populus trichocarpa]	0.982	0.581	0.660	2e-91
302821689		357	hypothetical protein SELMODRAFT_186771 [	0.961	0.633	0.709	1e-89

>gi\|356575490\|ref\|XP_003555873.1\| PREDICTED: lipoyl synthase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/243 (78%), Positives = 210/243 (86%), Gaps = 14/243 (5%)

Query: 1   MIHQAIWKPSNSISYSIPS-----------KIRCESRTDTVKMK--PPQRQQMGLHTGRD 47
           MI Q+++ P  SI++S PS           +IRC++ + +V+ K   P    +G HTGRD
Sbjct: 1   MIRQSLYTPP-SITFSTPSPKRHRFAPPSWRIRCDASSVSVEQKVVGPYPGGLGPHTGRD 59

Query: 48  PDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 107
           P+ KKPEWLRQKAPQG+RFQE+KESLS LKLNTVCEEAQCPNIGECWNGGGDGIATATIM
Sbjct: 60  PNAKKPEWLRQKAPQGERFQEIKESLSHLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 119

Query: 108 LLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSG 167
           LLGDTCTRGCRFCAVKTSRNP P DPMEPENTAKAIASWGVDYIVLTSVDRDD+PDGGSG
Sbjct: 120 LLGDTCTRGCRFCAVKTSRNPPPADPMEPENTAKAIASWGVDYIVLTSVDRDDLPDGGSG 179

Query: 168 HFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDP 227
           HFA+TVKAMK  KP+IMVECLTSDFRGDL+AVETLVHSGLDVFAHNIETVKRLQRIVRDP
Sbjct: 180 HFAQTVKAMKNLKPEIMVECLTSDFRGDLKAVETLVHSGLDVFAHNIETVKRLQRIVRDP 239

Query: 228 RAG 230
           RAG
Sbjct: 240 RAG 242

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255554575|ref|XP_002518326.1| lipoic acid synthetase, putative [Ricinus communis] gi|308197093|sp|B9RX57.1|LISC_RICCO RecName: Full=Lipoyl synthase, chloroplastic; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoate synthase, plastidial; Short=LIP1p; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|223542546|gb|EEF44086.1| lipoic acid synthetase, putative [Ricinus communis]

Back alignment and taxonomy information

>gi\|225463795\|ref\|XP_002270080.1\| PREDICTED: lipoyl synthase, chloroplastic [Vitis vinifera] gi\|297742716\|emb\|CBI35350.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449458724\|ref\|XP_004147097.1\| PREDICTED: lipoyl synthase, chloroplastic-like [Cucumis sativus] gi\|449526690\|ref\|XP_004170346.1\| PREDICTED: lipoyl synthase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|224126729|ref|XP_002319912.1| predicted protein [Populus trichocarpa] gi|308191445|sp|B9I666.1|LISC1_POPTR RecName: Full=Lipoyl synthase 1, chloroplastic; AltName: Full=Lipoate synthase 1; Short=LS 1; Short=Lip-syn 1; AltName: Full=Lipoate synthase, plastidial 1; Short=LIP1p 1; AltName: Full=Lipoic acid synthase 1; Flags: Precursor gi|222858288|gb|EEE95835.1| predicted protein [Populus trichocarpa]

Back alignment and taxonomy information

>gi\|356534404\|ref\|XP_003535745.1\| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi|18415808|ref|NP_568196.1| lipoyl synthase [Arabidopsis thaliana] gi|308191548|sp|Q8LEE8.2|LISC_ARATH RecName: Full=Lipoyl synthase, chloroplastic; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoate synthase, plastidial; Short=LIP1p; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|20373023|dbj|BAB91180.1| lipoic acid synthase [Arabidopsis thaliana] gi|98960967|gb|ABF58967.1| At5g08415 [Arabidopsis thaliana] gi|332003915|gb|AED91298.1| lipoyl synthase [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|21553591\|gb\|AAM62684.1\| lipoic acid synthase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|224127031|ref|XP_002329366.1| predicted protein [Populus trichocarpa] gi|308191448|sp|B9N2B0.1|LISC2_POPTR RecName: Full=Lipoyl synthase 2, chloroplastic; AltName: Full=Lipoate synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoate synthase, plastidial 2; Short=LIP1p 2; AltName: Full=Lipoic acid synthase 2; Flags: Precursor gi|222870416|gb|EEF07547.1| predicted protein [Populus trichocarpa]

Back alignment and taxonomy information

>gi\|302821689\|ref\|XP_002992506.1\| hypothetical protein SELMODRAFT_186771 [Selaginella moellendorffii] gi\|300139708\|gb\|EFJ06444.1\| hypothetical protein SELMODRAFT_186771 [Selaginella moellendorffii]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		235
TAIR\|locus:505006586		394	AT5G08415 [Arabidopsis thalian	0.838	0.5	0.878	1.6e-95
UNIPROTKB\|I3LGA8		372	LIAS "Lipoyl synthase, mitocho	0.770	0.486	0.662	2.8e-66
RGD\|1307270		373	Lias "lipoic acid synthetase"	0.765	0.482	0.661	2.8e-66
UNIPROTKB\|E2R257		373	LIAS "Lipoyl synthase, mitocho	0.765	0.482	0.661	9.4e-66
MGI\|MGI:1934604		373	Lias "lipoic acid synthetase"	0.765	0.482	0.661	9.4e-66
UNIPROTKB\|F1NEN8		339	LIAS "Uncharacterized protein"	0.791	0.548	0.645	1.5e-65
UNIPROTKB\|Q2KIH9		298	LIAS "Lipoyl synthase, mitocho	0.765	0.604	0.655	1.5e-65
UNIPROTKB\|Q5BIP7		372	LIAS "Lipoyl synthase, mitocho	0.765	0.483	0.655	1.5e-65
TAIR\|locus:2051384		374	LIP1 "lipoic acid synthase 1"	0.787	0.494	0.639	6.7e-65
ZFIN\|ZDB-GENE-040426-1528		399	lias "lipoic acid synthetase"	0.765	0.451	0.661	6.7e-65

TAIR\|locus:505006586 AT5G08415 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 950 (339.5 bits), Expect = 1.6e-95, P = 1.6e-95
 Identities = 173/197 (87%), Positives = 185/197 (93%)

Query:    34 PPQRQQMGLHTGRDPDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGEC 93
             P    +MG  TGRDP+VKKP WLRQKAPQG+RFQEVKESLS L LNTVCEEAQCPNIGEC
Sbjct:    79 PGGMPKMGPFTGRDPNVKKPAWLRQKAPQGERFQEVKESLSRLNLNTVCEEAQCPNIGEC 138

Query:    94 WNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVL 153
             WNGGGDG+ATATIM+LGDTCTRGCRFCAVKTSRNP PPDPMEPENTAKAIASWGVDYIV+
Sbjct:   139 WNGGGDGVATATIMVLGDTCTRGCRFCAVKTSRNPPPPDPMEPENTAKAIASWGVDYIVI 198

Query:   154 TSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHN 213
             TSVDRDDIPDGGSGHFA+TVKAMK+ KPDIM+ECLTSDFRGDL AV+TLVHSGLDVFAHN
Sbjct:   199 TSVDRDDIPDGGSGHFAQTVKAMKRHKPDIMIECLTSDFRGDLEAVDTLVHSGLDVFAHN 258

Query:   214 IETVKRLQRIVRDPRAG 230
             +ETVKRLQR+VRDPRAG
Sbjct:   259 VETVKRLQRLVRDPRAG 275

GO:0003824 "catalytic activity" evidence=IEA

GO:0009107 "lipoate biosynthetic process" evidence=IEA;ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0016992 "lipoate synthase activity" evidence=IEA;ISS

GO:0051536 "iron-sulfur cluster binding" evidence=IEA

GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA

UNIPROTKB\|I3LGA8 LIAS "Lipoyl synthase, mitochondrial" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|1307270 Lias "lipoic acid synthetase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R257 LIAS "Lipoyl synthase, mitochondrial" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1934604 Lias "lipoic acid synthetase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NEN8 LIAS "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KIH9 LIAS "Lipoyl synthase, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5BIP7 LIAS "Lipoyl synthase, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

TAIR\|locus:2051384 LIP1 "lipoic acid synthase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1528 lias "lipoic acid synthetase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6L534	LISC2_ORYSJ	2, ., 8, ., 1, ., 8	0.7346	0.8085	0.4947	yes	no
B9I666	LISC1_POPTR	2, ., 8, ., 1, ., 8	0.7411	0.9787	0.6117	yes	no
B9RX57	LISC_RICCO	2, ., 8, ., 1, ., 8	0.7695	0.9744	0.6291	N/A	no
A4RW69	LISC_OSTLU	2, ., 8, ., 1, ., 8	0.7027	0.7744	0.5617	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.8.1.8	0.946
3rd Layer	2.8.1	0.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		235
PLN02428		349	PLN02428, PLN02428, lipoic acid synthase	1e-144
PTZ00413		398	PTZ00413, PTZ00413, lipoate synthase; Provisional	1e-103
PRK05481		289	PRK05481, PRK05481, lipoyl synthase; Provisional	1e-101
COG0320		306	COG0320, LipA, Lipoate synthase [Coenzyme metaboli	7e-95
TIGR00510		302	TIGR00510, lipA, lipoate synthase	2e-82
PRK12928		290	PRK12928, PRK12928, lipoyl synthase; Provisional	1e-73
pfam04055		165	pfam04055, Radical_SAM, Radical SAM superfamily	9e-15
smart00729		216	smart00729, Elp3, Elongator protein 3, MiaB family	1e-06
cd01335		204	cd01335, Radical_SAM, Radical SAM superfamily	5e-04

>gnl\|CDD\|215236 PLN02428, PLN02428, lipoic acid synthase	Back alignment and domain information

 Score =  406 bits (1046), Expect = e-144
 Identities = 145/187 (77%), Positives = 163/187 (87%)

Query: 44  TGRDPDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIAT 103
            GRD  + KP+WLRQ+AP G+++ E+KE L  LKLNTVCEEAQCPNIGECWNGGG G AT
Sbjct: 43  YGRDKPLPKPKWLRQRAPGGEKYTEIKEKLRELKLNTVCEEAQCPNIGECWNGGGTGTAT 102

Query: 104 ATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPD 163
           ATIM+LGDTCTRGCRFCAVKTSR P PPDP EPEN A+AIASWGVDY+VLTSVDRDD+PD
Sbjct: 103 ATIMILGDTCTRGCRFCAVKTSRTPPPPDPDEPENVAEAIASWGVDYVVLTSVDRDDLPD 162

Query: 164 GGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRI 223
           GGSGHFA TV+ +K+ KP+I+VE L  DFRGDL AVET+  SGLDVFAHNIETV+RLQRI
Sbjct: 163 GGSGHFAETVRRLKQLKPEILVEALVPDFRGDLGAVETVATSGLDVFAHNIETVERLQRI 222

Query: 224 VRDPRAG 230
           VRDPRAG
Sbjct: 223 VRDPRAG 229

Length = 349

>gnl\|CDD\|240408 PTZ00413, PTZ00413, lipoate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|235493 PRK05481, PRK05481, lipoyl synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|223397 COG0320, LipA, Lipoate synthase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|233002 TIGR00510, lipA, lipoate synthase	Back alignment and domain information

>gnl\|CDD\|237261 PRK12928, PRK12928, lipoyl synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|217866 pfam04055, Radical_SAM, Radical SAM superfamily	Back alignment and domain information

>gnl\|CDD\|214792 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>gnl\|CDD\|100105 cd01335, Radical_SAM, Radical SAM superfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		235
PTZ00413		398	lipoate synthase; Provisional	100.0
COG0320		306	LipA Lipoate synthase [Coenzyme metabolism]	100.0
KOG2672		360	consensus Lipoate synthase [Coenzyme transport and	100.0
PLN02428		349	lipoic acid synthase	100.0
TIGR00510		302	lipA lipoate synthase. The family shows strong seq	100.0
PRK12928		290	lipoyl synthase; Provisional	100.0
PRK05481		289	lipoyl synthase; Provisional	100.0
COG0502		335	BioB Biotin synthase and related enzymes [Coenzyme	99.97
PRK08508		279	biotin synthase; Provisional	99.92
PLN02389		379	biotin synthase	99.91
KOG2900		380	consensus Biotin synthase [Coenzyme transport and	99.91
PRK15108		345	biotin synthase; Provisional	99.9
PRK09240		371	thiH thiamine biosynthesis protein ThiH; Reviewed	99.87
PRK06256		336	biotin synthase; Validated	99.86
PRK05927		350	hypothetical protein; Provisional	99.85
TIGR02351		366	thiH thiazole biosynthesis protein ThiH. Members t	99.85
PRK08444		353	hypothetical protein; Provisional	99.82
TIGR03700		351	mena_SCO4494 putative menaquinone biosynthesis pro	99.82
PRK08445		348	hypothetical protein; Provisional	99.8
PRK09613		469	thiH thiamine biosynthesis protein ThiH; Reviewed	99.75
PRK07360		371	FO synthase subunit 2; Reviewed	99.75
PRK05926		370	hypothetical protein; Provisional	99.74
TIGR03699		340	mena_SCO4550 menaquinone biosynthesis protein, SCO	99.71
TIGR03551		343	F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav	99.7
PRK09234		843	fbiC FO synthase; Reviewed	99.66
TIGR00433		296	bioB biotin synthetase. Catalyzes the last step of	99.64
PRK09234		843	fbiC FO synthase; Reviewed	99.63
PRK07094		323	biotin synthase; Provisional	99.62
TIGR03550		322	F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav	99.62
TIGR00423		309	radical SAM domain protein, CofH subfamily. This p	99.6
PRK06267		350	hypothetical protein; Provisional	99.59
PRK06245		336	cofG FO synthase subunit 1; Reviewed	99.29
smart00729		216	Elp3 Elongator protein 3, MiaB family, Radical SAM	98.89
cd01335		204	Radical_SAM Radical SAM superfamily. Enzymes of th	98.78
COG1060		370	ThiH Thiamine biosynthesis enzyme ThiH and related	98.66
PLN02951		373	Molybderin biosynthesis protein CNX2	98.43
PF04055		166	Radical_SAM: Radical SAM superfamily; InterPro: IP	98.43
TIGR02666		334	moaA molybdenum cofactor biosynthesis protein A, b	98.36
PRK00164		331	moaA molybdenum cofactor biosynthesis protein A; R	98.34
TIGR02668		302	moaA_archaeal probable molybdenum cofactor biosynt	98.21
PRK13361		329	molybdenum cofactor biosynthesis protein A; Provis	98.2
COG2108		353	Uncharacterized conserved protein related to pyruv	97.88
PRK05301		378	pyrroloquinoline quinone biosynthesis protein PqqE	97.88
PRK08207		488	coproporphyrinogen III oxidase; Provisional	97.87
PRK08599		377	coproporphyrinogen III oxidase; Provisional	97.72
PRK14329		467	(dimethylallyl)adenosine tRNA methylthiotransferas	97.72
TIGR02109		358	PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E.	97.69
TIGR02026		497	BchE magnesium-protoporphyrin IX monomethyl ester	97.65
TIGR01579		414	MiaB-like-C MiaB-like tRNA modifying enzyme. This	97.64
PRK14332		449	(dimethylallyl)adenosine tRNA methylthiotransferas	97.62
TIGR02495		191	NrdG2 anaerobic ribonucleoside-triphosphate reduct	97.58
TIGR03471		472	HpnJ hopanoid biosynthesis associated radical SAM	97.57
TIGR01290		442	nifB nitrogenase cofactor biosynthesis protein Nif	97.56
TIGR00089		429	RNA modification enzyme, MiaB family. This subfami	97.55
PRK05660		378	HemN family oxidoreductase; Provisional	97.49
TIGR00539		360	hemN_rel putative oxygen-independent coproporphyri	97.49
PRK14340		445	(dimethylallyl)adenosine tRNA methylthiotransferas	97.48
PRK14328		439	(dimethylallyl)adenosine tRNA methylthiotransferas	97.46
PRK05799		374	coproporphyrinogen III oxidase; Provisional	97.46
PRK14338		459	(dimethylallyl)adenosine tRNA methylthiotransferas	97.45
PRK14336		418	(dimethylallyl)adenosine tRNA methylthiotransferas	97.35
COG2896		322	MoaA Molybdenum cofactor biosynthesis enzyme [Coen	97.33
TIGR01125		430	MiaB-like tRNA modifying enzyme YliG, TIGR01125. T	97.33
TIGR01574		438	miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3	97.3
PRK14339		420	(dimethylallyl)adenosine tRNA methylthiotransferas	97.23
PRK14331		437	(dimethylallyl)adenosine tRNA methylthiotransferas	97.22
PRK14327		509	(dimethylallyl)adenosine tRNA methylthiotransferas	97.22
TIGR01578		420	MiaB-like-B MiaB-like tRNA modifying enzyme, archa	97.21
PRK14862		440	rimO ribosomal protein S12 methylthiotransferase;	97.19
PRK14325		444	(dimethylallyl)adenosine tRNA methylthiotransferas	97.14
TIGR00238		331	KamA family protein. Note that the E. coli homolog	97.12
TIGR03821		321	AblA_like_1 lysine-2,3-aminomutase-related protein	97.06
PRK14326		502	(dimethylallyl)adenosine tRNA methylthiotransferas	97.01
PRK14330		434	(dimethylallyl)adenosine tRNA methylthiotransferas	96.93
COG2100		414	Predicted Fe-S oxidoreductase [General function pr	96.89
PRK14335		455	(dimethylallyl)adenosine tRNA methylthiotransferas	96.87
PF13353		139	Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A	96.87
PRK14337		446	(dimethylallyl)adenosine tRNA methylthiotransferas	96.86
PRK14333		448	(dimethylallyl)adenosine tRNA methylthiotransferas	96.78
PRK08446		350	coproporphyrinogen III oxidase; Provisional	96.76
TIGR03822		321	AblA_like_2 lysine-2,3-aminomutase-related protein	96.76
TIGR03820		417	lys_2_3_AblA lysine-2,3-aminomutase. This model de	96.76
TIGR00538		455	hemN oxygen-independent coproporphyrinogen III oxi	96.74
PRK09249		453	coproporphyrinogen III oxidase; Provisional	96.69
COG0535		347	Predicted Fe-S oxidoreductases [General function p	96.64
PRK14334		440	(dimethylallyl)adenosine tRNA methylthiotransferas	96.62
TIGR01210		313	conserved hypothetical protein TIGR01210. This fam	96.58
PRK14455		356	ribosomal RNA large subunit methyltransferase N; P	96.45
PRK13347		453	coproporphyrinogen III oxidase; Provisional	96.35
COG0621		437	MiaB 2-methylthioadenine synthetase [Translation,	96.23
COG1856		275	Uncharacterized homolog of biotin synthetase [Func	96.23
TIGR02493		235	PFLA pyruvate formate-lyase 1-activating enzyme. A	96.22
PRK06582		390	coproporphyrinogen III oxidase; Provisional	96.13
PRK11145		246	pflA pyruvate formate lyase-activating enzyme 1; P	96.11
PRK05904		353	coproporphyrinogen III oxidase; Provisional	96.09
PRK08208		430	coproporphyrinogen III oxidase; Validated	95.94
PRK14456		368	ribosomal RNA large subunit methyltransferase N; P	95.91
PRK09057		380	coproporphyrinogen III oxidase; Provisional	95.83
TIGR02491		154	NrdG anaerobic ribonucleoside-triphosphate reducta	95.71
PRK08898		394	coproporphyrinogen III oxidase; Provisional	95.62
PRK14460		354	ribosomal RNA large subunit methyltransferase N; P	95.62
PRK05628		375	coproporphyrinogen III oxidase; Validated	95.57
PF13394		119	Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B	95.48
PRK11121		154	nrdG anaerobic ribonucleotide reductase-activating	95.29
TIGR03470		318	HpnH hopanoid biosynthesis associated radical SAM	95.26
PRK07379		400	coproporphyrinogen III oxidase; Provisional	95.14
PRK14457		345	ribosomal RNA large subunit methyltransferase N; P	95.11
COG1032		490	Fe-S oxidoreductase [Energy production and convers	94.74
PRK14466		345	ribosomal RNA large subunit methyltransferase N; P	94.72
PRK06294		370	coproporphyrinogen III oxidase; Provisional	94.67
PRK14463		349	ribosomal RNA large subunit methyltransferase N; P	94.61
PRK09058		449	coproporphyrinogen III oxidase; Provisional	94.33
TIGR00640		132	acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal	93.82
TIGR03278		404	methan_mark_10 putative methanogenesis marker prot	93.78
PRK14469		343	ribosomal RNA large subunit methyltransferase N; P	93.77
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	93.72
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	93.62
PRK14462		356	ribosomal RNA large subunit methyltransferase N; P	93.61
PRK14468		343	ribosomal RNA large subunit methyltransferase N; P	93.59
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	93.54
PRK08629		433	coproporphyrinogen III oxidase; Provisional	93.35
TIGR00048		355	radical SAM enzyme, Cfr family. A Staphylococcus s	93.07
PRK13745		412	anaerobic sulfatase-maturase; Provisional	93.04
PRK13762		322	tRNA-modifying enzyme; Provisional	92.96
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	92.77
PRK14470		336	ribosomal RNA large subunit methyltransferase N; P	92.57
TIGR01212		302	radical SAM protein, TIGR01212 family. This unchar	92.44
PRK14459		373	ribosomal RNA large subunit methyltransferase N; P	92.38
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	92.21
PRK14464		344	ribosomal RNA large subunit methyltransferase N; P	91.99
TIGR03365		238	Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosyn	91.79
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	91.78
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	91.73
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	91.69
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	91.6
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	91.43
COG0036		220	Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate	91.38
TIGR02826		147	RNR_activ_nrdG3 anaerobic ribonucleoside-triphosph	91.33
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	91.31
cd02071		122	MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin	91.28
PRK08005		210	epimerase; Validated	91.02
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	90.81
PRK11194		372	ribosomal RNA large subunit methyltransferase N; P	90.79
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	90.71
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	90.53
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	90.35
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	90.25
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	90.22
TIGR01768		223	GGGP-family geranylgeranylglyceryl phosphate synth	90.16
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	90.11
COG0731		296	Fe-S oxidoreductases [Energy production and conver	90.06
TIGR00126		211	deoC deoxyribose-phosphate aldolase. Deoxyribose-p	89.93
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	89.89
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	89.83
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	89.43
PRK14454		342	ribosomal RNA large subunit methyltransferase N; P	89.43
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	89.24
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	89.15
PRK14467		348	ribosomal RNA large subunit methyltransferase N; P	89.03
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	88.94
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	88.89
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	88.76
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	88.71
PRK07428		288	nicotinate-nucleotide pyrophosphorylase; Provision	88.34
PRK13758		370	anaerobic sulfatase-maturase; Provisional	88.34
cd02812		219	PcrB_like PcrB_like proteins. One member of this f	88.27
PRK08091		228	ribulose-phosphate 3-epimerase; Validated	87.95
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	87.92
TIGR01211		522	ELP3 histone acetyltransferase, ELP3 family. The S	87.9
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	87.76
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	87.57
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	87.47
COG1509		369	KamA Lysine 2,3-aminomutase [Amino acid transport	87.42
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	87.39
COG3246		298	Uncharacterized conserved protein [Function unknow	87.39
PRK01254		707	hypothetical protein; Provisional	87.31
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	87.3
PRK00507		221	deoxyribose-phosphate aldolase; Provisional	87.28
PRK08883		220	ribulose-phosphate 3-epimerase; Provisional	87.25
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	87.18
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	87.1
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	87.09
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	87.01
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	87.0
COG0635		416	HemN Coproporphyrinogen III oxidase and related Fe	86.83
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	86.59
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	86.51
PF05853		272	DUF849: Prokaryotic protein of unknown function (D	86.3
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	86.27
COG2516		339	Biotin synthase-related enzyme [General function p	86.22
COG4277		404	Predicted DNA-binding protein with the Helix-hairp	86.21
PLN02334		229	ribulose-phosphate 3-epimerase	86.21
PRK14453		347	chloramphenicol/florfenicol resistance protein; Pr	85.93
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	85.92
PF01729		169	QRPTase_C: Quinolinate phosphoribosyl transferase,	85.81
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	85.79
cd02067		119	B12-binding B12 binding domain (B12-BD). This doma	85.76
cd00956		211	Transaldolase_FSA Transaldolase-like fructose-6-ph	85.69
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	85.47
PRK08745		223	ribulose-phosphate 3-epimerase; Provisional	85.39
PLN02617		538	imidazole glycerol phosphate synthase hisHF	85.39
PRK14024		241	phosphoribosyl isomerase A; Provisional	85.01
PRK14461		371	ribosomal RNA large subunit methyltransferase N; P	84.8
PRK14057		254	epimerase; Provisional	84.78
PRK04169		232	geranylgeranylglyceryl phosphate synthase-like pro	84.77
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	84.77
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	84.52
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	84.49
COG2185		143	Sbm Methylmalonyl-CoA mutase, C-terminal domain/su	84.48
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	84.4
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	84.32
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	84.29
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	84.19
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	84.15
PRK09722		229	allulose-6-phosphate 3-epimerase; Provisional	84.04
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	83.75
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	83.66
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	83.62
PRK14465		342	ribosomal RNA large subunit methyltransferase N; P	83.59
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	83.29
PRK14024		241	phosphoribosyl isomerase A; Provisional	82.99
PLN02274		505	inosine-5'-monophosphate dehydrogenase	82.92
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	82.83
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	82.79
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	82.69
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	82.49
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	82.49
KOG3111		224	consensus D-ribulose-5-phosphate 3-epimerase [Carb	82.39
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	82.28
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	82.18
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	82.14
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	82.01
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	81.99
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	81.86
PRK02261		137	methylaspartate mutase subunit S; Provisional	81.75
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	81.6
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	81.53
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	81.53
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	81.37
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	81.04
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	80.3
PRK06096		284	molybdenum transport protein ModD; Provisional	80.26
cd04734		343	OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN	80.2

>PTZ00413 lipoate synthase; Provisional	Back alignment and domain information

Probab=100.00  E-value=5e-71  Score=517.78  Aligned_cols=204  Identities=53%  Similarity=0.967  Sum_probs=190.4

Q ss_pred             CCCCCCccccccccCCCCCCCCCCccceecCCCCc----cHHHHHHHHccCChHhhhhhcCCCCccceeCCC-CCCceee
Q 026651           30 VKMKPPQRQQMGLHTGRDPDVKKPEWLRQKAPQGQ----RFQEVKESLSSLKLNTVCEEAQCPNIGECWNGG-GDGIATA  104 (235)
Q Consensus        30 ~~~~~~~~~~~~~~~~~~~~~~~P~Wlk~~~~~~~----~~~~~~~~l~~~~L~TVCeeA~CPNi~ec~~~~-~~~~~ta  104 (235)
                      ++...++.+.+||.....  .+||+|||+++|.|+    +|.+++++|++++||||||||+||||+|||++| +.|.+||
T Consensus        73 ~~~~~~~~~~~~~~~~~~--~~kP~Wlk~~~~~~~~~~~~~~~~~~~~~~~~L~TVCeea~CPNi~EC~~~~~~~~~~tA  150 (398)
T PTZ00413         73 PEGLKPSAASIGPIKRGE--EPLPPWFKVKVPKGASRRPRFNRIRRSMREKKLHTVCEEAKCPNIGECWGGGDEEGTATA  150 (398)
T ss_pred             ccccccccccCCCccCCC--CCCCcceeecCCCCccccchHHHHHHHHHhCCCceeeCCCCCCChHHHhCCCCCCCCcee
Confidence            456667778888887443  479999999999998    899999999999999999999999999999997 4588999


Q ss_pred             eeeecCCCCCCCCCCcccCCCCCCCCCCchhHHHHHHHHHHcCCcEEEEEeecCCCCCCCchHHHHHHHHHHHhhCCCce
Q 026651          105 TIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIM  184 (235)
Q Consensus       105 T~mIlG~~CtedC~FCAQSt~~~p~~ld~eE~~~~A~aa~~~Gl~y~VVTSg~RddL~D~ga~~~a~~Ir~Ik~~~p~~~  184 (235)
                      ||||||++|||||+|||||++..|.++|++||.++|++++++|++|+|||||+||||+|+|++||+++|++||+.+|++.
T Consensus       151 TfmilG~~CTr~C~FCaqstg~~p~~lD~eEp~~vA~av~~~Gl~~~VVTSv~RDDL~D~ga~~~a~~I~~Ir~~~p~~~  230 (398)
T PTZ00413        151 TIMVMGDHCTRGCRFCSVKTSRKPPPLDPNEPEKVAKAVAEMGVDYIVMTMVDRDDLPDGGASHVARCVELIKESNPELL  230 (398)
T ss_pred             EeeecCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEEEEEcCCCCChhhHHHHHHHHHHHHccCCCCe
Confidence            99999999999999999998665788999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeecCCCCCHHHHHHHHhcCCCeeccCccccccccccccCCCCcccccC
Q 026651          185 VECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGLVMQV  235 (235)
Q Consensus       185 ievl~sdg~l~~e~l~~L~eAG~d~ynHNLETs~rlfp~Vcdtth~Y~~s~  235 (235)
                      ||+|++||+|+++++++|++|||++|||||||||+|||+||+++|+|++++
T Consensus       231 IevligDf~g~~e~l~~L~eAG~dvynHNLETv~rLyp~VRt~~atYe~sL  281 (398)
T PTZ00413        231 LEALVGDFHGDLKSVEKLANSPLSVYAHNIECVERITPYVRDRRASYRQSL  281 (398)
T ss_pred             EEEcCCccccCHHHHHHHHhcCCCEEecccccCHhHHHHHccCcCCHHHHH
Confidence            999999999999999999999999999999999999999995479999874

>COG0320 LipA Lipoate synthase [Coenzyme metabolism]	Back alignment and domain information

>KOG2672 consensus Lipoate synthase [Coenzyme transport and metabolism]	Back alignment and domain information

>PLN02428 lipoic acid synthase	Back alignment and domain information

>TIGR00510 lipA lipoate synthase	Back alignment and domain information

>PRK12928 lipoyl synthase; Provisional	Back alignment and domain information

>PRK05481 lipoyl synthase; Provisional	Back alignment and domain information

>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism]	Back alignment and domain information

>PRK08508 biotin synthase; Provisional	Back alignment and domain information

>PLN02389 biotin synthase	Back alignment and domain information

>KOG2900 consensus Biotin synthase [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK15108 biotin synthase; Provisional	Back alignment and domain information

>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>PRK06256 biotin synthase; Validated	Back alignment and domain information

>PRK05927 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02351 thiH thiazole biosynthesis protein ThiH	Back alignment and domain information

>PRK08444 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family	Back alignment and domain information

>PRK08445 hypothetical protein; Provisional	Back alignment and domain information

>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>PRK07360 FO synthase subunit 2; Reviewed	Back alignment and domain information

>PRK05926 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family	Back alignment and domain information

>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>TIGR00433 bioB biotin synthetase	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>PRK07094 biotin synthase; Provisional	Back alignment and domain information

>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit	Back alignment and domain information

>TIGR00423 radical SAM domain protein, CofH subfamily	Back alignment and domain information

>PRK06267 hypothetical protein; Provisional	Back alignment and domain information

>PRK06245 cofG FO synthase subunit 1; Reviewed	Back alignment and domain information

>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>cd01335 Radical_SAM Radical SAM superfamily	Back alignment and domain information

>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>PLN02951 Molybderin biosynthesis protein CNX2	Back alignment and domain information

>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation	Back alignment and domain information

>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial	Back alignment and domain information

>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed	Back alignment and domain information

>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal	Back alignment and domain information

>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional	Back alignment and domain information

>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only]	Back alignment and domain information

>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional	Back alignment and domain information

>PRK08207 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK08599 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E	Back alignment and domain information

>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase	Back alignment and domain information

>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme	Back alignment and domain information

>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ	Back alignment and domain information

>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB	Back alignment and domain information

>TIGR00089 RNA modification enzyme, MiaB family	Back alignment and domain information

>PRK05660 HemN family oxidoreductase; Provisional	Back alignment and domain information

>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK05799 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125	Back alignment and domain information

>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB	Back alignment and domain information

>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type	Back alignment and domain information

>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional	Back alignment and domain information

>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR00238 KamA family protein	Back alignment and domain information

>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>COG2100 Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PF13353 Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A 3CB8_A 3T7V_A 2YX0_A 3CAN_A	Back alignment and domain information

>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK08446 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>TIGR03820 lys_2_3_AblA lysine-2,3-aminomutase	Back alignment and domain information

>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>PRK09249 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>COG0535 Predicted Fe-S oxidoreductases [General function prediction only]	Back alignment and domain information

>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01210 conserved hypothetical protein TIGR01210	Back alignment and domain information

>PRK14455 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK13347 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown]	Back alignment and domain information

>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme	Back alignment and domain information

>PRK06582 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional	Back alignment and domain information

>PRK05904 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK08208 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PRK14456 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK09057 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>PRK08898 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK14460 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK05628 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PF13394 Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B 1TV7_A 2FB2_A 2FB3_A	Back alignment and domain information

>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional	Back alignment and domain information

>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH	Back alignment and domain information

>PRK07379 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>COG1032 Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>PRK14466 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK06294 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK14463 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK09058 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain	Back alignment and domain information

>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10	Back alignment and domain information

>PRK14469 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>PRK14462 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14468 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>PRK08629 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR00048 radical SAM enzyme, Cfr family	Back alignment and domain information

>PRK13745 anaerobic sulfatase-maturase; Provisional	Back alignment and domain information

>PRK13762 tRNA-modifying enzyme; Provisional	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK14470 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR01212 radical SAM protein, TIGR01212 family	Back alignment and domain information

>PRK14459 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK11194 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>COG0731 Fe-S oxidoreductases [Energy production and conversion]	Back alignment and domain information

>TIGR00126 deoC deoxyribose-phosphate aldolase	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK14454 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>PRK14467 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK13758 anaerobic sulfatase-maturase; Provisional	Back alignment and domain information

>cd02812 PcrB_like PcrB_like proteins	Back alignment and domain information

>PRK08091 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR01211 ELP3 histone acetyltransferase, ELP3 family	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>COG3246 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK01254 hypothetical protein; Provisional	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>PRK00507 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>PRK08883 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism]	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PF05853 DUF849: Prokaryotic protein of unknown function (DUF849); InterPro: IPR008567 This family consists of several hypothetical prokaryotic proteins with no known function	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG2516 Biotin synthase-related enzyme [General function prediction only]	Back alignment and domain information

>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only]	Back alignment and domain information

>PLN02334 ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK14453 chloramphenicol/florfenicol resistance protein; Provisional	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>cd02067 B12-binding B12 binding domain (B12-BD)	Back alignment and domain information

>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK08745 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14057 epimerase; Provisional	Back alignment and domain information

>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>PRK09722 allulose-6-phosphate 3-epimerase; Provisional	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK14465 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>PRK02261 methylaspartate mutase subunit S; Provisional	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>PRK06096 molybdenum transport protein ModD; Provisional	Back alignment and domain information

>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		235
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 39.5 bits (91), Expect = 7e-04
 Identities = 36/266 (13%), Positives = 76/266 (28%), Gaps = 78/266 (29%)

Query: 15  YS-IPSKIRCESRTDTVKMKPPQRQQMGLHTGRDPDVKKPEWLRQKAPQGQRFQEVKESL 73
           Y  + S I+ E R  ++  +    Q+  L+       K          + Q + +++++L
Sbjct: 91  YKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYN------VSRLQPYLKLRQAL 144

Query: 74  SSLKLNT------------------VC--EEAQCPNIGEC-W-NGGGDGIATATIMLLGD 111
             L+                     VC   + QC    +  W N          + +L  
Sbjct: 145 LELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQK 204

Query: 112 TCTR-GCRFCAVKTSRNPAPPDPMEPENTAKA--IASWGVDY----IVLTSVDRDDIPDG 164
              +    + + ++  +      +          + S    Y    +VL      ++ + 
Sbjct: 205 LLYQIDPNWTS-RSDHSSNIKLRIHSIQAELRRLLKSK--PYENCLLVL-----LNVQN- 255

Query: 165 GSGHFARTVKAMKKQKPDIMVEC---LTS------DF-RGDLRAVETLVHS--------G 206
                A+   A      ++   C   LT+      DF         +L H          
Sbjct: 256 -----AKAWNAF-----NL--SCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEV 303

Query: 207 LDVFAHNIET-VKRLQRIVRD--PRA 229
             +    ++   + L R V    PR 
Sbjct: 304 KSLLLKYLDCRPQDLPREVLTTNPRR 329

PyMOL of 1vt4

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		235
3t7v_A		350	Methylornithine synthase PYLB; TIM-barrel fold, mu	99.59
1r30_A		369	Biotin synthase; SAM radical protein, TIM barrel,	99.55
3iix_A		348	Biotin synthetase, putative; adoMet radical, SAM r	99.53
2qgq_A		304	Protein TM_1862; alpha-beta protein, structural ge	98.38
1tv8_A		340	MOAA, molybdenum cofactor biosynthesis protein A;	98.34
3c8f_A		245	Pyruvate formate-lyase 1-activating enzyme; adoMet	97.99
2yx0_A		342	Radical SAM enzyme; predicted tRNA modification en	97.8
1olt_A		457	Oxygen-independent coproporphyrinogen III oxidase;	97.58
2z2u_A		311	UPF0026 protein MJ0257; metal binding protein; 2.4	97.41
2a5h_A		416	L-lysine 2,3-aminomutase; radical SAM, four-iron-f	97.27
3rfa_A		404	Ribosomal RNA large subunit methyltransferase N; r	94.49
1h5y_A		253	HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py	93.62
2w6r_A		266	Imidazole glycerol phosphate synthase subunit HISF	93.59
1thf_D		253	HISF protein; thermophIle, TIM-barrel, histidine b	92.77
3tdn_A		247	FLR symmetric alpha-beta TIM barrel; symmetric sup	92.65
1thf_D		253	HISF protein; thermophIle, TIM-barrel, histidine b	91.94
1ka9_F		252	Imidazole glycerol phosphtate synthase; riken stru	91.8
3lab_A		217	Putative KDPG (2-keto-3-deoxy-6-phosphogluconate)	91.4
1ka9_F		252	Imidazole glycerol phosphtate synthase; riken stru	91.26
1h5y_A		253	HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py	91.18
4e38_A		232	Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho	90.99
2w6r_A		266	Imidazole glycerol phosphate synthase subunit HISF	90.96
1vzw_A		244	Phosphoribosyl isomerase A; histidine biosynthesis	90.21
2y88_A		244	Phosphoribosyl isomerase A; aromatic amino acid bi	89.69
2y88_A		244	Phosphoribosyl isomerase A; aromatic amino acid bi	89.48
1mzh_A		225	Deoxyribose-phosphate aldolase; alpha-beta barrel,	89.1
1jvn_A		555	Glutamine, bifunctional histidine biosynthesis pro	89.05
1ub3_A		220	Aldolase protein; schiff base, deoxyribose phospha	88.96
3no5_A		275	Uncharacterized protein; PFAM DUF849 domain contai	88.92
2y7e_A		282	3-keto-5-aminohexanoate cleavage enzyme; lyase, al	88.79
1z41_A		338	YQJM, probable NADH-dependent flavin oxidoreductas	88.42
1f76_A		336	Dihydroorotate dehydrogenase; monomer, alpha-beta-	88.24
1vzw_A		244	Phosphoribosyl isomerase A; histidine biosynthesis	87.96
3gr7_A		340	NADPH dehydrogenase; flavin, FMN, beta-alpha-barre	87.87
3r12_A		260	Deoxyribose-phosphate aldolase; TIM beta/alpha-bar	87.87
1tqx_A		227	D-ribulose-5-phosphate 3-epimerase, putative; stru	87.83
3oa3_A		288	Aldolase; structural genomics, seattle structural	86.91
4gj1_A		243	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me	86.87
3ndo_A		231	Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid	86.65
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	86.62
3chv_A		284	Prokaryotic domain of unknown function (DUF849) W	86.47
1ydn_A		295	Hydroxymethylglutaryl-COA lyase; TIM-barrel protei	86.19
2b7n_A		273	Probable nicotinate-nucleotide pyrophosphorylase;	85.74
1vc4_A		254	Indole-3-glycerol phosphate synthase; lyase, trypt	85.7
1vcv_A		226	Probable deoxyribose-phosphate aldolase; DERA, hyp	85.62
2jbm_A		299	Nicotinate-nucleotide pyrophosphorylase; NAD, enzy	85.19
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	84.97
1qo2_A		241	Molecule: N-((5-phosphoribosyl)-formimino)-5-amino	84.65
3lot_A		314	Uncharacterized protein; protein of unknown functi	84.46
3ngj_A		239	Deoxyribose-phosphate aldolase; lyase, structural	84.04
3b0p_A		350	TRNA-dihydrouridine synthase; TIM barrel, oxidored	83.88
3f4w_A		211	Putative hexulose 6 phosphate synthase; humps, mal	83.64
3e49_A		311	Uncharacterized protein DUF849 with A TIM barrel;	83.6
1nvm_A		345	HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered	83.56
3ngj_A		239	Deoxyribose-phosphate aldolase; lyase, structural	83.51
3zwt_A		367	Dihydroorotate dehydrogenase (quinone), mitochond;	83.45
1ydo_A		307	HMG-COA lyase; TIM-barrel protein, structural geno	83.1
1vhn_A		318	Putative flavin oxidoreducatase; structural genomi	83.0
3igs_A		232	N-acetylmannosamine-6-phosphate 2-epimerase 2; ene	82.98
3qja_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	82.96
1wbh_A		214	KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli}	82.93
1n7k_A		234	Deoxyribose-phosphate aldolase; A.pernix, tetramer	82.8
3q58_A		229	N-acetylmannosamine-6-phosphate 2-epimerase; TIM b	82.76
3hgj_A		349	Chromate reductase; TIM barrel, oxidoreductase; HE	82.69
1vhc_A		224	Putative KHG/KDPG aldolase; structural genomics, u	82.68
3r2g_A		361	Inosine 5'-monophosphate dehydrogenase; structural	82.62
2cw6_A		298	Hydroxymethylglutaryl-COA lyase, mitochondrial; HM	82.6
3e02_A		311	Uncharacterized protein DUF849; structural genomic	82.45
1ydn_A		295	Hydroxymethylglutaryl-COA lyase; TIM-barrel protei	82.36
3vzx_A		228	Heptaprenylglyceryl phosphate synthase; biosynthes	82.34
3c6c_A		316	3-keto-5-aminohexanoate cleavage enzyme; DUF849 fa	82.21
4avf_A		490	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	82.19
4fo4_A		366	Inosine 5'-monophosphate dehydrogenase; structural	82.11
1y0e_A		223	Putative N-acetylmannosamine-6-phosphate 2-epimer;	82.09
4fxs_A		496	Inosine-5'-monophosphate dehydrogenase; structural	82.09
3tdn_A		247	FLR symmetric alpha-beta TIM barrel; symmetric sup	82.08
4af0_A		556	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	81.73
1mxs_A		225	KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a	81.53
1tv5_A		443	Dhodehase, dihydroorotate dehydrogenase homolog, m	81.1
1aj0_A		282	DHPS, dihydropteroate synthase; antibiotic, resist	81.01
1ydo_A		307	HMG-COA lyase; TIM-barrel protein, structural geno	80.92
3tsm_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	80.18

>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri}	Back alignment and structure

Probab=99.59  E-value=7.6e-16  Score=138.37  Aligned_cols=158  Identities=17%  Similarity=0.172  Sum_probs=124.3

Q ss_pred             cHHHHHHHHcc---CChHhhhhhcCCCCccceeCCCCCCceeeeeee--cCCCCCCCCCCcccCCCCCC--CCCCchhHH
Q 026651           65 RFQEVKESLSS---LKLNTVCEEAQCPNIGECWNGGGDGIATATIML--LGDTCTRGCRFCAVKTSRNP--APPDPMEPE  137 (235)
Q Consensus        65 ~~~~~~~~l~~---~~L~TVCeeA~CPNi~ec~~~~~~~~~taT~mI--lG~~CtedC~FCAQSt~~~p--~~ld~eE~~  137 (235)
                      ...+...++..   ..|..+++.|+  .+++-+.++    .+-.+.+  +++.|+.+|+||+++.....  ..++++|++
T Consensus        24 ~~~e~~~l~~~~~~~~~~~L~~~A~--~~r~~~~g~----~v~~~~~i~~t~~C~~~C~fC~~~~~~~~~~~~ls~eei~   97 (350)
T 3t7v_A           24 TDNDLRTLLSLESKEGLERLYSAAR--KVRDHYFGN----RVFLNCFIYFSTYCKNQCSFCYYNCRNEINRYRLTMEEIK   97 (350)
T ss_dssp             CHHHHHHHHTCCSHHHHHHHHHHHH--HHHHHHHTT----EEEEEEEEEEECCCCCCCTTCTTCTTSCCCCCBCCHHHHH
T ss_pred             CHHHHHHHhcCCChhHHHHHHHHHH--HHHHHHCCC----EEEEEEeeecCCCcCCCCCcCCCcCcCCCCceeCCHHHHH
Confidence            46677777864   34778999999  888887776    2333333  38999999999999843211  247999999


Q ss_pred             HHHHHHHHcCCcEEEEEeecCCCCCCCchHHHHHHHHHHHhhCCCceEEEeecCCCCCHHHHHHHHhcCCCeeccCcccc
Q 026651          138 NTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETV  217 (235)
Q Consensus       138 ~~A~aa~~~Gl~y~VVTSg~RddL~D~ga~~~a~~Ir~Ik~~~p~~~ievl~sdg~l~~e~l~~L~eAG~d~ynHNLETs  217 (235)
                      +.++.+.+.|++.+++++|..+.+. ...+.+.+.++.||+..+   +.+.++.|.+++|.+++|+++|+++|++++||.
T Consensus        98 ~~~~~~~~~G~~~i~l~gGe~p~~~-~~~~~~~~l~~~ik~~~~---i~i~~s~g~~~~e~l~~L~~aG~~~i~i~lEt~  173 (350)
T 3t7v_A           98 ETCKTLKGAGFHMVDLTMGEDPYYY-EDPNRFVELVQIVKEELG---LPIMISPGLMDNATLLKAREKGANFLALYQETY  173 (350)
T ss_dssp             HHHHHHTTSCCSEEEEEECCCHHHH-HSTHHHHHHHHHHHHHHC---SCEEEECSSCCHHHHHHHHHTTEEEEECCCBCS
T ss_pred             HHHHHHHHCCCCEEEEeeCCCCccc-cCHHHHHHHHHHHHhhcC---ceEEEeCCCCCHHHHHHHHHcCCCEEEEeeecC
Confidence            9999999999998888888632110 136789999999997653   455678899999999999999999999999997


Q ss_pred             -ccccccccCCCCcccc
Q 026651          218 -KRLQRIVRDPRAGLVM  233 (235)
Q Consensus       218 -~rlfp~Vcdtth~Y~~  233 (235)
                       +++|..|+ +.++|++
T Consensus       174 ~~~~~~~i~-~~~~~~~  189 (350)
T 3t7v_A          174 DTELYRKLR-VGQSFDG  189 (350)
T ss_dssp             CHHHHHHHS-TTCCHHH
T ss_pred             CHHHHHHhC-CCCCHHH
Confidence             99999999 8898875

PyMOL of 3t7v

>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1	Back alignment and structure

>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A*	Back alignment and structure

>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8}	Back alignment and structure

>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A*	Back alignment and structure

>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A*	Back alignment and structure

>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii}	Back alignment and structure

>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2	Back alignment and structure

>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii}	Back alignment and structure

>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale}	Back alignment and structure

>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A*	Back alignment and structure

>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1	Back alignment and structure

>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima}	Back alignment and structure

>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A	Back alignment and structure

>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A	Back alignment and structure

>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A	Back alignment and structure

>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1	Back alignment and structure

>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1	Back alignment and structure

>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1	Back alignment and structure

>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3}	Back alignment and structure

>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima}	Back alignment and structure

>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A	Back alignment and structure

>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A*	Back alignment and structure

>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A*	Back alignment and structure

>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1	Back alignment and structure

>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A	Back alignment and structure

>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A*	Back alignment and structure

>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha}	Back alignment and structure

>2y7e_A 3-keto-5-aminohexanoate cleavage enzyme; lyase, aldolase; 1.28A {Candidatus cloacamonas acidaminovoransorganism_taxid} PDB: 2y7d_A 2y7f_A* 2y7g_A	Back alignment and structure

>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A*	Back alignment and structure

>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1	Back alignment and structure

>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A	Back alignment and structure

>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A*	Back alignment and structure

>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A*	Back alignment and structure

>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2	Back alignment and structure

>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis}	Back alignment and structure

>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp}	Back alignment and structure

>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A	Back alignment and structure

>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis}	Back alignment and structure

>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A*	Back alignment and structure

>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4	Back alignment and structure

>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1	Back alignment and structure

>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A	Back alignment and structure

>3lot_A Uncharacterized protein; protein of unknown function, structural genomics, joint CENT structural genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus}	Back alignment and structure

>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica}	Back alignment and structure

>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C*	Back alignment and structure

>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0	Back alignment and structure

>3e49_A Uncharacterized protein DUF849 with A TIM barrel; structural genomics, joint center for structural genomics; HET: MSE; 1.75A {Burkholderia xenovorans LB400}	Back alignment and structure

>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5	Back alignment and structure

>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica}	Back alignment and structure

>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ...	Back alignment and structure

>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp}	Back alignment and structure

>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1	Back alignment and structure

>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0	Back alignment and structure

>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A*	Back alignment and structure

>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A*	Back alignment and structure

>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1	Back alignment and structure

>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp}	Back alignment and structure

>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A*	Back alignment and structure

>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1	Back alignment and structure

>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp}	Back alignment and structure

>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A*	Back alignment and structure

>3e02_A Uncharacterized protein DUF849; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia xenovorans LB400}	Back alignment and structure

>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis}	Back alignment and structure

>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A	Back alignment and structure

>3c6c_A 3-keto-5-aminohexanoate cleavage enzyme; DUF849 family protein, TIM beta/alpha-barrel fold, structura genomics; HET: MSE; 1.72A {Ralstonia eutropha}	Back alignment and structure

>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A	Back alignment and structure

>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5	Back alignment and structure

>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B*	Back alignment and structure

>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1	Back alignment and structure

>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1	Back alignment and structure

>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A	Back alignment and structure

>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp}	Back alignment and structure

>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		235
d1r30a_		312	c.1.28.1 (A:) Biotin synthase {Escherichia coli [T	2e-05
d1muwa_		386	c.1.15.3 (A:) D-xylose isomerase {Streptomyces oli	7e-04

>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Length = 312	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]

 Score = 42.2 bits (98), Expect = 2e-05
 Identities = 21/177 (11%), Positives = 47/177 (26%), Gaps = 14/177 (7%)

Query: 52  KPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGD 111
           +P W   +             L    L  +  EAQ   +            +  + +   
Sbjct: 1   RPRWTLSQV----------TELFEKPLLDLLFEAQ--QVHRQHFDPRQVQVSTLLSIKTG 48

Query: 112 TCTRGCRFCAV-KTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFA 170
            C   C++C      +     + +         A                  +       
Sbjct: 49  ACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMP 108

Query: 171 RTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDP 227
              + ++  K   +  C+T     + +A     ++GLD + HN++T       +   
Sbjct: 109 YLEQMVQGVKAMGLEACMTLGTLSESQAQRL-ANAGLDYYNHNLDTSPEFYGNIITT 164

PyMOL of d1r30a_

>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Length = 386	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		235
d1r30a_		312	Biotin synthase {Escherichia coli [TaxId: 562]}	99.66
d1tv8a_		327	Molybdenum cofactor biosynthesis protein A MoaA {S	97.34
d1olta_		441	Oxygen-independent coproporphyrinogen III oxidase	94.26
d1tqxa_		221	D-ribulose-5-phosphate 3-epimerase {Plasmodium fal	93.35
d1ub3a_		211	Deoxyribose-phosphate aldolase DeoC {Thermus therm	92.08
d1mxsa_		216	KDPG aldolase {Pseudomonas putida [TaxId: 303]}	91.88
d1wbha1		213	KDPG aldolase {Escherichia coli [TaxId: 562]}	91.64
d1vhca_		212	Hypothetical protein HI0047 {Haemophilus influenza	91.22
d1h1ya_		220	D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa	90.97
d1h5ya_		252	Cyclase subunit (or domain) of imidazoleglycerolph	89.98
d1o0ya_		251	Deoxyribose-phosphate aldolase DeoC {Thermotoga ma	89.03
d1ka9f_		251	Cyclase subunit (or domain) of imidazoleglycerolph	88.68
d1mzha_		225	Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli	88.18
d1n7ka_		234	Deoxyribose-phosphate aldolase DeoC {Archaeon Aero	87.61
d1thfd_		253	Cyclase subunit (or domain) of imidazoleglycerolph	85.34
d1eepa_		388	Inosine monophosphate dehydrogenase (IMPDH) {Lyme	85.22
d1jvna1		323	Cyclase subunit (or domain) of imidazoleglycerolph	83.71
d7reqb2		163	Methylmalonyl-CoA mutase beta subunit, C-terminal	81.34
d1thfd_		253	Cyclase subunit (or domain) of imidazoleglycerolph	80.61
d1qpoa1		169	Quinolinic acid phosphoribosyltransferase (Nicotin	80.55

>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]

Probab=99.66  E-value=1.9e-16  Score=136.86  Aligned_cols=156  Identities=13%  Similarity=0.204  Sum_probs=120.0

Q ss_pred             HHHHHHccCChHhhhhhcCCCCcc-ceeCCCCCCce-eeeeeecCCCCCCCCCCcccCCCC-C----CCCCCchhHHHHH
Q 026651           68 EVKESLSSLKLNTVCEEAQCPNIG-ECWNGGGDGIA-TATIMLLGDTCTRGCRFCAVKTSR-N----PAPPDPMEPENTA  140 (235)
Q Consensus        68 ~~~~~l~~~~L~TVCeeA~CPNi~-ec~~~~~~~~~-taT~mIlG~~CtedC~FCAQSt~~-~----p~~ld~eE~~~~A  140 (235)
                      ++.+|+ +..|.+++..|+  .+. +.|+++  -.- ...+++.++.|+.+|.||+++... .    ...++.|++++.|
T Consensus         8 e~~~L~-~~~~~dL~~~A~--~v~r~~~~~~--~~~~~~~~~~~TngC~~~C~fC~~~~~~~~~~~~~~~~~~e~i~~~~   82 (312)
T d1r30a_           8 QVTELF-EKPLLDLLFEAQ--QVHRQHFDPR--QVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESA   82 (312)
T ss_dssp             TTHHHH-HSCHHHHHHHHH--HHHHHHSCTT--CCEEEEEEEEECSCBSSCCSSCSCBTTSCTTCCCCCCCCHHHHHHHH
T ss_pred             HHHHHH-cCCHHHHHHHHH--HHHHHHcCCC--EEEEeeeeEeeCCCCCCcCCcCCCCccCCCCCccccccchHHHHHHH
Confidence            455666 567888888887  663 445433  111 223335599999999999998422 1    1357899999999


Q ss_pred             HHHHHcCCcEEEEEeecCCCCCCCchHHHHHHHHHHHhhCCCceEEEeecCCCCCHHHHHHHHhcCCCeeccCccccccc
Q 026651          141 KAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRL  220 (235)
Q Consensus       141 ~aa~~~Gl~y~VVTSg~RddL~D~ga~~~a~~Ir~Ik~~~p~~~ievl~sdg~l~~e~l~~L~eAG~d~ynHNLETs~rl  220 (235)
                      +.+.+.|+..+++.++... ..+..++.+.+.|+.+++..    +.++++.+.++++.+++|++||++.+.+++||++++
T Consensus        83 ~~~~~~G~~~~~~~~g~~~-~~~~~~~~~~~~i~~~~~~~----~~~~~~~~~l~~e~l~~lk~aG~~~i~~~iEs~~~~  157 (312)
T d1r30a_          83 RKAKAAGSTRFCMGAAWKN-PHERDMPYLEQMVQGVKAMG----LEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEF  157 (312)
T ss_dssp             HHHHHTTCSEEEEEECCSS-CCTTTHHHHHHHHHHHHHTT----SEEEEECSSCCHHHHHHHHHHCCCEEECCCBSCHHH
T ss_pred             HHHHHcCCEEEEEccCCCC-CchhhHHHHHHHHHhccccc----ceeeeccccchHHHHHHhhcccceeEecccchhhhh
Confidence            9999999986666555332 34567999999999998754    467788899999999999999999999999999999


Q ss_pred             cccccCCCCccccc
Q 026651          221 QRIVRDPRAGLVMQ  234 (235)
Q Consensus       221 fp~Vcdtth~Y~~s  234 (235)
                      +..++ +.++|++.
T Consensus       158 ~~~~~-~~~~~~~~  170 (312)
T d1r30a_         158 YGNII-TTRTYQER  170 (312)
T ss_dssp             HHHHC-CSSCHHHH
T ss_pred             hccCC-CCCCHHHH
Confidence            99999 89998764

PyMOL of d1r30a_

>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}	Back information, alignment and structure

>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}	Back information, alignment and structure

>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}	Back information, alignment and structure

>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure